CLUSTAL format seed alignment for MF_00732

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MNTR_OCEIH            ------------MPTPSMEDYIEIIYNLIESKGYARVSAIAEALDVHPSSVTKMVQKLDK
A0A220U4Z3_9BACI      ------------MPTPSMEDYIEQIYILMESKGYARVSDIAEQLMVHPSSVTKMIQKLDK
MNTR_BACCR            ------------MPTPSMEDYIEQIYLLIDEKGYARVSDIAEALSVHPSSVTKMVQKLDK
MNTR_GEOKA            ------------MPTPSMEDYIEQIYILIEEKGYARVSDIAEALSVHPSSVTKMVQKLDK
MNTR_BACHD            ------------MPTPSMEDYLERIYLLIEEKGYARVSDIAEALEVHPSSVTKMVQKLDK
MNTR_BACSK            ------------MPTPSMEDYLERIYMLIEEKGYARVSDIAEALEVHPSSVTKMVQKLDK
D6XW30_BACIE          ------------MPTPSMEDYLERIYILIEEKGYARVSDIAEALQVHPSSVTKMVQKLDA
A0A1S2LU58_9BACI      ------------MPTPSMEDYLERIYLLIEDKGYARVSDIAEALEVHPSSVTKMVQKLDQ
MNTR_BACLD            ------------MTTPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDK
MNTR_BACSU            ------------MTTPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDK
I0JNX1_HALH3          ------------MPTPSMEDYIEQIYMLIEDKGYARVSDIAENLQVHPSSVTKMVQKLDR
A0A075LQP0_9BACI      ------------MPTPSMEDYIEQIYILMEQKGYARVSDIAENLQVHPSSVTKMVQKLDK
C6CTZ5_PAESJ          ------------MPTPSMEDYLERIYKLIDEKGYARVSDIAEGLEVHPSSVTKMIQKLDK
D3E6J7_GEOS4          ------------MPTPSMEDYLERIYKLIDEKGYARVSDIAEGLEVHPSSVTKMIQKLDK
L0EEK8_THECK          ------------MATPSMEDYLERIYRLIDEKGYARVSDIAEGLDVHPSSVTKMIQKLDK
E3E4Z8_PAEPS          ------------MPTPSMEDYLERIYQLIDEKGYARVSDIAEGLEVHPSSVTKMIQKLDK
A0A0X8D3C8_9BACL      ------------MATPSMEDYLERIYTLIEEKGYARVSDIAEALNVHPSSVTKMVQKLDK
F2F6C2_SOLSS          -----MEREGTAMPTPSMEDHIEQIYLLIEHKGYARVSDIAEALSVLPSSVTKMVQKLDK
MNTR_LYSSC            ------------MPTPSMEDHIEQIYLLIANKGYARVSDIAEALSVLPSSVTKMVQKLDK
A0A0X1RYN6_9BACL      ------------MPTPSMEDHIEQIYLLIDQKGYARVSDIAEALSVLPSSVTKMVQKLDK
A0A087N1X9_9BACI      ------------MPTPSMEDHIEQIYLLIDNKGYARVSDIAEALSVLPSSVTKMVQKLDK
K6DW04_BACAZ          ------------MPTPSMEDYLEQIYLLIDQKGYARVSDIAENLSVQPSSVTKMVQKLDK
MNTR_LISMO            ------------MPTPSMEDYIEKIYSLIETKGYARVSDIADELFVHPSSVTKMVQKLDK
MNTR_LISMC            ------------MPTPSMEDYIEKIYSLIETKGYARVSDIADELFVHPSSVTKMVQKLDK
MNTR_LISW6            ------------MPTPSMEDYIEKIYSLIETKGYARVSDIADELFVHPSSVTKMVQKLDK
W7B115_9LIST          ------------MPTPSMEDYIEKIYSLILNKGYARVSDIADELFVHPSSVTKMVQKLDK
D7UY36_LISGR          MEVLILKVGGSNMPTPSMEDYIEKIYSLIEKKGYARVSDIADELFVHPSSVTKMVQKLDK
