CLUSTAL format seed alignment for MF_00720

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PRIB_BORPE        ------------MNTLELSARVLECGAMRHTPAGLPALELLLVHESEVVEAGHPRRVELT
Q2KZ20_BORA1      ------------MNQLHLSVRVLECEPLRHTPAGVAALEMLLGHGSEVIEAGHPRRVELT
D5X3B3_THIK1      ------------MNRLELQGILAERGELRYTPAGIEALDFVLQHQSTQSEADMPCEVQLQ
A1TLI2_ACIAC      ---------MEPCNSVTLTACIAETKPLRYTPAGLPALDLKLEHGSKQSEAGVQRDVAAV
C5CUP1_VARPS      ----------------MLTASVAELGALRYTPAGLPAIDLKLEHESTLQEAGKARQVKTA
Q128U2_POLSJ      ------------MNHVELTACIAEASPLRYTPAGIPAANFVLEHESEIVEAGVARQVKLT
B1XXH4_LEPCP      ------------MNRVLLTAQLLERAVMRYTPAGLPALDVRLAHASQVEHAGQARQVSME
B2JG19_PARP8      ------------MNRLQLTASVVEREPVRYTPAGVPIAGCTLQHRTQVVEAGIARTVELT
B2UAG5_RALPJ      ---MNETLGDNAINRLQLVATLVEREVMRYTPAGVPIVNCLLAYSGQAVEAQTVRQIEFS
A4SVX7_POLAQ      ------------MNHFTLTAILVSKDAIRFTPAGIPVMHCQLEHSGQANEVGVARKIQMS
PRIB_NEIMB        ---------MGFNNLVSLAALIEKVFPIRYTPAGIPVLDIILKHESWQEENGQQCLVQLE
PRIB_NEIM0        ---------MGFNNLVSLAALIEKVFPIRYTPAGISVLDIILKHESWQKENGQQCFVQLE
PRIB_NEIG1        ---------MGFTNLVSLAALIEKAFPIRYTPAGIPVLDIILKHESWQEENGQQCLVQLE
A1K3D1_AZOSB      --------MESGLNELRLEATVAELLPLRRTPAGTAVASCTLTHESKQVEAGLERSVRVE
Q3SH32_THIDA      ------------MNRLLISGALIQVEPLRYSPAGVPIAEAVVLHRSTQAVAAQTRQVECE
PRIB_NITEU        MIPNPDPESSINRNQVIISGTITDLASPRYTPAGLMIAEFKLSHCSNQQEAGIQRRIEFE
PRIB_ECOLI        -----------MTNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQ
PRIB_ECO57        -----------MTNRLVLSGTVCRTPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQ
PRIB_SERP5        ----------MTANRLTLSGTVCKTPTRKVSPSGIPHCQFVLEHRSVQVEAGFTRQAWCR
D4GNY5_PANAM      ----------MTVNRLRLSGTVCKTPVRKISPSGIPHCQFVLEHNSVQEEAGFHRQAWCR
PRIB_YERPE        ---------MVTTNRLVLSGTVCKTPVRKVSPSGIPHCQFVLEHRSTQQEAGFSRQTWCR
PRIB_HAEIN        ----MLKSNLKIDNSFSVMGVVSRLPKRLKSPSGIEHCKFLLEHRSDQIESGFTRQAWLK
PRIB_PASMU        ----MLKSNLNIDNRFSLIGIVASQPKRHQSPNGIYHCQFVLEHRSIQEEAGLSRQAWCK
PRIB_ACTSZ        ----MLKSNLKIENRLSLIGVTESV-KRSKSPNGIEHCRIWLEHRSEQQEAGLIRQARCK
PRIB_ACTPJ        MNQRKLASNSPIDNCLILSGSVASTVKQSQNPLGVPNYRFWLEHRSIQTEVNLERQAWCK
PRIB_VIBPA        -----------MTNRMELSGTIAKPPIRSKSPGGIEHCRFWLEHRSTVIEADLPRQVYCR
PRIB_VIBCH        -----------MTNRIELSGVVAKALVRSQSPSGVKHCHFWLEHRSTMVEADLPRQVFCR
A1T039_PSYIN      ---------------MRLSGVVTEKPTFKKSPSGLQHCNLVIEHRSMQEEAELPRNVFCY
PRIB_SHEON        ----------MTTNNLVLSGTITRS-RRFKSPAGIAHSVIMLEHKSQRYEADMLRNVYVQ
                                   :            .* *       : :                

