CLUSTAL format seed alignment for MF_00719

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

COBS_FUSNN       --------------------------------MKGFLLLLSFMTRIPMPKTDYD-EEKLG
COBS_CLOD6       --------------------------------MKRFILILQFLTRIPIKLNVGF-DDEFY
COBS_CLOAB       -----------------------------MAFFRRLILMIQFLTRIPIKYESDITTEDFG
COBS_HUNT2       -----------------------------MKYLKRILLMVGFLTRIPVPFKIDGTEEDYG
COBS_CALS4       -----------------------------MEELKALILSIQFMTGIPIPINIDVKEDKIY
COBS_CLOTE       -----------------------------MKYIYNFLLMIQFLTRIPVKRSLPCEKEDFR
COBS_LISMO       --------------------------------MKTLILLIQFFTRIPLPIQINMDEINLK
COBS_LISMF       --------------------------------MKTLILLIQFFTRIPLPVQINMDEINLK
COBS_LISIN       --------------------------------MKTLILLIQFFTRIPLPIQINMDEINLK
COBS_LISW6       --------------------------------MKTLILLIQFFTRIPIPIAINMDEVNLK
COBS_CLONN       --------------------------------MKNLILMIQFFTRIPINIEIDVKEDSFA
COBS_ALKOO       --------------------------------MKSLLLMMTFFTRIPVTYPYDYDEKDFI
COBS_CLOP1       ----------------------------MKIFYKAINMTLSMFTVIPLPK-YEWDDRAAK
COBS_CLOPE       ----------------------------MKIFYKAINMTLSMFTVIPSPK-YEWDDRAAK
COBS_CLOPS       ----------------------------MKIFYKAINMTLSMFTVIPLPK-YEWDDRAAK
COBS_CLOB8       ----------------------------MKKLYKGFIMALSMFTILPTPY-VEWDDDGVK
COBS_GEOKA       ----------------------------MKQAWNGWLLALQLFTTIPIRRSIAWNAAHVR
COBS_GEOTN       ----------------------------MRQMWNGWLLALQLFTVIPIRRSIEWNDIHVR
COBS_BACHD       ----------------------------MKHGLNGLLLAFQFLTTVPITRQIPWTARSAR
COBS_ECOLI       -------------------------------MSKLFWAMLSFITRLPVPRRWSQGLDFE-
COBS_ECO57       -------------------------------MSKLFWAMLSFITRLPVPRRWSQGLDFE-
COBS_SHIFL       -------------------------------MSKLFWAMLSFITRLPVPRRWSQGLDFE-
COBS_SHIF8       -------------------------------MSKLFWAMLSFITRLPVPRRWSQGLDFE-
COBS_ECOHS       -------------------------------MSKLFWAMLSFITRLPVPRRWSQGLDFE-
COBS_SHISS       -------------------------------MSKLFWAMLSFITRLPVPRRWSQGLDFE-
COBS_ECO24       -------------------------------MSKLFWAMLSFITRLPVPRRWSQGLDFE-
COBS_ECOL5       -------------------------------MSKLFWAMLSFITRLPVPRRWSQGLDFE-
COBS_ECOL6       -------------------------------MSKLFWAMLSFITRLPVPRRWSQGLDFE-
COBS_SHIDS       -------------------------------MSKLFWAMLSFITRLPVPRRWSQGLDFE-
COBS_SHIBS       -------------------------------MSKLFWAMLSFITRLPVPRRWSQGLDFE-
COBS_ECOLC       -------------------------------MSKLFWAMLSFITRLPVPRRWSQGLDFE-
COBS_SALTY       -------------------------------MSKLFWAMLAFISRLPVPSRWSQGLDFE-
COBS_SALCH       -------------------------------MSKLFWAMLAFISRLPVPSRWSQGLDFE-
COBS_SALTI       -------------------------------MSKLFWAMLAFISRLPVPSRWSQGLDFE-
COBS_SALPA       -------------------------------MSKLFWAMLAFISRLPVPSRWSQGLDFE-
COBS_SALAR       -------------------------------MSKLFWATLSFISRLPVPSRWAQGLDFE-
COBS_CITK8       -------------------------------MSKLFWAMLAFISRLPVPTRWSQGLDFE-
COBS_KLEP7       -------------------------------MIKSFFAALSFISRLPVPARLSQGLEIE-
COBS_ROSS1       --------------MSSEDTTSQRAPRNWWGPFAPIGEALRFLTILPVPGL--PPMSEE-
COBS_CHLCH       -------------------------------MLGGLVTALRTLTILPIP-------GKD-
COBS_CHLPM       -------------------------------MLSGLVSAIRTLTIFSVP-------GKD-
COBS_CHLTE       -------------------------------MLSGLVTALRTLTALPVP-------GRD-
COBS_VIBCH       ------------------------MAAILRYQLELFLLAVSFFSRIPV----PVSLPYS-
COBS_VIBC3       ------------------------MAAILRYQLELFLLAVSFFSRIPV----PVSLPYS-
COBS_VIBVY       -------------------------MKTWQYQYQLFCLAVSFFSRLPV----PKSTPYS-
COBS_VIBVU       -------------------------MKTWQYQYQLFCLAVSFFSRLPV----PKSTPYS-
COBS_VIBPA       -----------------MSESKSSRQATLRYQMELFLLAVSFFSRLPV----PSDLPYS-
COBS_PSEA6       ------------------------MTRFLNYQFNLILLAVSFFTRLPV----PTAIDYS-
COBS_SHESW       ----------------------MSERESWHKEIDLFLVAMGYFTRIPM----PKWVEVD-
COBS_SHEPC       ----------------------MSERESWHKEIDLFLVAMGYFTRIPM----PKWVEVD-
COBS_SHEB8       ----------------------MSERESWHKEIDLFLVAMGYFTRIPM----PKWVEVD-
COBS_SHEB9       ----------------------MSERESWHKEIDLFLVAMGYFTRIPM----PKWVEVD-
COBS_SHEB5       ----------------------MSERESWHKEIDLFLVAMGYFTRIPM----PKWVEAD-
COBS_SHESM       ----------------------MSERESWHKEIDLFLVAMGYFTRIPM----PKWVEVD-
COBS_SHESR       ----------------------MSERESWHKEIDLFLVAMGYFTRIPM----PKWVEVD-
COBS_SHESA       ----------------------MSERESWHKEIDLFLVAMGYFTRIPM----PKWVEVD-
COBS_SHEON       ----------------------MSERESWHKEIDLFFVAMGYFTRIPM----PKWVEVD-
COBS_SHEFN       ----------------------MSGEIKWLRQLNLFFVAMSFFTRIPV----PSWVVID-
COBS_SHEDO       ----------------------MSNEYNWLRQLNLFFVATGFFTRLPT----PSWVIAD-
COBS_SHEPA       -------------------------MQAWQQQLNLFFIAMGFFTRIPM----PKWIEVD-
COBS_SHEHH       -------------------------MQLWQKQLNLFFIAMGFFTRIPM----PKWIEVD-
COBS_SHEAM       -------------------------MSTFKRELELFLLALTFFTRIPV----PVKLDYS-
COBS_AROAE       -------------------------MTTMRYQLELFFTALGFFTRLPV----PAWVPWS-
COBS_RALSO       ------------------------MMAALREACRSLWIAIGYFTRIPV----PASVGFS-
COBS_LEPIC       -------------------------MNKLQEEWNRFCASWMFNTRLPI----LPFYVYS-
COBS_LEPIN       -------------------------MNKLQEEWNRFCASWMFNTRLPI----LPFYVYS-
COBS_POLSJ       -------------------------MNPISQFVREYLLAVQFFTRIPVVGRLADWVGYS-
COBS_POLNA       ----------------------------MLQFIRHYLLAVQFFTRIPVTGRLADWVGYS-
COBS_RHOFT       ----------------------------MSQFIRHYLLSLQFFTRIPVTGRLANWVGFS-
COBS_BRADU       ---------------------MIPGTETIRNVIADLRIAASFVTLLPVG---SSKPAAD-
COBS_RHILO       -------------------MKLPNLTLSPRQILDDVALCLVFFTRLPLP---DLDFRGR-
COBS_SINMW       -------------------------MTEIREFWDDVARSVAFLSRIPVP---DRHFRGH-
COBS_RHIME       -------------------------MADIRELWDDVARSVAFLSRIPVP---DRYFHGY-
COBV_SINSX       -------------------------MGFVGDFCDDVARSIGFLSRIPMP---ARHFEGY-
COBS_RHIEC       --------------------------MKIKDYAVDTARAVAFLSRLPMP---PALFNGY-
COBS_RHIL3       --------------------------MKIKDYAVDTARAVAFLSRIPMP---QSLFKGY-
COBS_BRUAB       --------------------------MQRNGLIGDTIRSLGFLSRLPLP---QGWFDNT-
COBS_BRUSU       --------------------------MQRNGLIGDTIRSLGFLSRLPLP---QGWFDNT-
COBS_BRUSI       --------------------------MQRNGLIGDTIRSLGFLSRLPLP---QGWFDNT-
COBS_BRUC2       --------------------------MQRNGLIGDTIRSLGFLSRLPLP---QGWFDNT-
COBS_BRUA2       --------------------------MQRNGLIGDTIRSLGFLSRLPLP---QGWFDNT-
COBS_BRUME       --------------------------MQRNGLIGDTIRSLGFLSRLPLP---QGWFDNT-
COBS_BRUO2       --------------------------MQRNGLIGDTIRSLGFLSRLPLP---QGWFDNT-
COBS_OCHA4       --------------------------MQRNSLIGDTIRSLGFLSRLPLP---QRWFEDG-
COBS_AZOC5       --------------------------MRHSRILADVGAALRFYSRIPVP---AGAAEDAF
COBS_PSEAE       ----------------------------MREALRSLLVALQFLTRLPVRLSAMPTPEQF-
COBS_PSEAB       ----------------------------MREALRSLLVALQFLTRLPVRLSAMPTPEQF-
COBS_PSEA7       ----------------------------MREALQSLLVALQFLTRLPVRLSAMPTPEQF-
COBS_PSEF5       --------------------------------MLPFWIALQFLSSLPVRLPGMPRPEEL-
COBS_PSEPF       --------------------------------MLPLWIALQFLGSLPIRLPGMPTPEQL-
COBS_PSE14       --------------------------------MLPFWIALQFLGSLPIRLPGMPRPEEL-
COBS_PSEU2       --------------------------------MLPFWIALQFLGSLPIRLPGMPSPEEL-
COBS_PSESM       --------------------------------MLPFWIALQFLGSLPIRLPGMPRPAEL-
COBS_PSEPK       --------------------------------MLPFWIALQFLSSLPVSLPGMPAPREV-
COBS_PSEP1       --------------------------------MLPFWIALQFLSSLPVSLPGMPAPREV-
COBS_PSEPG       --------------------------------MLPFLIALQFLSSLPVSLPGMPAAREV-
COBS_PSEE4       --------------------------------MLPFWIALQFLSSLPVRLPGMPTPNEM-
COBS_PSEU5       --------------------------------MLPLLIALQFLTSLPIRLPAMPTPRQQ-
COBS_PSEMY       --------------------------------MIAPRIALQFLTRLPVSLPGMPTPEQI-
COBS_ALKEH       ----------------------------MTTAVRGLLLALAFLTRLPVWWLGPPRREDH-
COBS_SYNP6       -------------------------MIRQLW--TELNAAILFYTVLPLPQRWPTQFAGM-
COBS_SYNE7       -------------------------MIRQLW--TELNAAILFYTVLPLPQRWPTQFAGM-
COBS_NOSS1       -------------------------MVKLLL--LNLLASIIFYTNIPLPYINGLDFQRV-
COBS_TRIV2       -------------------------MVKLLL--LNLLASIIFYTSIPLPYIKGLDFQKV-
COBS_THEEB       --------------------------MKSLW--QEWLGAIAFYTCLPISPRWPIQLAGA-
COBS_SYNY3       --------------------MEWWRRWYFLWGGDSVGAAILFYTRLPWPPSWPVNFDRI-
COBS_PROM3       --------------------------MRAPLWLRDLAGAWIFYSVLPAWPGLKPRFERI-
COBS_PROMM       --------------------------MRAPLWLRDLAGAWIFYSVLPAWPGLKPRFERI-
COBS_PROMA       --------------------------MSSPNWLKDLTGAWLFYTVFPKLTRINPRFERI-
COBS_MYCTU       -------------------------------MMRSLATAFAFATVIPTPG--SATTPMGR
COBS_MYCTA       -------------------------------MMRSLATAFAFATVIPTPG--SATTPMGR
COBS_MYCBO       -------------------------------MMRSLATAFAFATVIPTPG--SATTPMGR
COBS_MYCBP       -------------------------------MMRSLATAFAFATVIPTPG--SATTPMGR
COBS_MYCUA       -------------------------------MIRSLATALSFGTVIPVPA--SVAAPMGR
COBS_MYCA1       -------------------------------MMRSLATAFAFGTVLPMPA--GGRGPMGR
COBS_MYCPA       -------------------------------MMRSLATAFAFGTVLPVPA--GGRGPMGR
COBS_MYCGI       -------------------------------MTRSLAGAFAFATVMPVPS--RRAAIAGR
COBS_MYCVP       -------------------------------MISSLTGAFAFATVLPTPT--RATAMVGR
COBS_MYCS2       -------------------------------MIRSLAGAFAFGTVLPV----RASAGVGR
COBS_MYCSK       -------------------------------MIGSLAGAFAFGTVLPVPA--GSTATLGR
COBS_MYCSS       -------------------------------MIGSLAGAFAFGTVLPVPA--GSTATLGR
COBS_MYCSJ       -------------------------------MIGSLAGAFAFGTVLPVPT--GSTATLGR
COBS_FRACC       -------------------------------MMLEARTAFTLLTVLPLRGPEHTDRRLAG
COBS_CORGL       ---------MSGKAGFTPEDPEDSDNRHGNPLFEGIFTALNWMTVLPVPGASVFDRTTGA
COBS_CORGB       ---------MSGKAGFTPEDPEDSDNRHGSPLFEGIFTALNWMTVLPVPGASVFDRTTGA
COBS_COREF       ---------MSGKAHVT-------DGDHGPALTEGVTTALNWLSVLPIRGATTFDRITGA
COBS_METAC       ----------------------------MNSYLLAFKSGFGFLTTIPVGISMEGIDELMK
COBS_METMA       ----------------------------MNSYLLAFKSGFGFLSTIPVGITMEGIDELMK
COBS_METBF       ----------------------------MNSYLLAFKSGFGFLSTIPVGISMEGIDELMK
COBS_METBU       ----------------------------MSGFLLALRTTFGFLSTIPVGMSMEGLDELVK
COBS_PYRAB       -----------------------------------MRNILPFLTRIP----VKGDFEKAR
COBS_THEKO       -----------------------------------MRNILPFLTRIP----VKGDFEKAR
COBS_PYRHO       -----------------------------------MKNILPFLTRIP----IKGDFEKAR
COBS_PYRFU       -----------------------------------MKNLIQFMTRVP----IKGDFEKAR
COBS2_ARCFU      -------------------------------MIKAIRSAISFLTTLP----LGGDVEELR
COBS1_ARCFU      ------------------------------MALDLLRSSLGFLTTLP----VKGDVDVLR
COBS_THEAC       --------------------------------MKGLRSAFSFFTIIP------IKSELDE
COBS_THEVO       ------------------------------MMISGLRSSFSFFTLVP------SRQKDIG
COBS_PICTO       --------------------------------MQGLKSAISFFTIIP------VKADLNK
COBS_SULTO       -----------------------------MKIFKKIASQISFFTIIP--STKATLEEVAS
COBS_SULAC       ----------------------------MGRILKAILGQLSFFTIIP--SPSASLEEIAE
COBS_SACS2       ------------------------------MHLKEILAQFSFFTAIPV-KSSASLEEIAE
COBS_PYRCJ       --------------------------------MQCLRALLSFFTIIP----AGVAKLDFK
COBS_PYRAE       --------------------------------MRCLKSLLAFFTAFP----IGGAELSFK
COBS_PYRIL       --------------------------------MRCLKAVVAFFTALP----VGGAELDFS
COBS_METJA       ---------------------------MGITMFKEFKALLSFFTRIPIYVEDFDFENIAN
COBS_METTH       -----------------------------MNVTGKLRGLISFSTVLPLKSEASIEDIASL
COBS_CARHZ       -------------------------------MLTTFLLGLTFFTRIPVPGKLNFSEEKFN
COBS_DEIRA       MVQPSPAPVVTITPAPAPAAPSHPHGWKRKQEFKALHLALAFLTTLPLPHVRDVQPGDFA
COBS_METKA       ------------------------------MIRVEFLKVFRFLTVLPIGEHPKSPREIGE
                                                              ..             