                                  * ******::* *: *:  ******* **: * * *******:**** 

MNTR_OCEIH            DQYLDYEKYRGFVLTSKGKKIGERLVFRHELLEEFLEIIGVNDENIYDDVEGIEHHLSWN
A0A220U4Z3_9BACI      DEYVNYEKYRGFILTSKGKKIGERLVFRHELLEQFLTIIGVDNDKIYDDVEGIEHHLSWN
MNTR_BACCR            DEYLIYEKYRGLVLTTKGKKIGERLVYRHDLLEQFMRIIGVDESKIYNDVEGIEHHLSWE
MNTR_GEOKA            DEYLVYEKYRGLVLTPKGRKIGQRLVYRHELLEQFLRLIGVSEENIYRDVEGIEHHLSWN
MNTR_BACHD            SDYLVYERYRGLILTAKGKKIGKRLVYRHDLLEDFLKMIGVDSDHIYEDVEGIEHHLSWD
MNTR_BACSK            SDYLVYERYRGLVLTAKGNKIGKRLVYRHELLEDFMKIIGVDDTHIYKDVEGIEHHISWD
D6XW30_BACIE          KEYLVYEKYRGLVLTGKGRKIGKRLVYRHDLLESFMKIIGVEEEGIYEDVEGIEHHLSWD
A0A1S2LU58_9BACI      TEYVIYEKYRGFVLTPKGKKVGKRLVFRHDLLEEFMRIIGVSNENIYEDVEGIEHHLSWD
MNTR_BACLD            DEYLIYEKYRGLVLTPKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYDDVEGIEHHLSWN
MNTR_BACSU            DEYLIYEKYRGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWN
I0JNX1_HALH3          DQYLNYEKYRGLILTPKGKKVGKRLVYRHELLEQFLEIIGVDKENIYEDVEGIEHHLSWN
A0A075LQP0_9BACI      DEYLKYEKYRGLILTDKGEQVGKRLVYRHELLEDFLRIIGVEEENIYQDVEGIEHHMSWN
C6CTZ5_PAESJ          DNYLIYEKYRGLVLTSKGKKMGKRLVDRHHLLESFLTIIGVQEENIYRDVEGIEHHLSWD
D3E6J7_GEOS4          DEYLIYEKYRGLVLTSKGKKMGKRLMERHHLLEEFLEMIGVQDENIYRDVEGIEHHLSWD
L0EEK8_THECK          DDYLVYEKYRGLVLTAKGKRIGKRLVDRHKLLETFLELIGVREENIYQDVEGIEHHLSWD
E3E4Z8_PAEPS          DDYLVYEKYRGLILTPKGKKVGKRLVDRHQLLEQFLDMIGVDKDLIYKDVEGIEHHLSWD
A0A0X8D3C8_9BACL      SQYLIYEKYRGLVLTSKGKKMGKRLVDRHTLLEDFLRLIGVSEDVIFEDVEGIEHHLSWD
F2F6C2_SOLSS          DGYLIYEKYRGLTLTPKGQKLGKRLVQRHDLLEQFLRLIGVDEERIYEDVEGIEHHLSWN
MNTR_LYSSC            DGYLVYEKYRGLTLTPKGEKLGKRLVQRHELLEQFLRMIGVDEERIYNDVEGIEHHLSWN
A0A0X1RYN6_9BACL      DGYLVYERYRGLTLTSKGTKLGKRLVDRHSLLEKLLRLIGVNEELIYHDVEGIEHHLSWN
A0A087N1X9_9BACI      DGYLNYEKYRGLALTSKGKKLGKRLVQRHELLERFLELIGVDAHTIYDEVEGIEHHLSWH
K6DW04_BACAZ          DDYLIYEKYRGIVLTPKGKKIGQRLLLRHELLEQFLELIGVKKENIYNDVEGIEHHLSWN
MNTR_LISMO            DEYLIYEKYRGLILTPKGTQMGKRLLERHALLESFLSIIGVDPSHIYHDVEGIEHHLSWN
MNTR_LISMC            DEYLIYEKYRGLILTPKGTQMGKRLLERHALLESFLSIIGVDPSHIYHDVEGIEHHLSWN
MNTR_LISW6            DEYLIYEKYRGLILTPKGTQMGKRLLERHALLESFLSIIGVDSSHIYHDVEGIEHHLSWN
W7B115_9LIST          DEYLVYEKYRGLVLTPKGNKAGKRLLERHALLEEFLRTIGVREEHVYEDVEGIEHHLSWN
D7UY36_LISGR          DEYLVYEKYRGLVLTPKGKKVGKRLLERHTLLERFLTIIGVEEEHIYHDVEGIEHHLSWN
                        *: **:***: ** :* : *:**: ** *** ::  ***     : :*******:* .