PRIB_BORPE        ISAVALG-DLALLLADTPLGTEMQVQGFLAPARKDS--VKVKLHLQQARRIAGSMGRDPL
Q2KZ20_BORA1      ITAVALG-DLAQMLAGVALGTEMQVEGFLAPARKDS--VKLKLHLQRARKTGGSTGSDPV
D5X3B3_THIK1      IGCVGFG-KIAHEMHRLSPGVLLQVSGFLRASRRGS--RQMKLHVTQYIEV---------
A1TLI2_ACIAC      VKAVAFG-ALAERLARQALGSLWTFQGFLA-TPRNA--KGLVFHIQDIQQD---------
C5CUP1_VARPS      LRAVAFG-AIAERLATQSMGSLWRFQGFLA-TPGNG--KHPVLHIQDFQQD---------
Q128U2_POLSJ      VRAVAFG-TLAEQSAKSPLGKPFRFTGFLI-NARTS--KGVVFHIQAIDQVLNPI-----
B1XXH4_LEPCP      IHATAIG-DVALELGRLAVGTTAEFTGFLG-KQRHG--KGVMLHISAFVSSPQSPELN--
B2JG19_PARP8      MQAVAAG-EASGRLERIEMGVETLFTGFLAKRSRNA--RTLVFHITELQDIGKD------
B2UAG5_RALPJ      MEALAAG-KMASVLDRIAPGTVLDCVGFLARKHRSS--KALVFHISGCNVFVKD------
A4SVX7_POLAQ      VEAIAIG-PIQKDLEQMDLGAQAVFEGFLAPKTLRN--QRLVFHITHIQLKN--------
PRIB_NEIMB        IPARILG-RQAEEWQYRQ-GVYVHVEGFLAQKSRRS--LMPMLRIQNIQEYKG-------
PRIB_NEIM0        IPARILG-RQAEEWQYRQ-GVYVHVEGFLAQKSRRS--LMPMLRIQNIKEYKG-------
PRIB_NEIG1        IPARILG-RQAEEWQYRQ-GDCATVEGFLAQKSRRS--LMPMLRIQNIKEYKG-------
A1K3D1_AZOSB      LQAVAVG-ELASILATVVPGTRVVTTGFLAAKSMRS--RLPVLHLNKIEFVEGN------
Q3SH32_THIDA      LTVQASG-ALADQLAKLPAATQVKLEGALNRRSVNS--RQLILILNRIEKE---------
PRIB_NITEU        FEAIAIA-ETAEKIIRIGSGSNVEITGFIAKKNRLS--NQLVLHVRDTRII---------
PRIB_ECOLI        MPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELIDSGD-----
PRIB_ECO57        MPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELIDSGD-----
PRIB_SERP5        MPVIISGKAHQAITQSITVGTPLTVSGFISSHQGRNGLNKMVLHAEQIELIDSGD-----
D4GNY5_PANAM      MPVIISGSAHQVITQHITVGTQLILEGFISCHQARNGQSKMVLHAEQIELIDSGD-----
PRIB_YERPE        MPIVVSGQQSQALTHSITVGSQLTVEGFISCHQGRNGLNKLVLHAEQIEFIDSGD-----
PRIB_HAEIN        MPVQISGNQLIEKTQSITVGSKILVVGFITSHKTQSGLCQLVLHAEQIEFID--------
PRIB_PASMU        MPVQMSGNQFREKTQSITVGSQLLVVGFISSHKTANGLSQLVLHAEQIEFID--------
PRIB_ACTSZ        MPIQISGHQLIHKTQGITVGSKILVVGFITSHKQTNGLNQLVLHAEHIELLD--------
PRIB_ACTPJ        IQVILNGNQFSLITQQIKLGDKIRVYGFIHTHKDYNGLSQLVVHAEHIEFIDQEKPNGTL
PRIB_VIBPA        MPVVVSGLRSQAITQNLVQGSNIKVSGFVAYQTGRNGVGKLVLHADNITQI---------
PRIB_VIBCH        LPVVVSGARSEALTQNLVQGSSILVSGFLAYQTSRNGVGKLVLHADKISQI---------
A1T039_PSYIN      MPVAASGILASQLKDKLSKGMQIRVSGFITFHQSANKLGKLVLHAQYIEQI---------
PRIB_SHEON        IQVILSGPRFESVADNLKAGVEVQVQGFMTLQQGRNGQNRLVIHAENVELKT--------
                  .     .            .      * :             .                 

PRIB_BORPE        VG--
Q2KZ20_BORA1      LA--
D5X3B3_THIK1      ----
A1TLI2_ACIAC      ----
C5CUP1_VARPS      ----
Q128U2_POLSJ      ----
B1XXH4_LEPCP      ----
B2JG19_PARP8      ----
B2UAG5_RALPJ      ----
A4SVX7_POLAQ      ----
PRIB_NEIMB        ----
PRIB_NEIM0        ----
PRIB_NEIG1        ----
A1K3D1_AZOSB      ----
Q3SH32_THIDA      ----
PRIB_NITEU        ----
PRIB_ECOLI        ----
PRIB_ECO57        ----
PRIB_SERP5        ----
D4GNY5_PANAM      ----
PRIB_YERPE        ----
PRIB_HAEIN        ----
PRIB_PASMU        ----
PRIB_ACTSZ        ----
PRIB_ACTPJ        FPSS
PRIB_VIBPA        ----
PRIB_VIBCH        ----
A1T039_PSYIN      ----
PRIB_SHEON        ----