COBS_FUSNN       ------KSMKYFPVVGIIVGFILLFFCIIFNFILKNISYSAVLPLMIIVVILTDLITTGA
COBS_CLOD6       ------KSIVYFPLVGFVIGILSYLIGWISMLLFEPFIAS-------IIITLAGVLITGG
COBS_CLOAB       ------KALALVPIVGLIIGGIMGVTYMLLVKVFFYKISA-------VLVLIEYIFLTGG
COBS_HUNT2       ------KGLVFAPVVGLLIGGILTILFYILKRFFPPGVTG-------ILLIAAYIMLTGG
COBS_CALS4       ------KIASYFPVVGLLIGGILYIAYLLLKDLFSREIVM-------TFLVAFSYILTRG
COBS_CLOTE       ------RGAAMLPLIGLIVGCIQWVVFYILSKIFPANITA-------IFIILVGMVLIGG
COBS_LISMO       ------KGSALLPFVGVIIGAWNWLIFTLVALVMPLPVAI-------IAGLFAEVIITGG
COBS_LISMF       ------KGSALLPFVGVIIGAWNWLIFTLVALLMPLPVAI-------IAGLFAEIIITGG
COBS_LISIN       ------KGSALLPLVGVVIGAWNWLVFSLVALVMPLPVAI-------IAGLFAEIIITGG
COBS_LISW6       ------KGSALLPFVGLIIGAWNWLVFTLVALVMPLPVAI-------IAGLFAEIIITGG
COBS_CLONN       ------KGISYLPLVGLIIGGFNAIVYFVSSKFILGTLPI-------VLALLANTIITGA
COBS_ALKOO       ------KGVKFLPVIGLLIGILMYLP-TLLAPYIHRPIII-------VSIWALYFLITGG
COBS_CLOP1       ------HIMKLYPFIGLIIGALWYLSFFVLSK-LNVPIML-----MAALILTVPYILTGF
COBS_CLOPE       ------HIMKLYPFIGLIIGALWYLSFFVLSK-LNVPIML-----MAALILTVPYILTGF
COBS_CLOPS       ------HIMKLYPFIGLIIGILWYLSFFVLSK-LNVPIML-----MAALILTVPYILTGF
COBS_CLOB8       ------NMMKFYPLIGLIIGVLWSIIYYLASI-LNASIIL-----KSSIITIVPFIITGM
COBS_GEOKA       ------WLVRCMPLAGALIGALSAGVYALFSTFSFSSPLV-----WALLLLWLGIWMAGG
COBS_GEOTN       ------WLVRSMPLAGAAIGALAAGTYALCSMFSFGTPLF-----LALFLLWLGIWLAGG
COBS_BACHD       ------WSIVCYPLTGLVLGGLLVSLYLLLS--PFLSPLV-----LAALLVTLSIFYSGG
COBS_ECOLI       ---HYSRGIITFPLIGLLLGAISGLVFMVLQAWCGA-------PLAALFSVLVLVLMTGG
COBS_ECO57       ---HYSRGIITFPLIGLLLGAISGLVFMVLQAWCGA-------PLAALFSVLVLVLMTGG
COBS_SHIFL       ---HYSRGIITFPLIGLLLGAISGLVFMVLQAWCGA-------PLAALFSVLVLALMTGE
COBS_SHIF8       ---HYSRGIITFPLIGLLLGAISGLVFMVLQAWCGA-------PLAALFSVLVLALMTGE
COBS_ECOHS       ---HYSRGIITFPLIGLLLGAISGLVFMVLQAWCGV-------PLAALFSVLVLALMTGG
COBS_SHISS       ---HYSRGIITFPLIGLLLGAISGLVFMVLQAWCGV-------PLAALFSVLVLALMTGG
COBS_ECO24       ---HYSRGIITFPLIGLLLGAISGLVFMVLQAWCGV-------PLAALFSVLVLALMTGG
COBS_ECOL5       ---HYSRGIITFPLIGLLLGAISGLVFMVLQAWCGV-------PLAALFSVLVLALMTGG
COBS_ECOL6       ---HYSRGIITFPLIGLLLGAISGLVFMVLQAWCGV-------PLAALFSVLVLALMTGG
COBS_SHIDS       ---HYSRGIITFPLIGLLLGAISGLVFMVLQAWCGV-------PLAALFSVLVLALMTGG
COBS_SHIBS       ---HYSRGIITFPLIGLLLGAISGLVFMVLQAWCGV-------PLAALFSVLVLALMTGG
COBS_ECOLC       ---HYSRGIITFPLIGLLLGAISGLVFMVLQAWCGV-------PLAALFSVLVLALMTGG
COBS_SALTY       ---QYSRGIVMFPFIGLILGGVSGLIFILLQPWCGI-------PLAALFCILALALLTGG
COBS_SALCH       ---QYSRGIVMFPFIGLILGGVSGLIFILLQSWCGI-------PLAALFCILALALLTGG
COBS_SALTI       ---QYSRGIVMFPFIGLILGGISGLIFILLQPWCGI-------PLAALFCILALALLTGG
COBS_SALPA       ---QYSRGIVMFPFIGLILGGISGLIFILLQSWCGI-------PLAALFCILALALLTGG
COBS_SALAR       ---QYSRGIVMFPLIGAILGGLSGLIFILLQPWCGI-------PLAALFCILALALLTGG
COBS_CITK8       ---EYSRGIVTFPLIGMLLGAIGGLVFVALQSWCGI-------PLAALFCVLTLALLTGG
COBS_KLEP7       ---QYQRSIVTFPLVGLLLGAIAGAVALLLQPWCGV-------PLAALFGVLALALLTGG
COBS_ROSS1       ---AIPQSIRYFPIAGLVIGGILAAVGWGAGVLWNE-------TVRAVVLVVAWGVLTAG
COBS_CHLCH       -AVTFSHSLYWFPFVGLLLGALLAALGYVGSLSGWH-------EFAALLVVLGGIVLTRG
COBS_CHLPM       -AENFSSSLYWFPVVGAFLGTLLAACAWLPLSIGWS-------ELASAVVVVGGFIVSRG
COBS_CHLTE       -AERFSSSLYWFPVVGLVIGGIVVLLARAGMGVGWP-------ELAAVLALLGGLILTRG
COBS_VIBCH       -SERMNQAGRYFALVGLLLGAICALVYSLATQLFS-------TNISVFLTMVLSLLLTGA
COBS_VIBC3       -SERMNQAGRYFALVGLLLGAICALVYSLATQLFS-------TNISVFLTMVLSLLLTGA
COBS_VIBVY       -DERMNQAGRYFALVGTLLGLLCVLVYAFASLFFP-------YQVAIVLMMAFSLLLTGA
COBS_VIBVU       -DERMNQAGRYFALVGTLLGLLCVLVYAFASLFFP-------YQVAIVLMMAFSLLLTGA
COBS_VIBPA       -EERMNQAGRYFALVGVILGVLCALVFYFTQLIFP-------DSVAIVLTMAFSLLLTGA
COBS_PSEA6       -PQKLHQAGRYFPLVGWLLAALLSAFYCFMLPYLG-------REPTVCLLIIFSLMLTGA
COBS_SHESW       -SDKLNKASRYFGLVGLLIGLLSAIVFWLTQNWLP-------AGVSVLLAMLVGVLLTGG
COBS_SHEPC       -SDKLNKASRYFGLVGLLIGLLSAIVFWLTQNWLP-------AGVSVLLAMLVGVLLTGG
COBS_SHEB8       -SDKLNKASRYFGLVGLLVGLLSAIVFWLTQNWLP-------AGVSVLLAMLVGVLLTGG
COBS_SHEB9       -SDKLNKASRYFGLVGLLVGLLSAIVFWLTQNWLP-------AGVSVLLAMLVGVLLTGG
COBS_SHEB5       -SDKLNKASRYFGLVGLLVGLLSAIVFWLTQNWLP-------AGVSVLLAMLVGVLLTGG
COBS_SHESM       -ADKLNKASRYFGLVGLLVGLLSAIVFWLTQNWLP-------AGVSVLLSMVTGVLLTGG
COBS_SHESR       -ADKLNKASRYFGLVGLLVGLLSAIVFWLTQNWLP-------AGVSVLLSMVTGVLLTGG
COBS_SHESA       -ADKLNKASRYFGLVGLLVGLLSAIVFWLTQNWLP-------AGVSVLLSMVTGVLLTGG
COBS_SHEON       -ADKLNKASRYFGLVGLLVGLLSAIIFWLTQNWLP-------AGVSVLLSMLTGILLTGG
COBS_SHEFN       -SDKLNKASRYFGLVGLLIGLICALVFWLAQLILP-------ASIAILLAMVAGVLVTGA
COBS_SHEDO       -DNELKKSSRYFGLVGLLIGLICALVYWFTQQWLP-------TSVAVLLAMVAGVLVTGG
COBS_SHEPA       -ADKLNKASRYFGLVGLLVGAISALVYTLMLYWVS-------PSIAIVLAMITSVLVTGG
COBS_SHEHH       -ADKLNKASRYFGLVGLLVGAISAAVYSLMLYWVS-------PSVAIVFAMITSVLVTGG
COBS_SHEAM       -GEGLNRASRYFGLVGTLVGLIAALVFYLTQFIFP-------ASVAVVLAMIATVLLTGG
COBS_AROAE       -PERLNHAARFFPLVGWVVGAIGAASYLAFVQLLP-------PALAVLLSMAVTIRATGA
COBS_RALSO       -QDGLNRAARFFPLVGWLVGAAGALAYWLASRTVPA------PGVAVAASMAATLLLTGA
COBS_LEPIC       -ESTLSRSSRYFPLIGWIVSAGTSYSTYFLSWILP-------IEISIILGMILSVLITGG
COBS_LEPIN       -ESTLSRSSRYFPLIGWIVSAGTSYSTYFLSWILP-------IEISIILGMILSVLITGG
COBS_POLSJ       -PELLRASAGHFPGVGILVGVMAALVYGLIQALLPNTPFT--PLVAAVLSTAATVLLTGG
COBS_POLNA       -PGMLRASAVHFPGIGVVVGGAAAAMFALLQLLLPDTTFT--PLVAAAFSTVATVWLTGG
COBS_RHOFT       -PAMLRASAGHFPGVGVLVGALVAAFTALLLFVLPRTGST--PLVAAALGTALGVLLTGA
COBS_BRADU       --GAIARATWALPVAGLLVGLAGALVYKISSRLGLT------PNLAALLALATTALITGA
COBS_RHILO       --G-LAAAIWAAPVAGLLVGLIGAIVFATAERFGLA------MGPAAALALVATVIATGC
COBS_SINMW       -DGGLGRAVRAFPLAGILIALPAAVTAVLLGAIHAS------SLFTAFLIVAAQATVTGA
COBS_RHIME       -DGGLGRAVRAFPLAAILITLPAAAIAFILGALHAS------SLFSAFLVVAVQAMVTGA
COBV_SINSX       -DGRLSRAVRAFPFAGLAIALPSAAVAMALMALQVS------SLFAAFVVVAIQALVTGA
COBS_RHIEC       -DGRLNRLVRAFPFAGLLIGFVPAVTLLLLLSLRTD------PLVAALVALSVQALVTGA
COBS_RHIL3       -DGRLGRLVRAFPFAGIVIGFIPALALLLLLGLRAD------PLMAALIALSIQVLVTGA
COBS_BRUAB       -DDSLPRNARAFPLAGGILGLLAGVALLIANAISLP------PLAAALIAIGALAAMTGA
COBS_BRUSU       -DDSLPRNARAFPLAGGILGLLAGVALLIANAISLP------PLAAALIAIGALAAMTGA
COBS_BRUSI       -DDSLPRNARAFPLAGGILGLLAGVALLIANAISLP------PLAAALIAIGALAAMTGA
COBS_BRUC2       -DDSLPRNARAFPLAGGILGLLAGVALLIANAISLP------PLAAALIAIGALAAMTGA
COBS_BRUA2       -DDSLPRNARAFPLAGGILGLLAGVALLIANAISLP------PLAAALIAIGALAAMTGA
COBS_BRUME       -DDSLPRNARAFPLAGGILGLLAGVALLIANAISLP------PLAAALIAIGALAAMTGA
COBS_BRUO2       -DDSLPRNARAFPLAGGILGLLAGVALLIANAISLP------PLAAALIAIGALAAMTGA
COBS_OCHA4       -DDSLPRNARAFPLAGAVLGLLAGAVLFMAYKVNLP------PLACAMLAIGALAAMTGA
COBS_AZOC5       APPDLKRIAYAVPLAGAAIGLAGAAILIGAHALGLP------NLVAAILAVLTCVLLTGA
COBS_PSEAE       -----GRAVLCYPLVGVLIGVVLYAAARSLD---GTPPL-----LQAALLLSLWVALSGA
COBS_PSEAB       -----GRAVLCYPLVGVLIGVVLYAAARSLD---GTPPL-----LQAALLLSLWVALSGA
COBS_PSEA7       -----GRAVLCYPLVGVLIGVVLYGAARSLD---GTPPL-----LQAALLLSLWVALSGA
COBS_PSEF5       -----GRSLLFYPLVGLLFGVLLWVLNAMLG---GVPLL-----LHAALLLTAWVLLSGG
COBS_PSEPF       -----GRSLLFYPLVGLLFGVILWALNIALA---GTPLL-----LHAALLLAVWVLLSGA
COBS_PSE14       -----GRSLLFYPLVGVVFGMLLLGFSALLS---GTPLM-----LHAALVLSAWVLLSGG
COBS_PSEU2       -----GRSLLFYPLVGAVFGTLLLGFNTLLS---GAPLM-----LHAALVLTAWVLLSGG
COBS_PSESM       -----GRSLLFYPLVGVVFGTLLLGFNALLS---GAPLL-----LHAALLLSAWVLLSGG
COBS_PSEPK       -----GRSLLYYPLVGLLFGLLLWLASHLLQ---GTPSP-----LHAALLLTLWVLLSGA
COBS_PSEP1       -----GRSLLYYPLVGLLFGLLLWLASHLLQ---GTPSP-----LHAALLLTLWVLLSGA
COBS_PSEPG       -----GRSLLYYPLVGLLFGLLLWLASHLLQ---GTPAP-----LHAALLLTAWVLLSGA
COBS_PSEE4       -----GRSLLFYPVVGLLFGLLLWLASHLLQ---GAPAP-----LHAALLLALWVLLSGA
COBS_PSEU5       -----GRSLLHYPAVGLFLGALLWLAALLLE---GASPL-----LQAALLLALWVALTGA
COBS_PSEMY       -----GRSLLWYPAVGLLLGLLLWLAHLLLG---QTPDV-----LQAAIILALWVGLSGG
COBS_ALKEH       -----AASLPAYPVVGLILGILLLALYALLQWFFPDQFV-----VQAALLVAAWALVTGL
COBS_SYNP6       --------SRWAPIVGLILGLILAVSDRLLAVGQFP------LPLRSLLIVLLAIALTGG