MNTR_OCEIH            SIDRIGDLVNYFKDDD-SRVKDLKKVIKESDQQVNETAEK
A0A220U4Z3_9BACI      SIDRIGGLVSYFNADK-TRIEDLRKMDNEN----------
MNTR_BACCR            AIDRIGDLVQYFEQDT-VRVETLRGVQRANE----EKSN-
MNTR_GEOKA            AIDRIGDLVQYFQEDE-RRLEALRDVQKRNE----QGE--
MNTR_BACHD            AIDRIGDLVQYFQEDP-SRLNDLREVQKKN-----EE---
MNTR_BACSK            AIDRIGDLVQYFQENQ-TRIDDLREIQKRNDFP--EDE--
D6XW30_BACIE          AIDRIGDLVQFFEENP-ERVEALRDVQRKNDLVNGEDK--
A0A1S2LU58_9BACI      AIDRIGDVVQFFEEDK-TRIDLLRQVQKKNEALNEQNK--
MNTR_BACLD            SIDRIGDLVQYFEDDS-KRIDDLRSVQKRNEQ---ENQ--
MNTR_BACSU            SIDRIGDLVQYFEEDD-ARKKDLKSIQKKTEH---HNQ--
I0JNX1_HALH3          SIDRIGDLVQYFDEKP-ARVDSLREVQQKNEEQNQE----
A0A075LQP0_9BACI      SIERIGNLVEYFREDN-KRKEALIKIQQKQKS--------
C6CTZ5_PAESJ          SITCIETLVEFFNREP-SRLDELRGIRTELETE-------
D3E6J7_GEOS4          SITRIETLVEYFKRDE-NRLQDLRDVHNELVNES------
L0EEK8_THECK          SITCIETLVEYFKRDP-KRLEELAAVRRELENE-------
E3E4Z8_PAEPS          SITRIETLVEYFRRDE-DRLRQLHDIHKELSGDS------
A0A0X8D3C8_9BACL      SITCIECLVQYFQKNP-ERIEDLRKFREAQNDEEGIE---
F2F6C2_SOLSS          SIDRIADLVQLLEEEP-QITKKLEEMKSNHSM--------
MNTR_LYSSC            SIDRIADLVQVMEENP-DIVKKLEASKTQHNL--------
A0A0X1RYN6_9BACL      SIDRIADLIQVLEENP-EFLQKLEVVRNQQED--------
A0A087N1X9_9BACI      SIDRIADLVQLMEDDK-SIQQKLAQIRLQDGEE-------
K6DW04_BACAZ          SIDRIGDLVQYLEKNKQEYENYLMELNNSEKN--------
MNTR_LISMO            SIDRIGDVVQFFENHP-DALKTLKAMETTKPETKE-----
MNTR_LISMC            SIDRIGDVVQFFENHP-DALKTLKAMETNKPETKE-----
MNTR_LISW6            SIDRIGNVVQFFENHP-DALEALKAMETTKPETNE-----
W7B115_9LIST          SIDRIGDLLQFFKEHP-DCLEELHKSQSEDKEDDDV----
D7UY36_LISGR          SIDRIGDVVQYFEENE-AAQQKLKELQAKQGE--------
                      ::  *  ::. :  .       :