COBS_SYNE7       --------SRWAPIVGLILGLILAVSDRLLAVGQFP------LPLRSLLIVLLAIALTGG
COBS_NOSS1       --------ARLVPTVGLIIGGILGLFDGGMNYLGMP------VLTRSALVVVLWIFITGG
COBS_TRIV2       --------ARLVPMVGLIIGVILGLLDGGMNYLGMP------VLTRSALVVALWIFITGG
COBS_THEEB       --------AKWCPWVGLVLGGMLWGVQWLLDFLQVP------SPVASAVLVALWLALTGG
COBS_SYNY3       --------ARWITLMGLLLSLILLALDRGLHWLGMD------NLLQSAVVVSLWLALTGG
COBS_PROM3       --------ARFAPWIGLVLGGLQSFLWLVLIRADWP------TSAVALLVIGLGAWLSGG
COBS_PROMM       --------ARFAPWIGLVLGGLQSFLWLVLIRADWP------TSAVTLLVIGLGAWLSGG
COBS_PROMA       --------ARFSPLIGVLIGVLQVSVLILLLQLQWP------NESMPFIAIALGLWITGG
COBS_MYCTU       ------GPMTALPVVGAALGALAAAIAWAGAQVFGP-----SSPLSGMLTVAVLLVVTRG
COBS_MYCTA       ------GPMTALPVVGAALGALAAAIAWAGAQVFGP-----SSPLSGMLTVAVLLVVTRG
COBS_MYCBO       ------GPMTALPVVGAALGALAAAIAWAGAQVFGP-----SSPLSGMLTVAVLLVVTRG
COBS_MYCBP       ------GPMTALPVVGAALGALAAAIAWAGAQVFGP-----SSPLSGMLTVAVLLVVTRG
COBS_MYCUA       ------GAMTALPVVGVVLGGLAAGVTWSASLVFGP-----VSPLPGLLAVAVLLLATRG
COBS_MYCA1       ------GAMTALPVVGLALGALAAAVAWGGTVVFGR-----SSPLGGLLAVAALLLITRG
COBS_MYCPA       ------GAMTALPVVGLALGALAAAVAWGGAVVFGR-----SSPLGGLLAVAALLLITRG
COBS_MYCGI       ------GVLTALPVVGLVLGSAAAAVCWLGTRAFGS-----GSVLAGALTVAVLLLATRG
COBS_MYCVP       ------GVLTALPVAGAALGVLAAGVLWAGSWAFGD-----GSALAGVLTVAVLLLATRG
COBS_MYCS2       ------GALTALPFVGLALGALAAAVVWAGGWAFAA-----GSPLPGVLAVAVLLLATRG
COBS_MYCSK       ------GVMTALPGVGIVLGAVAAAVLWAGSWAFGP-----HSALAGLLAVAVLLLATRG
COBS_MYCSS       ------GVMTALPGVGIVLGAVAAAVLWAGSWAFGP-----HSALAGLLAVAVLLLATRG
COBS_MYCSJ       ------GVMTALPGVGIVLGAVAAAVLWAGSWAFGP-----HSALAGLLAVAVLLLATRG
COBS_FRACC       ------RAMALAPFVGLALGLLAGSAVFATRIVTAVPGQRAQTLLPAVVGVTVLALVTRG
COBS_CORGL       ------RVMASLPFVGFVFGMFTAIIMWAIGPISGVIH--VDGLLVAVLIVAFWELLNRF
COBS_CORGB       ------RVMASLPFVGFVFGMFTAIIMWAIGPISGVIH--VDGLLVAVLIVAFWELLNRF
COBS_COREF       ------RVMASLPVVGVVFGVLTAVLL----GLLGVLG--VTPLLTAVLVVIMWELLNRM
COBS_METAC       ------KIYFYPVVGAVLGLLIGAIAYIGQLIFPDPVL--------AALIMGSVYYFTGF
COBS_METMA       ------KIFFYPVVGAVLGLLIGIVAYAGQLVFPGPVL--------AALIMGFVYYITGF
COBS_METBF       ------KIYFYPVVGAVLGLLIGAVAFIGQVIFPGPVL--------AALLMGFIYYITGF
COBS_METBU       ------RSYLQTFAGIVLGSMIGIFAYLTESFLPSTIS--------AVLIMVFIYYITGL
COBS_PYRAB       ------NELWAFPLVSLVSSIIPIAILYLRIPLANVLA--------LLSLYFVI----GL
COBS_THEKO       ------NELWAFPLVALVSSALPTLILYLGLPLSNLLA--------VLALYWTI----GL
COBS_PYRHO       ------RELWAFPLVSVFTSPLPALILYLKVPLASILA--------LLSLYFTI----GL
COBS_PYRFU       ------EEVWMLPLLTPLTAFIPSLILYLNIPLKNVLS--------ILSLYWVI----GL
COBS2_ARCFU      ------KNLWLFPYAAILIALIVSVPHFIRNFVDIRFL--------ALVLYLGAE---GI
COBS1_ARCFU      ------RNLWVFSFVGIFIGSVISIPAVL----GFWFL--------CVLLYVAIE---GV
COBS_THEAC       ------HLIAYVPLVALFDAALAASLYVAIYGISKLLA--------SFISVSAIYIVNGL
COBS_THEVO       ------NPITFLPLVVTVGALIGDSILYITWQFSHLIA--------SFLSISSIIIYNGL
COBS_PICTO       ------NIVFFFTITGAITGLMAASIFYLTSFINQLLA--------SVASVSFLIIIYGF
COBS_SULTO       ------ASFISPIIIGVITALIDYSVVFVTSKFLGNLA--------FLLLLPTVEIIRGF
COBS_SULAC       ------FSFISPLMVGIITGIIDWFVVLLGIRLIGSLG--------ALLLIPTVEIIRGF
COBS_SACS2       ------SSYISPIIVGISLGLIESVAYLILYRILGELT--------GIVLLGIIELLRGF
COBS_PYRCJ       ------CAWALPYVVPPLVAGPAAAALWLGASPHVAYL--------LLLLMTGL------
COBS_PYRAE       ------CVWALPYVAAPIIAAIPTTLLYLGASPAIAYI--------ALLAATGL------
COBS_PYRIL       ------CIWATPYLAGLMVGGAGGAVYFLTHSPAAAYA--------ALLLATGL------
COBS_METJA       -------YFYLIILIGYVFGIFSLILGYIFSFLLPNF-------LSAVLILFFIEYLNGF
COBS_METTH       --------TLHWPLVGALIGVAVGSAGVAASLVFPG-------AVVACVAYGFAIWFTGF
COBS_CARHZ       ------RAPIFLPAYGLVTGGILALIIELFGRSFPGF-------FWAGVIIAGQIYLSGA
COBS_DEIRA       ------RASAYYPLAGYAVGGLVAGLLYLNVPLPPG--------VVAALGVGLWLGLTGM
COBS_METKA       ------QAWLGLPAVGLVSGLLAGVVAWAFAGTPVR----------GCLVVLTLLVLEGA
                                                                             

COBS_FUSNN       LHLDGLADTFDGIFSYR-S-KHKMLEIMKDSRLGSNGALALILYFLLKFILLFSLTIESR
COBS_CLOD6       LHIDGLGDTFDAIYSYR-D-KEKMLEIMKDSRLGTNSLLAIMFVLLLKVGFVYDIISNN-
COBS_CLOAB       IHLDGLGDTFDGVFSNR-P-KERILEIMRDSRVGTNAVLAVISVIILNYVILTEIDPAY-
COBS_HUNT2       LHLDGLGDTFDGIFSNR-S-REKMLEIMRDSRIGTNAVLAVICVVILNYALLSSIPLSG-
COBS_CALS4       MHIDGLADTFDGLFSNK-D-REKIIEIMKDSRLGTNGVLALVFMVILKILFLSDIRQSL-
COBS_CLOTE       LHQDGLGDIFDGFFSFKGD-KEKIIEIMKDSRVGTFAVLALIFDILIKYSALSFIIENN-
COBS_LISMO       FHVDALADTADGLFSSR-K-RERMLEIMKDSRVGANGVIAICFYFLFYGALFLSVTDTQQ
COBS_LISMF       FHVDALADTADGLFSSR-K-RERMLEIMKDSRVGANGVIAICFYFLFYGSLFLSVPDTQQ
COBS_LISIN       FHVDALADTADGLFSSR-K-KERMLEIMKDSRVGANGVIAICFYFLFYGALFLSVPNIQQ
COBS_LISW6       FHVDALADTADGLFSSR-K-KERMLEIMKDSRVGANGVIAICFYFLFYGALFLSVPSAYE
COBS_CLONN       FHIDGLADTCDGIFSSR-K-KERMLEIMKDSRVGTNGAIAIVFDFMLRYAVLNSLNKKYI
COBS_ALKOO       LHIDGLADTFDGIFSYR-S-KEEMLRIMKDSRIGAFGVLGILWLLILNLTLAYYTENM--
COBS_CLOP1       LHLDGFMDVSDALLSRR-D-KETKLRILKDSTVGAFSVISVVLLLLVEFAGMFTVLNKNL
COBS_CLOPE       LHLDGFMDVSDALLSRR-D-KETKLRILKDSTVGAFSVISVVLLLLVEFAGMFTVLNKNL
COBS_CLOPS       LHLDGFMDVSDALLSRR-D-KETKLRILKDSTVGAFSVISVVLLLLVEFAGIFTVLNKNL
COBS_CLOB8       LHLDGFMDVCDAILSRR-S-KEEKLRILKDSATGAFAVIPLVILFFLQFGGVYSILEKNS
COBS_GEOKA       MHADGFMDVSDAFFSYR-D-VKRRQEIMSDPRVGAFAVLSLICLLSFRWLFLYESLQTGI
COBS_GEOTN       LHADGWMDVSDAFFSYR-D-AKRRQQIMSDSRVGAFAVLSLACLLSFRWLFLYETIKAEI
COBS_BACHD       LHLDGWMDVSDAFLSRR-D-RETKLIILKDSRVGAFAVMTTILLIGWKVLLLMELI--AL
COBS_ECOLI       FHLDGLADTCDGVFSAR-S-RDRMLEIMRDSRLGTHGGLALIFVVLAKILVLSELALRGE
COBS_ECO57       FHLDGLADTCDGVFSAR-S-RDRMLEIMRDSRLGTHGGLALIFVVLAKILVLSELALRGE
COBS_SHIFL       FHLDGLADTCDGVFSAR-S-RDRMLEIMRDSRLGTHGGLALIFVVLAKILVLSELALRGE
COBS_SHIF8       FHLDGLADTCDGVFSAR-S-RDRMLEIMRDSRLGTHGGLALIFVVLAKILVLSELALRGE
COBS_ECOHS       FHLDGLADTCDGVFSAR-S-RDRMLEIMRDSRLGTHGGLALIFVVLAKILVLSELALRGE
COBS_SHISS       FHLDGLADTCDGVFSAR-S-RDRMLEIMRDSRLGTHGGLALIFVVLAKILVLSELALRGE
COBS_ECO24       FHLDGLADTCDGVFSAR-S-RDRMLEIMRDSRLGTHGGLALIFVVLAKILVLSELALRGE
COBS_ECOL5       FHLDGLADTCDGVFSAR-S-RDRMLEIMRDSRLGTHGGLALIFVVLAKILVLSELALRGE
COBS_ECOL6       FHLDGLADTCDGVFSAR-S-RDRMLEIMRDSRLGTHGGLALIFVVLAKILVLSELALRGE
COBS_SHIDS       FHLDGLADTCDGVFSAR-S-RDRMLEIMRDSRLGTHGGLALIFVVLAKILVLSELALRGE
COBS_SHIBS       FHLDGLADTCDGVFSAR-S-RDRMLEIMRDSRLGTHGGLALIFVVLAKILVLSELALRGE
COBS_ECOLC       FHLDGLADTCDGVFSAR-S-RDCMLEIMRDSRLGTHGGLALIFVVLAKILVLSELALRGE
COBS_SALTY       FHLDGLADTCDGIFSAR-R-RERMLEIMRDSRLGTHGGLALIFVLLAKILVVSELALRGT
COBS_SALCH       FHLDGLADTCDGIFSAR-R-RERMLEIMRDSRLGTHGGLALIFVLLTKILVVSELALRGT
COBS_SALTI       FHLDGLADTCDGIFSAR-R-RERMLEIMRDSRLGTHGGLALIFVLLAKILVVSELALRGT
COBS_SALPA       FHLDGLADTCDGIFSAR-R-RERMLEIMRDSRLGTHGGLALIFVLLAKILVVSELALRGT
COBS_SALAR       FHLDGLADTCDGIFSAR-R-RERMLEIMRDSRLGTHGGLALIFVLLAKILVVSELALRGT
COBS_CITK8       FHLDGLADTCDGIFSAR-R-RERMLEIMRDSRLGTHGGLALIFVLLAKVLVISELALRGT
COBS_KLEP7       FHLDGLADTCDGIFSAR-T-RDRMLEIMRDSRLGTHGGLALIFVLVAKVLVVGELLLRDI
COBS_ROSS1       MHLDGLSDTFDGVMSWR-S-RERKLEIMRDSRIGVMGALALAAVLGLKAAF---LAGAGD
COBS_CHLCH       MHADGLADVADGFWGGR-S-KEAALRIMKDPTVGSFGALALSGVMLLKWVAVVRLLSFGL
COBS_CHLPM       MHADGLADMADGFWGGG-D-RERTLSIMKDPTVGSFGALALLSLMLLKWVAILRLTEHGA
COBS_CHLTE       LHADGLADLADGFFGGR-T-REAALRIMKDPNVGSFGSLALIGVMLFKWICLLELARAEA
COBS_VIBCH       FHEDGLADMADGVGGGM-T-AERRLEIMKDSRIGTYGSSALIMVLLGKYLLLTELADLT-
COBS_VIBC3       FHEDGLADMADGVGGGM-T-AERRLEIMKDSRIGTYGSSALIMVLLGKYLLLTELADLT-
COBS_VIBVY       FHEDGLTDMADGIGGGM-T-LDKRLTIMKDSRIGTYGSATLTMALIGKFVFLTTLARQP-
COBS_VIBVU       FHEDGLTDMADGIGGGM-T-LDKRLTIMKDSRIGTYGSATLTMALIGKFVFLTTLARQP-
COBS_VIBPA       FHEDGLTDMADGIGGGM-T-VERRLSIMKDSRIGTYGAATLVMALLAKFVLWSELVHLP-
COBS_PSEA6       IHEDGLADTADGFWGGQ-S-ITRKLTIMKDSQIGTYGTCALICALLSKFILLSSLAADQ-
COBS_SHESW       FHEDGLADTFDGFGGGW-T-AEDKLRIMKDSRLGSYGAIALILALLLKWQLLVELALYDP
COBS_SHEPC       FHEDGLADTFDGFGGGW-T-AEDKLRIMKDSRLGSYGAIALILALLLKWQLLVELALYDP
COBS_SHEB8       FHEDGLADTFDGFGGGW-T-AEDKLRIMKDSRLGSYGALALILALLLKWQLLVELALYDP
COBS_SHEB9       FHEDGLADTFDGFGGGW-T-AEDKLRIMKDSRLGSYGALALMLALLLKWQLLVELALYDP
COBS_SHEB5       FHEDGLADTFDGFGGGW-T-AEDKLRIMKDSRLGSYGALALMLALLLKWQLLVELALYDP
COBS_SHESM       FHEDGLADTFDGFGGGW-T-AEDKLRIMKDSRLGSYGALALMLVLMLKWQLLVELALYDP
COBS_SHESR       FHEDGLADTFDGFGGGW-T-AEDKLRIMKDSRLGSYGALALMLVLMLKWQLLVELALYDP
COBS_SHESA       FHEDGLADTFDGFGGGW-T-AEDKLRIMKDSRLGSYGALALMLVLMLKWQLLVELALYDP
COBS_SHEON       FHEDGLADTFDGFGGGW-T-AEDKLRIMKDSRLGSYGALALIMVLLLKWQLLVELALYDP
COBS_SHEFN       FHEDGLADTADGFGGGW-T-VEDKLRIMKDSRLGSYGALSLGLVLLLKWQLLVELALYSP
COBS_SHEDO       FHEDGLADTADGFLGGK-T-FEDKLRIMKDNHLGSYGAIVLALILLLRWQLLVELALFSP
COBS_SHEPA       FHEDGLADTADGLGGGW-T-VEAKLNIMKDSRLGSYGALALVLALLLKWQLLTELALFDP
COBS_SHEHH       FHEDGLADTADGLGGGW-T-VEAKLNIMKDSRLGSYGALALVLALLLKWQLLTELALFDP
COBS_SHEAM       FHEDGLADTADGFGGAF-E-RERKLEIMKDSRVGSYGSLALMLALLLKFQLLSELALYSV
COBS_AROAE       FHEDGWADACDGLGGGW-D-RLQVLTIMKDSRIGSYGTAGLVLMLLAKAAALVELAAHGN
COBS_RALSO       FHEDGLADCADGFGGGY-T-AEDRLRIMRDSRIGAFGAIAVCMALLLKWQLLMAMAAQHA
COBS_LEPIC       FHEDGLADVCDAFGGGW-S-KEKILEIMKDSRIGTFGSIGLILSLGLKYLLLVNLFKISP
COBS_LEPIN       FHEDGLADVCDAFGGGW-S-KEKILEIMKDSRIGTFGSIGLILSLGLKYLLLVNLFKISP
COBS_POLSJ       FHEDGLADVADGLGGSQ-D-RERALEIMKDSRVGAFGAMALMLALLGKTALLAMLGSVDV
COBS_POLNA       FHEDGLADVADGLGGSY-D-RERALEIMKDSRVGAFGAMALVLALLCKVALLALLGSVEA
COBS_RHOFT       FHEDGLADVFDGLGGSA-E-RERALVIMKDSRVGAFGAIAVMLALLCKVALLALLGAVSA
COBS_BRADU       LHEDGLADTADGLGGGR-T-RERKLEIMRDSRIGTYGVCALILSFGLRWSALAA---IAN
COBS_RHILO       LHEDGLSDVADGFGGGK-S-RGRKLDIMRDSRIGAYGAMALALSLLIRWNVLSE---LVD
COBS_SINMW       LHEDGLADTADGFGGGR-D-RESALEIMKDSRIGTYGAVALILSFGIRVSALAAFLPLLT
COBS_RHIME       LHEDGLGDTADGFGGGR-D-RESALEIMKDSRIGTYGAVALILSFGLRVSALAAFLPLLT
COBV_SINSX       LHEDGLGDTADGFGGGR-D-REAALAIMKDSRIGTYAAVALILSFGLRVSAFASILPLFS
COBS_RHIEC       LHEDGLADTADGIGGGS-S-REQSLIIMKDSRIGTYGAIALILSFAIRAAALAAIIRHSS
COBS_RHIL3       LHEDGLADTADGIGGGK-S-REQSLLIMKDSRIGTYGAIALILSLAIRAAALAVIARHSS
COBS_BRUAB       LHEDGLGDTADGFFGAS-T-PDRRLDIMKDSRIGTFAALTLVIWTGVKASLLMAIIARAG
COBS_BRUSU       LHEDGLGDTADGFFGAS-T-PDRRLDIMKDSRIGTFAALTLVIWTGVKASLLMAIIARAG
COBS_BRUSI       LHEDGLGDTADGFFGAS-T-PDRRLDIMKDSRIGTFAALTLVIWTGVKASLLMAIIARAG
COBS_BRUC2       LHEDGLGDTADGFFGAS-T-PDRRLDIMKDSRIGTFAALTLVIWTGVKASLLMAIIARAG
COBS_BRUA2       LHEDGLGDTADGFFGAS-T-PDRRLDIMKDSRIGTFAALTLVIWTGVKASLLMAIIARAG
COBS_BRUME       LHEDGLGDTADGFFGAS-T-PDRRLDIMKDSRIGTFAALTLVIWTGVKASLLMAIIARAG
COBS_BRUO2       LHEDGLGDTADGFFGAS-T-PDRRLDIMKDSRIGTFAALTLVIWTSVKASLLMAIIARAG
COBS_OCHA4       LHEDGLGDTADGFFGAS-S-PDRRLDIMKDSRIGTFAALTLIVFVGLKAALLMTIIDRAG
COBS_AZOC5       LHEDGLADTADGFGGGA-S-RLRRLEIMRDSRIGSYGACALVFSLLLRVALLDGLLAL-S
COBS_PSEAE       LHLDGLADMADAWVGGLGD-RERTLAIMKDPRSGPVAVVVLVLVLLLKFSALAALLGQGE
COBS_PSEAB       LHLDGLADMADAWVGGLGD-RERTLAIMKDPRSGPVAVVVLVLVLLLKFSALAALLGQGE
COBS_PSEA7       LHLDGLADMADAWVGGLGD-RERTLAIMKDPRSGPAAVVALVLVLLLKFGALAALLGAGR
COBS_PSEF5       LHLDGLADSADAWLGGFGD-RERTLSIMKDPRSGPIAVVTLVLVLLLKFTALVALIEQQQ
COBS_PSEPF       LHLDGLADSADAWLGGFGD-RERTLTIMKDPRSGPIAVVTLVLVLLLKFAALLALIEQQQ
COBS_PSE14       LHLDGLADSADAWLGGFGD-RERTLQIMKDPRSGPIAVVTLVLVLLLKFAAILALIESHS
COBS_PSEU2       LHLDGLADSADAWLGGFGD-RERTLKIMKDPRSGPIAVVTLVLVLLLKFAAILALIESHA
COBS_PSESM       LHLDGLADSADAWLGGFGD-RERTLNIMKDPRSGPIAVVTLVVVLLLKFAAIVALIESHN
COBS_PSEPK       LHLDGLADSADAWLGGFGD-RERTLRIMKDPRSGPIAVVTLVLVLLLKFCALWVLVGQGI
COBS_PSEP1       LHLDGLADSADAWLGGFGD-RERTLRIMKDPRSGPIAVVTLVLVLLLKFCALWVLVGQGI
COBS_PSEPG       LHLDGLADSADAWLGGFGD-RERTLQIMKDPRSGPIAVVTLVLVLLLKFCALWVLVEQGV
COBS_PSEE4       LHLDGLADSADAWLGGFGD-RERTLQIMKDPRSGPIAVVVLVLVLLLKFCALWVLVERGT
COBS_PSEU5       LHLDGLADSADAWLGGFGD-PARTLEIMKDPRSGPVAVVVLVIMLLLKFSALLVVLQAQQ
COBS_PSEMY       LHLDGLADTADAWVGGFGD-PGRTLAIMKDPRSGPIAVVVLVLLLLLKFAALLSLLQAGQ
COBS_ALKEH       LHLDGLGDSADAWLGGHGD-RLRSLEIMKDPRSGPAAVAVITLALVVKVAALAALLRLDA
COBS_SYNP6       LHLDGAMDTADGLAVPN---PDRRLEVMSDSHTGAFGAIAAIAIISLKTIALCYLPAP--
COBS_SYNE7       LHLDGAMDTADGLAVPN---PDRRLEVMSDSHTGAFGAIAAIAIISLKTIALCYLPAP--
COBS_NOSS1       LHLDGAMDTADGLAVGD---PERRLEVMADSATGAFGAMSAIAILLLKTSALTEIGEY--
COBS_TRIV2       LHLDGAMDTADGLAVGD---PERRLQVMADSATGAFGAMSAIAILLLKTSALTEIGEY--
COBS_THEEB       LHLDGAMDTADGLAVRD---QQRRLEVMADSRAGAFGVMAAMVILLLKVTSLSSLE----
COBS_SYNY3       LHLDGVADTADGLAVTN---PSKRLAVMQDSYTGAYGVMAIAVVLLLKTFALASFSDHGL
COBS_PROM3       LHLDGLMDTADGLAAG----RERCLQAMDDSCVGASGVQALLVVVLLQIAALLRLGSL--
COBS_PROMM       LHLDGLMDTADGLAAG----RERCLQAMDDSCVGASGVQALLVVVLLQIASLLRLGSL--
COBS_PROMA       IHVDGLMDTADGIAAG----PSRCIEAMKDSRIGASGIIALTINLLLQIAALFKLRLL--
COBS_MYCTU       LHIDGVADTADGLGCYGPP--QRALAVMRDGSTGPFGVAAVVLVIALQGLAFATLTTVG-
COBS_MYCTA       LHIDGVADTADGLGCYGPP--QRALAVMRDGSTGPFGVAAVVLVIALQGLAFATLTTVG-
COBS_MYCBO       LHIDGVADTADGLGCYGPP--QRALAVMRDGSTGPFGVAAVVLVIALQGLAFATLTTVG-
COBS_MYCBP       LHIDGVADTADGLGCYGPP--QRALAVMRDGSTGPFGVAAVVLVIALQGLAFATLTTVG-
COBS_MYCUA       LHIDAVADTADGLGCYGPP--QRALAVMRDGSTGPFGVAAVVLVIAVQGSAFSTLSAAGS
COBS_MYCA1       LHIDGVADTADGLGCYGPP--DRARAVMRDGSTGPFGVAAVVVVVMAQALAFSALAAGRP
COBS_MYCPA       LHIDGVADTADGLGCYGPP--DRARAVMRDGSTGPFGVAAVVVVVMAQALAFSALAAGRP
COBS_MYCGI       LHIDGLSDTTDALGCYGPA--ERALAVMRDGRAGPFGVAAVAVTVVIQSVAFSQ------
COBS_MYCVP       LHIDGLSDTVDALGCYGPP--ERALAVMRDGTAGPFGVAAVAATLLVQSLAFAQ------
COBS_MYCS2       LHIDGFCDTVDGLGCYGPP--ERALAVMRDGSAGPFGVAAVVVVIAVQALTFAE------
COBS_MYCSK       MHIDGLSDTVDGLGCYGAP--ERALRVMRDGSAGAFGAASIVVAVGAQTLAFSMLPGGW-
COBS_MYCSS       MHIDGLSDTVDGLGCYGAP--ERALRVMRDGSAGAFGAASIVVAVGAQTLAFSMLPGGW-
COBS_MYCSJ       MHIDGLSDTVDGLGCYGAP--ERALRVMRDGSAGAFGAASIVVAVGAQTLAFSMLPGGW-
COBS_FRACC       LHLDGLADLGDGLGAWRARGRDRALEIMRESTIGAFGAIIVLFVVLLQVGALSTTISAH-
COBS_CORGL       MHLDGLADVSDALGSYAAP--PRAREILADPRTGLFGLATAMLSVLLQVAAVASLVDST-
COBS_CORGB       MHLDGLADVSDALGSYAAP--PRAREILADPRTGLFGLATAMLSVLVQVAAVASLVDST-
COBS_COREF       MHLDGLADVADALGSYAAP--ERAREILADPHTGLMGFSAVLFSLLVQVTAVAALVEGK-
COBS_METAC       NHLDGVTDMGDGFMAHGSH--EKKIKALKDTTLGTGGVAFGMLVLLAFYGSIRSIQDEGI
COBS_METMA       NHLDGVTDMGDGFMAHGSL--EKKVKALKDTTLGTGGVAFGILVLLAFYGSIRSVQEEGI
COBS_METBF       NHLDGITDIGDGFMAHGSL--EKKIKALKDTTIGTGGVSFCILLLLTLYGSIRAVQQEGS
COBS_METBU       NHLDGLGDFGDGATAHGSL--EKKVNALKDMSLGIGGVSYTVLALIALYASISSLQAE-V
COBS_PYRAB       LHLDGLADWADGIMVKGDR--ERKIKAMKDLNTGIAGVFAVVVVLFLQVYSLSMLPFY--
COBS_THEKO       LHLDGLADWADGIMAKGDR--ERKIEVMKDVNTGIAGLFAVVIVLLLQVYSLQLLPFY--
COBS_PYRHO       LHLDGLADWADGIMVKGDR--EKKIKAMKDINVGVAGIFAVVTVLMLQIYSLQLVPFY--
COBS_PYRFU       LHLDGLADWADGIMVKGDR--EKKVRAMKDVNTGIAGTFAVVMILLIQVYSLFSAPFY--
COBS2_ARCFU      NHVDGLADFGDALFAPKNR--KR--EAIKDLNTGAGGVAVVVVYFLLLYTLLYRSDFW--
COBS1_ARCFU      NHIDGLADFGDAFFAPEER--KK--VAIKDLNLGTGGAVFLCVYFLILFYSFQRVSAF--
COBS_THEAC       NHVDAVADAGDAMMIRNR---SRIREVFEDHDVGAGGVFTLIFVYLLALISLSSMDLYIG
COBS_THEVO       NHFDATADLGDALMVRDK---SRIPEVIKDHHVGAGGIFAVIFVYGIAVLSLARSTLYIG
COBS_PICTO       NHADAVLDLGDTFMVHDP---EKKKIIIKDVYHGTGSVVTFFIIYIITISLLSSFNSIQG
COBS_SULTO       HHLDGLLDFGDALMAKDY---NKKIKALHDVEVGAGGIGLLLVYVSIFLTVLLSIKTL--
COBS_SULAC       HHLDGLLDMGDALMVGK----ERRPQVLHDLQTGSGAIGLFLVYFSIFLIATLNLNVS--
COBS_SACS2       NHLDGLLDLGDALMIRGNR--EKKIKALKDVEVGSGGIGLLLVYLSIQIVALLKLDFSLY
COBS_PYRCJ       NHLDGLADVADALMVRDR---ERARAVLEDPRRGTGGIFAVVATYAVATAS-TASPLQ--
COBS_PYRAE       HHLDGLADVGDALLVRDR---EAARRVLEDPRRGTGGIFAVTAVVVTTAAH-LHSPLQ--
COBS_PYRIL       HHLDGLADVGDALMVRDR---ERARRVLEDPRRGVGGIFAVVALFVLAASARPESWLD--
COBS_METJA       HHIDGLIDFGDGWMAVGDK--RKKLMAMKDRYIGCGGVVFAIFFNLMAVISLSYILDINI
COBS_METTH       HHLDGLIDMGDALMSHGSF--ERKIEIMRDPRIGTGGLGLLLIVSSTTIAAIYSLPQGVL
COBS_CARHZ       LHIDGLLDSLDAIYSNRDR--EKRLEILKDSRVGSMAVAFFGAFLILKYGSYASFTPKVQ
COBS_DEIRA       LHFDGLVDSADALFAMKSP--EQRLDILKDVHVGAFGLATGVLALLLLWSLLGAGLPWY-
COBS_METKA       QHFDGLVDVGDALMAGVIS-EEGATKAMRDPRVGVGGLAIGSMALLLAVASFGWIPFE--
                  * *.  *  *                : :   *  .                       

COBS_FUSNN       EA-------------AVYAIITYPVVSRFCSVVSCAS------SPYARG-SGMGKTFVDN
COBS_CLOD6       ---------------SLWVIIFMPMIARLGVMLLTYK------TVTPRE-KGMGNLFIGK
COBS_CLOAB       ---------------MVKVIILFPVAGRLGSIVSASL------STYARRGEGMGKSFIDY
COBS_HUNT2       ---------------LPKALLLFPVAGRIGSLVGAGS------TVYAREGEGLGKSFINC
COBS_CALS4       ---------------LFSALLVSPVIARLSVVFSIAI------SKSARGGKGLGGLLLER
COBS_CLOTE       ---------------MSYAIIITPIMSRCTLVFLFLI------GKNAKK-NGTGNLFIEN
COBS_LISMO       ---------------ICWLFFVLPIVAKGVTMLLFAK------MTYAGSKEGLGSIFLG-
COBS_LISMF       ---------------IGWLFFVLPIVAKGVTMLLFAK------MTYAGSKEGLGSIFLG-
COBS_LISIN       ---------------IGWLFFVLPIVAKGVTMLLFAK------MSYAGSKEGLGSIFLG-
COBS_LISW6       ---------------IGWLFFVLPIVAKGVTMLLFAK------MTYAGSNEGLGSIFLG-
COBS_CLONN       ---------------IIALILS-PVVAKTVVTLLMCF------SVYARKEGGLGGVFVGK
COBS_ALKOO       ------------------LLLLVPVVGRASAVFAASR------TIYARSE-GMGGAFIES
COBS_CLOP1       ---------------DMRILIFIPIASRVINGYFIVS-------QEMLGQSSLAKFFKEG
COBS_CLOPE       ---------------DMRVLIFIPIASRAINGYFIVS-------QEMLGQSSLAKFFKEG
COBS_CLOPS       ---------------DMRILIFIPIASRTMNGYFIVS-------QEMLGQSSLAKFFKEG
COBS_CLOB8       ---------------SLYTLILIPIISRSVVAYYLLS-------RATIKESTLGTYFKKG
COBS_GEOKA       ---------------PPALFAAVPLLSRAGAAWLLSV----GKLAKPTGMAASLREYSSW
COBS_GEOTN       ---------------PPALFVAIPLLSRSGAAWLLSV----GKLAKSTGMAASVREYISW
COBS_BACHD       ---------------APREFTWLLLLVPVCLRWMIIVQLIYGKAASDQGMAASLLPYVT-
COBS_ECOLI       SI--------------LASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQTC
COBS_ECO57       PI--------------LASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQTC
COBS_SHIFL       PI--------------LASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQTC
COBS_SHIF8       PI--------------LASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQTC
COBS_ECOHS       PI--------------LASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQTC
COBS_SHISS       PI--------------LASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQTC
COBS_ECO24       PI--------------LASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQTC
COBS_ECOL5       PI--------------LASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQTC
COBS_ECOL6       PI--------------LASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQTC
COBS_SHIDS       PI--------------LASLAAACAVSRGIAALLMYRHRYAREEGLGNVFIGKIDGRQTC
COBS_SHIBS       PI--------------LALLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQTC
COBS_ECOLC       PS--------------LASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQTC
COBS_SALTY       PM--------------LAALAAACAAGRGSAVLLMYRHRYAREEGLGNVFIGKVSGRQTC
COBS_SALCH       PM--------------LAALAAACAAGRGSAVLLMYRHRYAREEGLGNVFIGKVSGRQTC
COBS_SALTI       PM--------------LAALAAACAAGRGSAVLLMYRHRYAREEGLGNVFIGKVSGRQTC
COBS_SALPA       PM--------------LAALAVACAAGHGSAVLLMYRHRYAREEGLGNVFIGKVSGRQTC
COBS_SALAR       PV--------------LAALAAACAAGRGSAALLMYRHRYAREEGLGNVFIGKVSGRQTC
COBS_CITK8       PM--------------LAALAMACAAGRGVAVLLMYRHRYAREEGLGNVFIGKVTGRQTC
COBS_KLEP7       HP--------------IAALAAACAVGRGMAALLMYRHRYAREKGLGNLFIGKISLQQTL
COBS_ROSS1       AW--------------LTAVVLAPVLGRWADVYGIVRFPPAREGGLGRTFQSYLR-PGDF
COBS_CHLCH       FD----------------VVMAGILLARLVQVLLASALPYARREAGTASAFVAGAGAPHA
COBS_CHLPM       FA----------------LIASGVLLGRLSQVLLAASLPYARKEGGTASGFVGGAGRTHA
COBS_CHLTE       YG----------------MIAAGAVLSRTAQVLLAARMPYARSDGGTAMAFVEDAGWPHL
COBS_VIBCH       -S-------------LVPVWLLAYTLSRAVAASLIRNTPYVS-DTDSSKSKPLAQQLSGT
COBS_VIBC3       -S-------------LVPVWLLAYTLSRAVAASLIRNTPYVS-DTDSSKSKPLAQQLSGT
COBS_VIBVY       -D-------------FGLMIVVAYTLSRAVAATLIYDMPYVS-DSDTSKSKPLANAQSST
COBS_VIBVU       -D-------------FGLMIVVAYTLSRAVAATLIYDMPYVS-DSDTSKSKPLANAQSST
COBS_VIBPA       -D-------------FWLVIVVAYTTSRALAATLIYDMPYVS-DSDTSKSKPLASKQSSS
COBS_PSEA6       -H-------------LLLALAIAYPLSRGLAISHVQHLAYARKNSDNSKSDSLAQPMQPR
COBS_SHESW       VV-------------AGSALIVAHTVSRVVAASIIFTEKYVR-DDETSKSKPLSQHQGIN
COBS_SHEPC       VV-------------AGSALIVAHTVSRVVAASIIFTEKYVR-DDETSKSKPLSQHQGIN
COBS_SHEB8       VV-------------AGSALIVAHTVSRVVSASIIFSEKYVR-DDETSKSKPLSQHQGIN
COBS_SHEB9       VV-------------AGSALIVAHTVSRVVSASIIFSEKYVR-DDETSKSKPLSQHQGIN
COBS_SHEB5       VV-------------AGSALIVAHTVSRMVSASIIFSEKYVR-DDETSKSKPLSQHQGIN
COBS_SHESM       VV-------------AGSAMIVAHTVSRVVAASLIFTEKYVR-DDESSKSKPLAQHQGIN
COBS_SHESR       VV-------------AGSAMIVAHTVSRVVAASLIFTEKYVR-DDESSKSKPLAQHQGIN
COBS_SHESA       VV-------------AGSAMIVAHTVSRVVAASLIFTEKYVR-DDESSKSKPLAQHQGIN
COBS_SHEON       VV-------------AGSAMIVAHTVSRVVAASLIFTETYVR-DDETSKSKPLAQHQGIN
COBS_SHEFN       MA-------------AVSALVAGHTLSRVVASSLIFSEQYVR-DDDTSKSKPIAQDQQLN
COBS_SHEDO       WA-------------AITGFIVAHTLSRVLAASLIFSVKYVT-DLELEEGKRLSHDQSLN
COBS_SHEPA       SS-------------VSLALIVGHCLSRVVAASFIFSEPYVS-DSDTSKSKPLAQEQGIN
COBS_SHEHH       SS-------------VSLALIVGHCLSRVVAASFIFSEEYVS-DTDTSKSKPLAQQQGIN
COBS_SHEAM       SS-------------VAGGLVLGHTLSRAFAASIIFNHTYVR-EDAESKAKPLAQSMHWD
COBS_AROAE       LQ-------------VALALLAAHPLSRLASTSLIHTMQYVR-EDESAKSKPLARRLSAT
COBS_RALSO       AA-------------AMAAMVAAHAASRGMAVSYLLTHDYAR-ME--GKAKPVAQPMGRR
COBS_LEPIC       WI-------------FLFTSWFSHSASRWFALLLMMLIPYAR-ENDLSKSKPMIKKLPPF
COBS_LEPIN       WI-------------FLFTSWFSHSASRWFALLLMMLIPYAR-ENDLSKSKPMIKKLPPF
COBS_POLSJ       SPAELGDDASFSSWYIGAALLTGHVVSRGLPLLLIWLLPHVG-NTASSKSKPLADQISQG
COBS_POLNA       VP-EAGEAPAFSSWYVCAALWTGHIVSRGLPLVMIWRLPHVG-DIAISKSKPLADQISAG
COBS_RHOFT       TL-------------MVAALFVAHVLSRTWPLLTIRLLPHVG-DAAGSKSKPLADQISVA
COBS_BRADU       PWLV------------TLALCAAHCAARAGVPAFMSLVPPARPDGLSASAGAPPGRSVAI
COBS_RHILO       PTQA------------LFALVAAHAASRGVLGAFMHLLPPARSDGLSAGAGAVS-LETAI
COBS_SINMW       PTGG------------GVALLATAALSRAAMVWHWSRLPPARRDGVAAAAGAPEAPATSV
COBS_RHIME       PTGG------------GIALLATAALSRAAMVWHWSRLPPARRGGVAASAGIPEPGATSV
COBV_SINSX       PLGA------------AMAILGAACLSRAAMVWHWSSLPPARSSGVAASAGEPEPAATRF
COBS_RHIEC       PLAA------------ALAIPAVAALSRGAIAWHWQRLPPAKPDGVAASNGQPNEAAMHF
COBS_RHIL3       PLTA------------ALAIPAVAALSRGAIAWHWQRLAPAKADGVAASTGQPDEAAMQF
COBS_BRUAB       AGYA------------LLALIGTEAASRAGMLAFWHALPSARPGGLADSMGQPQWETVVC
COBS_BRUSU       AGYA------------LLALIGTEAASRAGMLAFWHALPSARPGGLADSMGQPQWETVVC
COBS_BRUSI       AGYA------------LLALIGTEAASRAGMLAFWHALPSARPGGLADSMGQPQWETVVC
COBS_BRUC2       AGYA------------LLALIGTEAASRAGMLAFWHALPSARPGGLADSMGQPQWETVVC
COBS_BRUA2       AGYA------------LLALIGTEAASRAGMLAFWHALPSARPGGLADSMGQPQWETVVC
COBS_BRUME       AGYA------------LLALIGTEAASRAGMLAFWHALPSARPGGLADSMGQPQWETVVC
COBS_BRUO2       AGYA------------LLALIGTEAASRAGMLAFWHALPSARPGGLADSMGQPQWETVVC
COBS_OCHA4       AGYA------------ALALVGCEAASRSGMLAFWHALPSARPGGLSDSVGQPQWETVVC
COBS_AZOC5       PTRA------------ALALIAAASLSRAAGMLLLEFLPPARADGASAAAGQPGADAAVR
COBS_PSEAE       A----------------GLLPLAPWLARSSLPLLFLTTPYARPGGLGQAIAEHLPARSLP
COBS_PSEAB       A----------------GLLPLAPWLARSSLPLLFLTTPYARPGGLGQAIAEHLPARSLP
COBS_PSEA7       P----------------GLLLLAPWLARSSLPLLFLTTPYARPGGLGQAIAEHLPARSLP
COBS_PSEF5       G----------------FALLLAPLIGRGALLGLFLCTPYVRAGGLGQALADHLPRVAGR
COBS_PSEPF       S----------------MALIIVPLIGRAALLGLFLTTSYVRAGGLGQALADHLPRKTGW
COBS_PSE14       S----------------IGLLLAPVIGRAAMLGLFLGTPYVRSGGLGQALADHLPRGPGR
COBS_PSEU2       S----------------VWLLLAPVIGRAAMLGLFLGTPYVRSGGLGQALADHLPRGPGR
COBS_PSESM       S----------------IGLLLAPLIGRSAMLALFLGTPYVRSGGLGQALADHLPRSLGR
COBS_PSEPK       G----------------AQLLLAPLIGRAAMLGLFLCTPYVRPGGLGQALAEHMPRRAAG
COBS_PSEP1       G----------------AQLLLAPLIGRAAMLGLFLGTPYVRPGGLGQALAEHLPRRAAG
COBS_PSEPG       G----------------AQLLLAPLIGRTAMLGLFLCTPYVRPGGLGQALAEHLPRRAAG
COBS_PSEE4       G----------------GWLVLAPVVGRAAMLGLFMGTPYVRKGGLGAALAEHLPRRAAG
COBS_PSEU5       P----------------AALVLAPLLGRAALLALFLCTPYVRPNGLGQALAANLPRSRAL
COBS_PSEMY       G----------------IYLVLLPWLGRSLLPLLLATTPYVRAGGLGQALVDHLPRRQLP
COBS_ALKEH       AL---------------AALLIAPVLGRAAAALLIAGTPYARKQGLAGPLAEAPATRWIG
COBS_SYNP6       ---------------RSLLILLIPVWGRWAQVLAIVRYPYLKA--EGKGAIHKQTGRGAI
COBS_SYNE7       ---------------RSLLILLIPVWGRWAQVLAIVRYPYLKA--EGKGAIHKQTGRGAI
COBS_NOSS1       ---------------RWLVLMAACGWGRWGQQVAIACYPYLKA--TGKGAFHKQAIRSYK
COBS_TRIV2       ---------------RWLVLMAACGWGRWGQQVAIACYPYLKA--TGKGAFHKQAIRSYK
COBS_THEEB       ---------------KGSVLVWVLVLGRLAQVWAIARYPYLKP--QGTGQIHKTSGVFPR
COBS_SYNY3       ---------------ASWALIMALGWGRWGQLLAIALYPYLRE--NGKGAMHKRNLKLRP
COBS_PROM3       ---------------APLALLIAAFWGRCAPLWAMARFFYLREGQAGSASFHRRYRQGWQ
COBS_PROMM       ---------------APLALLIAAFWGRCAPLWAMARFFYLREGQAGTASFHRRYRKGWQ
COBS_PROMA       ---------------ILFAIPIASFWGRYSQIWAISHYPYLNK-EGSSKFLHKKNWRGFL
COBS_MYCTU       ----------------IAGITLAVLSGRVTAVLVCRRLVPAAHGSTLGSRVAGTQPAPVV
COBS_MYCTA       ----------------IAGITLAVLSGRVTAVLVCRRLVPAAHGSTLGSRVAGTQPAPVV
COBS_MYCBO       ----------------IAGITLAVLSGRVTAVLVCRRSVPAAHGSTLGSRVAGTQPAPVV
COBS_MYCBP       ----------------IAGITLAVLSGRVTAVLVCRRSVPAAHGSTLGSRVAGTQPAPVV
COBS_MYCUA       RG--------------IAGIAVAVFAGRVTAVLGCRRSVPAAAGSSLGSRVAGTQPISVL
COBS_MYCA1       V---------------PVGVAVAVFAGRVAAVLACRRTVPAAAGSSLGAAVAGSQPATVA
COBS_MYCPA       V---------------PVGVAVAVFAGRVAAVLACRRTVPAAAGSSLGATVAGSQPATVA
COBS_MYCGI       AG--------------WAAVLVAVAAGRVAVVVACRRGVPAAEGSTLGALVAGTQPLWVA
COBS_MYCVP       SG--------------WAAVFIAVVAGRVAVVAACRRGVPAAAGSTLGALVSGTQPRWVA
COBS_MYCS2       LS--------------VLAVVTAVVAGRVAVVAACRRSVPAAAGSTLGAAVAGSQPRWVV
COBS_MYCSK       SG--------------AVGVVVAVTAGRVAALVACRRGIPAAEGSALGGRVAGTQPAAVV
COBS_MYCSS       SG--------------AVGVVVAVTAGRVAALVACRRGIPAAEGSALGGRVAGTQPAAVV
COBS_MYCSJ       SG--------------AVGVVVAVTAGRVAALVACRRGIPAAEGSALGGRVAGTQPAAVV
COBS_FRACC       RG--------------TLSILVAAMTSRLAATLACTGAVPPARPDGLGALVAGTVRTRDA
COBS_CORGL       -V--------------WWMICFIPVLGRIAGQVTALKNHNAFSPTGFGALVIGTVKFWWI
COBS_CORGB       -V--------------WWMICFIPVLGRIAGQVTALKNHHAFSPTGFGALVIGTVKFWWI
COBS_COREF       -A--------------GWLVCFIPALSRLGGQIMARVGRTPLSPTGFGAMVVGTVRLWWV
COBS_METAC       NVFGSNLPLLM-----FASMFIAEVSAKQSMLTIAAFGKPLPRPENQAYPGLGEMTINGA
COBS_METMA       AAFGSNLPFLM-----FASMFIAEVSAKQSMLTIAAFGKPLPRLKEQTYPGLGEMTINGA
COBS_METBF       AVFGSNLPVLM-----FESMFIAEVSAKQSMLTIAAFGKPIPPREKQAYPGLGAMTINGA
COBS_METBU       LFFSDNAALII-----AISLLIAEIGAKQAMLTVAAFGKPI-------HEGLGSMIINNT
COBS_PYRAB       --A----------------IYIAELNSKFSMLLGLATKKPL-------GQGLGAYFMEGM
COBS_THEKO       --A----------------LFLAELNSKYAMLLALATKRPL-------GKGLGAYFMEGM
COBS_PYRHO       --A----------------IFLAELNSKFAMLLAMATKKPL-------GKGLGAYFMEAL
COBS_PYRFU       --S----------------IYLAELNSKMAMLLALATKKPL-------GEGLGKYFMDKL
COBS2_ARCFU      --E----------------IALSQVLAKYSMLLLMLLSRPS-------WDGMGSYFMEKI
COBS1_ARCFU      --Y----------------IIFSQVLAKFSMLLLLTTSKPA-------WQGMTGFMMEFA
COBS_THEAC       IFS----------------IILAEFLSKSMMMITLHRSRPL-------FQGIGSLFIDLY
COBS_THEVO       LVG----------------ILIGQVVSGSSMMISLIGSQPF-------VPGLADYFISLF
COBS_PICTO       SIA----------------LILSETISRFSMLMSMYKSNSF-------SGGISEIFISYF
COBS_SULTO       SFY----------------SLLIAEVESRALGILLLAIMPP-------IEISYMGKIFHK
COBS_SULAC       NLW----------------FFLPSEVLARASAISLLGLMKP-------IPGSYLGKVFHD
COBS_SACS2       TIF----------------YLISSNVLSMSLSLYILSTISP-------IPESNLGRIFHD
COBS_PYRCJ       -------------------LLLAEVFSKALIVTVAAFSKPF-------KPGLGALFIDGA
COBS_PYRAE       -------------------LLLGEVFSKSTALLFAGFSKSF-------KPGLGEAFTEAA
COBS_PYRIL       -------------------YIVTDLYSKALALVVAAYSKPF-------KEGLGSLFIVSA
COBS_METJA       LY-----------------LLVGEVCAKLGMLSCSTFGNPLIEGTGRYFVKKADEKFLTI
COBS_METTH       FQ----------------GLLIGEVSAKVCLTGCARVSRPLDGGTGRHFIMASRSPFTGM
COBS_CARHZ       AF----------------TVLISEIILRGTGYLVIYSFPYVGSSLGRGFKDNASTAGLIF
COBS_DEIRA       ------------------APLVAAVVARMVVLMPMNAYPAARQESLGAQSRQGRWGLAFL
COBS_METKA       ------------------VLVPIEVFSRFTVLPMAAVGEPAPASYSGRVFTEYVDADQVL
                                                                             

COBS_FUSNN       IKTCGLIVATVITLLYT----------------IGMLFMPFILFTNYSL----------P
COBS_CLOD6       LTTSMLITAIIYTLLIV----------------ALITKFIFLLPNIVLI----------K
COBS_CLOAB       CTLKELAIGIILYAVIF----------------LSVGLSRGY------------------
COBS_HUNT2       CGIKEILQGGIIYFIVS----------------LLVLNIKGL------------------
COBS_CALS4       AGLREFVIALLISTIAG----------------YFVMPLKDLA-----------------
COBS_CLOTE       VSVKEFIISFIFMIVPS----------------VLLIGYKYSV-----------------
COBS_LISMO       VPWWPIVIAQVIVLAVL----------------GLFFSYVGVI-----------------
COBS_LISMF       VPWWPVVIAQVIVLVAL----------------GAFFSYIGVI-----------------
COBS_LISIN       VPWWPIMIAQGIVLIVL----------------ALFFSYIGLI-----------------
COBS_LISW6       VPWWPIAISQLFVLFIL----------------GLVFSYIGLL-----------------
COBS_CLONN       VKPFRVIVAFIISISIG----------------YVLIGYKYVA-----------------
COBS_ALKOO       CRTKEGVISIAFSLLLG----------------SMVSIKGAII-----------------
COBS_CLOP1       TGKVDEIILLGIYVLVA----------------LITFFTLGINYL---------------
COBS_CLOPE       TGKVDEIILLGIYVLVA----------------LITFFTLGINYL---------------
COBS_CLOPS       TGKVDEIILLGIYVLVA----------------LITFFTLGINYL---------------
COBS_CLOB8       TNVYDKLIMIITLIITL----------------IISVILLNIYGI---------------
COBS_GEOKA       RDAIWALGLAFVLLSLL----------------CASTAISVQTGA---------------
COBS_GEOTN       RDAVWALVLAFLALSLL----------------LVFGGVPVWTSA---------------
COBS_BACHD       THVKNASRVWFLFIAGA----------------CFLLLQNVILTL---------------
COBS_ECOLI       V-------TLGLAAIFA----------------AVLLPGMHGV-----------------
COBS_ECO57       V-------TLGLAAIFA----------------AVLLPGMHGV-----------------
COBS_SHIFL       V-------TLGLAAIFA----------------AVLLLGMHGV-----------------
COBS_SHIF8       V-------TLGLAAIFA----------------AVLLLGMHGV-----------------
COBS_ECOHS       V-------TLGLAAIFA----------------AVLLPGMHGV-----------------
COBS_SHISS       V-------TLGLAAIFA----------------AVLLPGMHGV-----------------
COBS_ECO24       V-------TLGLAAIFA----------------AVLLPGMHGV-----------------
COBS_ECOL5       V-------TLGLAAIFA----------------AVLLPGMHGV-----------------
COBS_ECOL6       V-------TLGLAAIFA----------------AVLLPGMHGV-----------------
COBS_SHIDS       V-------TLGLAAIFA----------------AVLLPGMHGV-----------------
COBS_SHIBS       V-------TLGLAAIFA----------------AVLLPGMHGV-----------------
COBS_ECOLC       V-------TLGLAAIFA----------------AVLLPGMHGV-----------------
COBS_SALTY       I-------TLGLAVIVA----------------TVLLPGMQGL-----------------
COBS_SALCH       I-------TLGLAVIVA----------------TVLLPGMQGL-----------------
COBS_SALTI       I-------TLGLAVIVA----------------TVLLLGMQGL-----------------
COBS_SALPA       I-------TLGLAVIVA----------------TVLLPGMQGL-----------------
COBS_SALAR       V-------TLGLAAIIT----------------TVLLPGMQGL-----------------
COBS_CITK8       V-------TLGLTAILA----------------AILMPGMHGV-----------------
COBS_KLEP7       V-------TMAMAIALA----------------TALL-GLQGL-----------------
COBS_ROSS1       A-------GASVATLAL----------------ALIVGGVGGL-----------------
COBS_CHLCH       F--------SALLFTLA----------------LLFPFYTENF-------------PTML
COBS_CHLPM       A--------VALALSLM----------------MTLPFFYRDP-------------FLLF
COBS_CHLTE       L--------VASISGVV----------------LLFVLLDWQL-------------APSL
COBS_VIBCH       D------VAVLSLTALA----------------TLLYFSWQFI----------------G
COBS_VIBC3       D------VAVLSLTALA----------------TLLYFSWQFI----------------G
COBS_VIBVY       E------LAILILTGVL----------------AAISLGLGVG----------------L
COBS_VIBVU       E------LAILILTGVL----------------AAISLGLGVG----------------L
COBS_VIBPA       E------VAILLFTAGV----------------ASLFLGVIQT----------------S
COBS_PSEA6       V------LLWLLASSVP----------------AVLWLPLSSA----------------I
COBS_SHESW       E------LFILVASGVL----------------VLLFLKGLAA----------------L
COBS_SHEPC       E------LFILVASGVL----------------VLLFLKGLAA----------------L
COBS_SHEB8       E------LLILIASGVL----------------VLLFLKGLAA----------------L
COBS_SHEB9       E------LLILIASGVL----------------VLLFLKGLAA----------------L
COBS_SHEB5       E------LLILIASGVL----------------VLLFLKGLAA----------------L
COBS_SHESM       E------LFILIASGVL----------------VLLVLKGIAA----------------L
COBS_SHESR       E------LFILIASGVL----------------VLLVLKGIAA----------------L
COBS_SHESA       E------LFILIASGVL----------------VLLVLKGIAA----------------L
COBS_SHEON       D------LFILIASGVL----------------VLLVLKGIAA----------------L
COBS_SHEFN       D------LFILIASGIF----------------VLLWLNGVAA----------------F
COBS_SHEDO       D------LFILLASGIF----------------VLFWLNGLAA----------------F
COBS_SHEPA       E------LSILLATGIL----------------ALLLVGVMQA----------------L
COBS_SHEHH       E------LSILLASGVL----------------ALLLVGLVPA----------------L
COBS_SHEAM       EV-----LFLVLSAGVI----------------CLLLTGVGAT----------------L
COBS_AROAE       E------LVVAAVFGLA----------------PLALLAPAEA----------------L
COBS_RALSO       D------AAWAALFGGL----------------PLLGFGMACA----------------A
COBS_LEPIC       DFALSTFFGCFPAVYFL----------------YQFQNQIPNV----------------L
COBS_LEPIN       DFALSTFFGCFPAVYFL----------------YQFQNQIPNV----------------L
COBS_POLSJ       S----LLVAFIWSFVVL----------------ALAGLALDAI--------------SLI
COBS_POLNA       G----LAIAFSWCFGAL----------------ALASLALDAI--------------NLI
COBS_RHOFT       A----LLTGFIWCFMAL----------------ALVISTQSATEYIAINLTDTALLQALL
COBS_BRADU       A----------FAVGTL----------------VLTLALGPG---------------KAL
COBS_RHILO       A----------GAVLGA----------------IPLLLLGAG---------------GAI
COBS_SINMW       A----------LGSGVI----------------LALVLFFLSG----------IPTVAVL
COBS_RHIME       A----------LGSGVL----------------LALVLFFLAG----------IPTVAVW
COBV_SINSX       A----------LAFGLL----------------VAMLLFYLAQ----------VPALGVI
COBS_RHIEC       A----------LVSAGL----------------LAALLIWPP-----------FGLRPLV
COBS_RHIL3       A----------LASAGL----------------VAALLIWPA-----------FGLRPLV
COBS_BRUAB       G----------CGLGLA----------------LLAIGFLPS-----------GGMVALI
COBS_BRUSU       G----------CGLGLA----------------LLAIGFLPS-----------GGMVALI
COBS_BRUSI       G----------CGLGLA----------------LLAIGFLPS-----------GGMVALI
COBS_BRUC2       G----------CGLGLA----------------LLAIGFLPS-----------GGMVALI
COBS_BRUA2       G----------CGLGLA----------------LLAIGFLPS-----------GGMVALI
COBS_BRUME       G----------CGLGLA----------------LLAIGFLPS-----------GGMVALI
COBS_BRUO2       G----------CGLGLA----------------LLAIGFLPS-----------GGMVALI
COBS_OCHA4       G----------FGIGLA----------------FLVFTLIPA-----------GGFLSLI
COBS_AZOC5       S----------ALVGAL----------------LATLLIVPS-----------TGVGATL
COBS_PSEAE       W---------VLGVSFG----------------LALAFGL-AG----------------L
COBS_PSEAB       W---------VLGGSFG----------------LALAFGL-AG----------------L
COBS_PSEA7       W---------VLGVSFG----------------LALAFGL-SG----------------L
COBS_PSEF5       Q---------VLGLSVL----------------ACLLLGGYSG----------------L
COBS_PSEPF       Q---------VLAVSAA----------------VCLVIAGFNA----------------V
COBS_PSE14       K---------VLAATAI----------------ACVLLAGWSG----------------V
COBS_PSEU2       K---------VLLATAI----------------ACVLLAGWSG----------------V
COBS_PSESM       K---------VLLVSTV----------------ACVVLAGWSG----------------I
COBS_PSEPK       W---------VLLVCVL----------------FCLFLGG--------------------
COBS_PSEP1       W---------VLLVCVL----------------FCLFLGG--------------------
COBS_PSEPG       W---------VLLCCAL----------------FCLLLGG--------------------
COBS_PSEE4       W---------VLLGSVL----------------GCVVLGGSPG----------------L
COBS_PSEU5       M---------VLALVVI----------------GCLLLGA-TG----------------L
COBS_PSEMY       W---------VLGGHVA----------------AMLLLGW-GA----------------L
COBS_ALKEH       L---------TALGALL----------------FVTALAGWAG----------------L
COBS_SYNP6       DLLPGA-----IALVLG----------------IGAIARFHSL-------------TVAL
COBS_SYNE7       DLLPGA-----IALVLG----------------IGAIARFHSL-------------TVAL
COBS_NOSS1       DLLPGLC---LMFAISG----------------LFWLVNNHHL-------------LISV
COBS_TRIV2       DLLPGLC---LMVAVSS----------------LFWLVNNHHL-------------LITV
COBS_THEEB       DFWPSG---------------------------LLVLLLSFLL-------------PLPL
COBS_SYNY3       DLLLGTM---IIVFGGV----------------GMGYALAIEP-------------WLIL
COBS_PROM3       EALPAFLVLLLALTVVP----------------LLMIVGWPSQ-------------MVLM
COBS_PROMM       EALPACLVLLLALTVVP----------------SLMIVGWPSQ-------------MVLM
COBS_PROMA       IESIPSYAFLSFLIFIL----------------INIDISIIST-------------PNLI
COBS_MYCTU       AAWLAVLLAVSVPAG--------------------PRPWQGPI-----------------
COBS_MYCTA       AAWLAVLLAVSVPAG--------------------PRPWQGPI-----------------
COBS_MYCBO       AAWLAVLLAVSVPAG--------------------PRPWQGPI-----------------
COBS_MYCBP       AAWLAVLLAVSVPAG--------------------PRPWQGPI-----------------
COBS_MYCUA       VAWLAVLLFASLAAA--------------------PRPWQGPA-----------------
COBS_MYCA1       AAWVAVLLGMSLVAG--------------------PRPWHGPV-----------------
COBS_MYCPA       AAWVAVLLGMSLVAG--------------------PRPWHGPV-----------------
COBS_MYCGI       AAWLVAIAGLATLAG--------------------ERAWQGPL-----------------
COBS_MYCVP       AGWTVAVAAAAVPVC--------------------ARPWQGPL-----------------
COBS_MYCS2       AGWIVALAALAVFAC--------------------PRPWQGPL-----------------
COBS_MYCSK       LVWLAAVAALAIPAT--------------------ERIWQGPL-----------------
COBS_MYCSS       LVWLAAVAALAIPAT--------------------ERIWQGPL-----------------
COBS_MYCSJ       LVWLAAVAALAIPAT--------------------ERIWQGPL-----------------
COBS_FRACC       ALSFLAVCAVAALAGLL-----------DFDGGGPGRALRAVL-----------------
COBS_CORGL       ALWLLVTAALAFWCAELISPLSPLTSVNTPFVAGPFPAAINPAWLGGWV----------A
COBS_CORGB       ALWLLVTPALAFWCAELISPLSPLTSVNTPFVAGPFPAAINPAWLGGWV----------A
COBS_COREF       AAWLVALGVTAGGVAV--------------WAAGPAVVWIVPA-----------------
COBS_METAC       TR---KNFLIGFIFGAF----------------VCFLPFGLIG----------------L
COBS_METMA       TR---KNFLIGFIFGAV----------------VCCLPFGLIG----------------L
COBS_METBF       TR---KNFLIGFVFGAI----------------VCFLPFGWIG----------------L
COBS_METBU       TF---PRYAVSFVLGAL----------------VCVLAFGTLG----------------I
COBS_PYRAB       NG--RQLAIGVVLYVLL----------------YLPVVIYDPS----------------A
COBS_THEKO       NG--RQLALGTLLYVLL----------------GLSVVLFEPR----------------A
COBS_PYRHO       DR--NQLLYGTLIYLLL----------------YIPVIIAEPR----------------N
COBS_PYRFU       TT--KRVFLGGVLYALL----------------LIPILLYDPQ----------------S
COBS2_ARCFU      SS--KDVFIGAVPVVLL----------------CYKVGIESLA----------------A
COBS1_ARCFU      RK--RDVVIGSLPLLLV----------------VLKP--LAVF----------------P
COBS_THEAC       RKHDSLYTVEFVVIPIV----------------LALLSRASIM----------------I
COBS_THEVO       RKHSVGYTIEFLAIPII----------------VSFIFSPLYV----------------V
COBS_PICTO       DKPFKITFFNFLVIILI----------------FLIFYKYIIF----------------T
COBS_SULTO       NLNNKW---KILSIIVE----------------VVLFGNPYIL----------------I
COBS_SULAC       KMRDKLFSIKFLLVQVF----------------AILFSSPVLI----------------L
COBS_SACS2       KLKGKS-----TILLLE----------------LIPFISLYNV----------------I
COBS_PYRCJ       RS---------TWPLAL----------------PALAVIICLR----------------P
COBS_PYRAE       KR---------QWPAAL----------------PALAVLAYLA----------------P
COBS_PYRIL       KR---------QWPAAL----------------PALAVAAWLH----------------P
COBS_METJA       G--------IILSLPLL----------------LIFSGIERKI---------------VI
COBS_METTH       V---------WIFWAVA----------------AYLLAGVPGA-----------------
COBS_CARHZ       TLG----QTLIFTLGAA----------------AFFNFSLIKI----------------L
COBS_DEIRA       FA-------------------------------LPALLLPHAW----------------L
COBS_METKA       LG--------GILSTVV----------------SLPFSPVATL-----------------
                                                                             

COBS_FUSNN       MQFMIRSVLIIVIIVGLLALFAFAFSKLIERKIGGITGDTLGALLEISSLVYIFLFLVIP
COBS_CLOD6       VLGSIIVVFVFIIL----------FKKHIYKKIDGVTGDILGCGIELSELVYLIYIYLLI
COBS_CLOAB       IIMIFPILTAVILI------------KYFTRKIGGATGDILGAVCELNQTFYLMTVYAVL
COBS_HUNT2       LLAAATMITSFATV------------KFFAGKVGGATGDILGAVCELNQTFFLILFYLFK
COBS_CALS4       LLYVISLSFTCLIS------------KYISKKIGGMTGDTLGAVNEFVELIAFIYFSIL-
COBS_CLOTE       IIIVVSFIITLAFL------------NLCNRKIGGITGDCLGANNEIVEMFTMLVFVALL
COBS_LISMO       -AYVGVILFTIIYR------------AFVYKRIGGMNGDTLGAGGQMGQLICLFCLVLLW
COBS_LISMF       -AYAGVILFTIIYR------------AFVYKRIGGMNGDTLGAGGQMGQLICLFCLVLLW
COBS_LISIN       -AYAGVLVFTIIYR------------LFVYKRIGGMNGDTLGAGGQMGQLVCLFCLVLIW
COBS_LISW6       -AYAGVILFTIIYR------------TFVYKRIGGMNGDTLGAGGQMGQLVCLFCLVLVW
COBS_CLONN       -LLLITVLFIEIYK------------KLIYSKIDGMTGDTLGAANEIAEIIFMLALLSFK
COBS_ALKOO       -PMGITFLGVAMLT------------KKISKILGGMTGDTIGATIEISQTLFMLSAYLLK
COBS_CLOP1       IAILAMGLISFILL------------LKVKKELGGINGDVAGYILVLMEFTGILLLGII-
COBS_CLOPE       IAILAMGLISFILL------------LKVKKELGGINGDVAGYILVLMEFTGILLLGII-
COBS_CLOPS       IAILAMGLISFILL------------LKVKKELGGINGDVAGYILVLMEFTGILLLGII-
COBS_CLOB8       ILVLLMSLGIKLSV------------EKCRKEFGGISGDVAGFALVIGEVVGILILGIIP
COBS_GEOKA       ALAAAAVVLAAAAK------------PWAEKQFGGITGDVLGALIEGGETVLWGVIWLLH
COBS_GEOTN       ALAVAMALLALGAK------------PWVEKQFGGVTGDVLGALIEGGETLLWGVVWLLH
COBS_BACHD       CFLLMIWLFPLFWL------------RVCKREIGGMSGDTIGASIEGGELFLWGIMWTFF
COBS_ECOLI       AAMVVTMVAIFILG------------QLLKRTLGGQTGDTLGAAIELGELVFLLALL---
COBS_ECO57       AAMVVTMVAIFILG------------QLLKRTLGGQTGDTLGAAIELGELVFLLALL---
COBS_SHIFL       AAMVVTMVAIFILG------------QLLKRTLGGQTGDTLGAAIELGELVFLLALL---
COBS_SHIF8       AAMVVTMVAIFILG------------QLLKRTLDGQTGDTLGAAIELGELVFLLALL---
COBS_ECOHS       AAMVVTMVAIFILG------------QLLKRTLGGQTGDTLGAAIELGELVFLLALL---
COBS_SHISS       AAMVVTMVAIFILG------------QLLKRTLGGQTGDTLGAAIELGELVFLLALL---
COBS_ECO24       AAMVVTMVAIFILG------------QLLKRTLGGQTGDTLGAAIELGELVFLLALL---
COBS_ECOL5       AAMVVTMVAIFILG------------QLLKRTLGGQTGDTLGAAIEFGELVFLLALL---
COBS_ECOL6       AAMVVTMVAIFILG------------QLLKRTLGGQTGDTLGAAIEFGELVFLLALL---
COBS_SHIDS       AAMVVTMVAIFILG------------QLLKRTLGGQTGDTLGAAIELGELVFLLALL---
COBS_SHIBS       AAMVVTMVAIFILG------------QLLKRTLGGQTGDTLGAAIELGELVFLLALL---
COBS_ECOLC       AAMVVTMVAIFILG------------QLLKRTLGGQTGDTLGAAIELGELVFLLALL---
COBS_SALTY       AAMVVTCAAIFILG------------QLLKRTLGGQTGDTLGAAIELGELIFLLALL---
COBS_SALCH       AAMVVTCAAIFILG------------QLLKRTLGGQTGDTLGAAIELGELIFLLALL---
COBS_SALTI       ATMVVTLAAIFILG------------QLLKRTLGGQTGDTLGAAIELGELIFLLALL---
COBS_SALPA       ATMVVTLAAIFILG------------QLLKRTLGGQTGDTLGAAIELGELIFLLALL---
COBS_SALAR       AAIVITLAAIFILG------------QLLKRTLGGQTGDTLGAAIELGELIFLLALL---
COBS_CITK8       AALVVTLAAIFILG------------QLLKRTLGGQTGDTLGAAIELGELIFLLALL---
COBS_KLEP7       RAALITLVLIWGLG------------WALKRTLGGQTGDTLGAAIELGELLFLLALL---
COBS_ROSS1       IALALVWMVTHLLG------------RWWTRDLGGLTGDTYGALCEIAEVVALATLTLSA
COBS_CHLCH       WLLGAALVAGSMVG------------MVSYRKIGGVTGDVLGAGSELTEVAVWITGALLL
COBS_CHLPM       LLFGAALTAAALIG------------FLSMKKIGGITGDVLGAVSEVTELFVWLAAGVAF
COBS_CHLTE       ILLFGSVVALFFVG------------WLSHRKIGGITGDVLGACSELVEAAVWLLAALWL
COBS_VIBCH       VMIAASLIFRQIFR------------QWLIRRLGGFTGDCLGAAQQLMEILIYLILLAFL
COBS_VIBC3       VMIAASLIFRQIFR------------QWLIRRLGGFTGDCLGAAQQLMEILIYLILLAFL
COBS_VIBVY       LLILFAILFRWAFK------------RWLLARLGGFTGDCLGGAQQLMELGIYLVLIAVV
COBS_VIBVU       LLILFAILFRWAFK------------RWLLARLGGFTGDCLGGAQQLMELGIYLVLIAVV
COBS_VIBPA       FIVIVLFAFRFAFK------------RWLTKRIGGFTGDCLGAAQQLSELLVYLTLIAFY
COBS_PSEA6       LVIVSACVLRFALK------------HWFKKHIDGYTGDCLGFAQQTQELLIYLLLIITL
COBS_SHESW       SLLLVMIGLRRLIV------------VIFRRQIGGYTGDTLGAAQQICEIVCYLVLLIVG
COBS_SHEPC       SLLLVMIGLRRLIV------------VIFRRQIGGYTGDTLGAAQQICEIVCYLVLLIVG
COBS_SHEB8       SLLLVMIGLRRLII------------VIFRRQIGGYTGDTLGAAQQIAEIVCYFVLLVVG
COBS_SHEB9       SLLLVMIGLRRLII------------VIFRRQIGGYTGDTLGAAQQIAEIVCYFVLLVVG
COBS_SHEB5       SLLLVMIGLRRLII------------VIFRRQIGGYTGDTLGAAQQIAEIVCYFVLLVVG
COBS_SHESM       SLLLVMIGLRRLIV------------VIFRRQIGGYTGDTLGAAQQICEIVCYFVLLVVG
COBS_SHESR       SLLLVMIGLRRLIV------------VIFRRQIGGYTGDTLGAAQQICEIVCYFVLLVVG
COBS_SHESA       SLLLVMIGLRRLIV------------VIFRRQIGGYTGDTLGAAQQICEIVCYFVLLVVG
COBS_SHEON       SLLLVMIGLRRLIV------------VIFRRQIGGYTGDTLGAAQQICEIVCYFVLLVVG
COBS_SHEFN       VLFITLWLVRILLG------------GFFRKQIGGYTGDTLGAAQQISEVCCYLVILAVG
COBS_SHEDO       VLFISLWALRFCLC------------KYFRSQIGGYTGDTLDAAQQVSEIMCYLIILAVG
COBS_SHEPA       VLTLALTIVRYGFV------------RLFTKQIGGYTGDTLGAAQQGSELTCYLLLLVLG
COBS_SHEHH       VLITGLVIVRYGFI------------RLFRSQIGGYTGDTLGAAQQGSELSCYLLLLILG
COBS_SHEAM       VILVTLFVARSLLA------------RWQSRHIGGYTGDTLGACQQILELVVYLVLLLLW
COBS_AROAE       AALTATAAATLWAA------------RVFARRLGGYTGDCLGAAQQGSELACYLGILAAW
COBS_RALSO       IAVAVLLAARWALG------------RYFTRRLGGITGDCLGLAQQVFELLVLWVLLAWT
COBS_LEPIC       LGFFLSSIFVFYFR------------NYFNKWIEGFTGDCLGFIQQGTELLFYLGITVSW
COBS_LEPIN       LGFFLSSIFVFYFR------------NYFNKWIEGFTGDCLGFIQQGTELLFYLGITVSW
COBS_POLSJ       VACSFSLLALLWMG------------ALFKRRLQGFTGDCLGATQQVCEIAFYLGLAVSL
COBS_POLNA       VACGFSVLALLGLL------------RFFRRRLQGFTGDCLGTTQQVCEIAFYLGLAVSL
COBS_RHOFT       SAVVASCVAWAVMA------------RWFWRRLQGFTGDCLGATQQVCELAFYLGLAVGL
COBS_BRADU       VGLILLSLAGLILA------------RLAIRQIGGQTGDILGAFEQTGEIVILLVAAAFQ
COBS_RHILO       AALILLGLLFAAFH------------ALCLNQIGGQTGDTIGALQQVSEIAVLLVASVAL
COBS_SINMW       LSFGAFVLAVLSFT------------RIASRKLGGHTGDTIGATQQLTEVAVLGALALAI
COBS_RHIME       LSFAAFGLAVPGFT------------RIASRKLGGHTGDTIGATQQLTEVAVLGALALAI
COBV_SINSX       AALVAFLATVKGFA------------RLAMRKIGGQTGDTIGATQQLTEIAVLGALALTV
COBS_RHIEC       AGLLVAGVAGFAFT------------VFIRRKLAGHTGDTLGATQQICEIATLCALATAL
COBS_RHIL3       ASLLATGIAGFAFT------------AFIRRKLAGHTGDTLGATQQICEIATLCALATAL
COBS_BRUAB       NALVLMTVVLFGFA------------RLCMAKIGGQTGDTLGAAQQIGSLAALIGLVMAL
COBS_BRUSU       NALVLMTVVLFGFA------------RLCMAKIGGQTGDTLGAAQQIGSLAALIGLVMAL
COBS_BRUSI       NALVLMTVVLFGFA------------RLCMAKIGGQTGDTLGAAQQIGSLAALIGLVMAL
COBS_BRUC2       NALVLMTVVLFGFA------------RLCMAKIGGQTGDTLGAAQQIGSLAALIGLVMAL
COBS_BRUA2       NALVLMTVVLFGFA------------RLCMAKIGGQTGDTLGAAQQIGSLAALIGLVMAL
COBS_BRUME       NALVLMTVVLFGFA------------RLCMAKIGGRTGDTLGAAQQIGSLAALIGLVMAL
COBS_BRUO2       NALVLMTVVLFGFA------------RLCMAKIGGQTGDTLGAAQQIGSLAALIGLVMAL
COBS_OCHA4       NALVLATGLLFGFA------------RLCIAKIGGQTGDTLGAAQQIGSVAVLAGLVMAL
COBS_AZOC5       MAIGLSVLALFAMT------------RLSNRLIGGQTGDVAGAVQQLCEIAFLMGVLIYA
COBS_PSEAE       LALLVTLMLFAWLR------------SRFLARLGGTTGDTAGALVELTECAVLVALAL--
COBS_PSEAB       LALLVTLMLFAWLR------------SRFLARLGGTTGDTAGALVELTECAVLVALAL--
COBS_PSEA7       LALLVTLMLFAWLR------------SRFLARLGGTTGDTAGALVELTECAVLVALAL--
COBS_PSEF5       WAVLLATVLFFWLR------------QVMMRRLGGTTGDTAGAVLELLETAVLLGVALF-
COBS_PSEPF       VALLLAVIVFIWLR------------HLMVRRLGGTTGDTAGALLELLEMSVLVGLALF-
COBS_PSE14       AVLLVCAVCFFWLR------------QLMMRRLGGCTGDTAGALLELLELAVLLTLALL-
COBS_PSEU2       AVLLVCAVCFFWLR------------QLMMRRLGGCTGDTAGALLELLELAVLLTLALL-
COBS_PSESM       AALLVCAVCFYWLR------------HMMMRRLGGSTGDTAGALLELLELAVVLTLALL-
COBS_PSEPK       WSVLLALAVFAWLR------------HLMCRRLGGTTGDTAGALLELLELAVVLGLALGL
COBS_PSEP1       WSVLLALAVFAWLR------------HLMCRRLGGTTGDTAGALLELLELAVVLGLALGL
COBS_PSEPG       WVVLLAVAVFAWLR------------HLMYRRLGGATGDTAGALLELLELAVVLGLALGL
COBS_PSEE4       WMLLLSLGVFLWLR------------RLMCKRLGGTTGDTAGAMVELLELAVLVGLALMV
COBS_PSEU5       LALTLAGVTFLLAR------------RAMLRRLGGTTGDTAGALLELVECAVLVGLALQV
COBS_PSEMY       IALATALALFVWLR------------RALMQRLGGTTGDTAGALLELAECAALLALALSL
COBS_ALKEH       AAVLGVVAVGVWAQ------------HLMMRRLDGFTGDTAGALVEVAELAALLGLLAVL
COBS_SYNP6       QLLAIGLLWAWATG------------AWLQKKLGGQTGDTYGAIVEWTEALIWVSFTIGQ
COBS_SYNE7       QLLAIGLLWAWATG------------AWLQKKLGGQTGDTYGAIVEWTEALIWVSFTIGQ
COBS_NOSS1       VVLIAGSAIATLTA------------AWFNHKLGGHTGDTYGAVVEWTEALFLCVLTILT
COBS_TRIV2       VGLITGSAIASLTA------------AWFNHKLGGHTGDTYGAVVEWTEALFLCVLTILT
COBS_THEEB       GQLLFGLLLILLIP------------AWFQSQLGGHTGDSYGAVVEWTEALLLVAFTVGS
COBS_SYNY3       GATGSSALIAWAVG------------RWFAQQFKGHTGDTYGAVVEWSEVLILLGLSLV-
COBS_PROM3       AGIGVGVLPAFLVP------------ELLGRRLGGHSGDSYGASVVLVETITLLLLAVLL
COBS_PROMM       AGIGVGVLPAFLVP------------ELLGRRLGGHSGDSYGASVVLVETITLLLLAVLL
COBS_PROMA       IGIIVGFLPALIIP------------HLLARRLGGHSGDSYGASVVLVETCMLIIFSIIL
COBS_MYCTU       -AVLVAVTAGAALA------------AHCVHRFGGVTGDVLGSAIELSTTVSAVTLAGLA
COBS_MYCTA       -AVLVAVTAGAALA------------AHCVHRFGGVTGDVLGSAIELSTTVSAVTLAGLA
COBS_MYCBO       -AVLVAVTAGAALA------------AHCVHRFGGVTGDVLGSAIELSTTVSAVTLAGLA
COBS_MYCBP       -AVLVAVTAGAALA------------AHCVHRFGGVTGDVLGSAIELSTTVSAVTLAGLA
COBS_MYCUA       -AVVAAVCAGTLLI------------RHCVRRFGGITGDVLGCAIELATTVTAVVLAALV
COBS_MYCA1       -AVLLGLGCGAVLV------------RHCVRRFGGISGDVLGAAIELTATVSAVALAALV
COBS_MYCPA       -AVLLGLGCGGVLV------------RHCVRRFGGISGDVLGAAIELTATVSAVALAALV
COBS_MYCGI       -AVVVAVACSVVMV------------AHCVRRFGGITGDVLGAAVEVTTTVTALGLAIA-
COBS_MYCVP       -VVALALACSAGLV------------AHCVRRFGGITGDVLGAALEVTTTIAAVGLAVR-
COBS_MYCS2       -AVLVAIGCSLALV------------AHCVRRFGGITGDVLGAAVEVTTTLAALGLAIG-
COBS_MYCSK       -TVVVAVGMTALLV------------RHCVRRFGGITGDVLGAAIEVTTTVVAVGLVIR-
COBS_MYCSS       -TVVVAVGMTALLV------------RHCVRRFGGITGDVLGAAIEVTTTVVAVGLVIR-
COBS_MYCSJ       -TVVVAVGMTALLV------------RHCVRRFGGITGDVLGAAIEVTTTVVAVGLVIR-
COBS_FRACC       -AVWVGTGVSFLLR------------RYLLTRFGGITGDILGGLIEITAAATLLVMAMTI
COBS_CORGL       ITAVVACVFAALFS------------RRLSRSFGGLNGDCIGACIHLGASISAVMFAVVA
COBS_CORGB       ITAVVACVFAALFS------------RRLSRSFGGLNGDCIGACIHLGASISAVMLAVVA
COBS_COREF       -AGIIACVVSESAG------------RHVSRRFGGVNGDCIGAGIHLSAAVVAVFCAVAV
COBS_METAC       IPYLAACISALVLL------------NRSYAHFGGLNGDGIGTANEIGRITALIIIAVTL
COBS_METMA       IPYLAACISALVLL------------NRSYAHFGGLNGDGIGTANEIGRITALIVIAVTL
COBS_METBF       LPYLGACLVALVIL------------NRSYAHFGGLNGDGIGTANEIGRVTALIILAVLL
COBS_METBU       IGYISAIVTAFVIL------------NISIRHFKGINGDCIGTSNEIARIIVLMVLTVAI
COBS_PYRAB       LFGVMGLVFAWYVI------------RLSLENFGGINGDCLGAMAEITRAGTLVILSFSL
COBS_THEKO       LAGILGLLFGVHII------------RISLKNFDGLNGDCLGATAEITRAGTLVVMALVW
COBS_PYRHO       LVSFLGLFIGLYAV------------KISLDNFGGLNGDCIGAVAEITRVGTLVVITLGW
COBS_PYRFU       IFALLGLVGGIYAV------------KISLDNFGGLNGDCIGAVGEITRGATLLILGVWA
COBS2_ARCFU      L--ASGFAVVLLLK------------AYSEKHFGGVNGDVIGSANCLTFAASLSALTIAG
COBS1_ARCFU      L--LFAITISLLVK------------RYAEEKFGGVSGDVVGASNCLVFAGSLLVCYFLA
COBS_THEAC       SVAL-AFLIFIIVK------------MAVIRRFGGINGDLAGFIGELGRSIFLMISLIMA
COBS_THEVO       IVAL-NLLIVQLTK------------TMISRRFGGINGDVIGFLGEFSRSLFIFMLIIIA
COBS_PICTO       MFSLISIVISYYFK------------SHEQKIFNGINGDIIGFTGELSRLISLLLILISF
COBS_SULTO       SFAI----LLLFFY------------FLGYSTLKGSSGDFIGAIITLSFPIFLLIAERSC
COBS_SULAC       AYVI----LLLVFY------------LMAKLVFDGMSGDIVGAIITLSFPIYLLVAEKTC
COBS_SACS2       VFII----FYMIMY------------KICGSLG-GSSGDIAGASITLSFPLFLITDEITN
COBS_PYRCJ       AATLAALAVALALY------------AVAYQHLGGANGDVFGYLLEVSRVAYIVTWHM--
COBS_PYRAE       VTTAVSLATSALLY------------QLAYRHLGGANGDVYGYLLEVSRSAFVIWSAYVP
COBS_PYRIL       AAFLAATVLSLFFY------------VAAYKHLGGANGDLLGALLEVTRALYLATVDLST
COBS_METJA       IAIITTIITGLCMA------------KIAKRHFGGVNGDVLGASNEITRVVVLLSIIASI
COBS_METTH       VSVAVAVLSGVFIG------------LVARRNFYWSTGDVLGASNEVGRMMSLLGLLAAI
COBS_CARHZ       IILLLAYLFAFVVA------------ARWQQFFGGLTGDNYGGIMELTGLFVPVAVLLIN
COBS_DEIRA       AALVALLGVTLVAA------------WAARRLGGGLSGDVYGLLIVVAELLVLGFYGWGF
COBS_METKA       TCAVCSAVVAWTCL------------EAARRTIRGVNGDFLGASIWVSRVLSAVCLSSLP
                                                     .**  .                  

COBS_FUSNN       TFFIG---------------
COBS_CLOD6       FMFF----------------
COBS_CLOAB       YFRG----------------
COBS_HUNT2       --------------------
COBS_CALS4       --------------------
COBS_CLOTE       YIN-----------------
COBS_LISMO       GLV-----------------
COBS_LISMF       GLI-----------------
COBS_LISIN       GLM-----------------
COBS_LISW6       GLI-----------------
COBS_CLONN       GCGLL---------------
COBS_ALKOO       SIII----------------
COBS_CLOP1       --------------------
COBS_CLOPE       --------------------
COBS_CLOPS       --------------------
COBS_CLOB8       --------------------
COBS_GEOKA       SSVMG---------------
COBS_GEOTN       SSAMG---------------
COBS_BACHD       LSVTA---------------
COBS_ECOLI       --------------------
COBS_ECO57       --------------------
COBS_SHIFL       --------------------
COBS_SHIF8       --------------------
COBS_ECOHS       --------------------
COBS_SHISS       --------------------
COBS_ECO24       --------------------
COBS_ECOL5       --------------------
COBS_ECOL6       --------------------
COBS_SHIDS       --------------------
COBS_SHIBS       --------------------
COBS_ECOLC       --------------------
COBS_SALTY       --------------------
COBS_SALCH       --------------------
COBS_SALTI       --------------------
COBS_SALPA       --------------------
COBS_SALAR       --------------------
COBS_CITK8       --------------------
COBS_KLEP7       --------------------
COBS_ROSS1       PMRLLAT-------------
COBS_CHLCH       SDYLLF--------------
COBS_CHLPM       TAF-----------------
COBS_CHLTE       KGLFWAIA------------
COBS_VIBCH       QHEVMI--------------
COBS_VIBC3       QHEVMI--------------
COBS_VIBVY       Q-------------------
COBS_VIBVU       Q-------------------
COBS_VIBPA       QNI-----------------
COBS_PSEA6       PKTVNEQTIGFLL-------
COBS_SHESW       SIL-----------------
COBS_SHEPC       SIL-----------------
COBS_SHEB8       NIL-----------------
COBS_SHEB9       NIL-----------------
COBS_SHEB5       NIL-----------------
COBS_SHESM       SIL-----------------
COBS_SHESR       SIL-----------------
COBS_SHESA       SIL-----------------
COBS_SHEON       GIL-----------------
COBS_SHEFN       LS------------------
COBS_SHEDO       LSA-----------------
COBS_SHEPA       VSW-----------------
COBS_SHEHH       VSW-----------------
COBS_SHEAM       SQS-----------------
COBS_AROAE       NFI-----------------
COBS_RALSO       SS------------------
COBS_LEPIC       NSI-----------------
COBS_LEPIN       NSI-----------------
COBS_POLSJ       --------------------
COBS_POLNA       --------------------
COBS_RHOFT       --------------------
COBS_BRADU       MGR-----------------
COBS_RHILO       SS------------------
COBS_SINMW       --------------------
COBS_RHIME       --------------------
COBV_SINSX       --------------------
COBS_RHIEC       --------------------
COBS_RHIL3       --------------------
COBS_BRUAB       --------------------
COBS_BRUSU       --------------------
COBS_BRUSI       --------------------
COBS_BRUC2       --------------------
COBS_BRUA2       --------------------
COBS_BRUME       --------------------
COBS_BRUO2       --------------------
COBS_OCHA4       --------------------
COBS_AZOC5       RPH-----------------
COBS_PSEAE       --------------------
COBS_PSEAB       --------------------
COBS_PSEA7       --------------------
COBS_PSEF5       --------------------
COBS_PSEPF       --------------------
COBS_PSE14       --------------------
COBS_PSEU2       --------------------
COBS_PSESM       --------------------
COBS_PSEPK       --------------------
COBS_PSEP1       --------------------
COBS_PSEPG       --------------------
COBS_PSEE4       --------------------
COBS_PSEU5       GR------------------
COBS_PSEMY       --------------------
COBS_ALKEH       ANSAG---------------
COBS_SYNP6       V-------------------
COBS_SYNE7       V-------------------
COBS_NOSS1       --------------------
COBS_TRIV2       --------------------
COBS_THEEB       AS------------------
COBS_SYNY3       --------------------
COBS_PROM3       TAG-----------------
COBS_PROMM       PAG-----------------
COBS_PROMA       PAS-----------------
COBS_MYCTU       RL------------------
COBS_MYCTA       RL------------------
COBS_MYCBO       RL------------------
COBS_MYCBP       RL------------------
COBS_MYCUA       RL------------------
COBS_MYCA1       RV------------------
COBS_MYCPA       RV------------------
COBS_MYCGI       --------------------
COBS_MYCVP       --------------------
COBS_MYCS2       --------------------
COBS_MYCSK       --------------------
COBS_MYCSS       --------------------
COBS_MYCSJ       --------------------
COBS_FRACC       PTPVLHTLGLH---------
COBS_CORGL       NAMV----------------
COBS_CORGB       NAMV----------------
COBS_COREF       AGMTG---------------
COBS_METAC       ELSLN--TGGLEWTLL----
COBS_METMA       KLSLNGYLGGLEWTLL----
COBS_METBF       QLSLNGYMGGFKWTLL----
COBS_METBU       TAVNNG-YGGLFWTPL----
COBS_PYRAB       CFTT----------------
COBS_THEKO       WYL-----------------
COBS_PYRHO       RI------------------
COBS_PYRFU       --------------------
COBS2_ARCFU      QL------------------
COBS1_ARCFU      D-------------------
COBS_THEAC       QSSVLSTYDILSKIMSSL--
COBS_THEVO       HYNVASTYDIFSKMLSSFTS
COBS_PICTO       KLI-----------------
COBS_SULTO       YLF-----FTSLFSLI----
COBS_SULAC       YHY-----FIFQYSLTLP--
COBS_SACS2       LNYSLLSILCYLFSHLH---
COBS_PYRCJ       --------------------
COBS_PYRAE       VPTAF---------------
COBS_PYRIL       SLINGLF-------------
COBS_METJA       KVFSIYLLG-----------
COBS_METTH       RLTGL---------------
COBS_CARHZ       NIGVV---------------
COBS_DEIRA       TPL-----------------
COBS_METKA       W-------------------