CLUSTAL format seed alignment for MF_00733

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ROCA_BACAN       MVVAYKHEPFTDFSVEANKLAFEEGLKKVESYLGQDYPLIIGGEKITTEDKIVSVNPANK
ROCA_BACCR       MVVAYKHEPFTDFSVEANKLAFEEGLKKVESYLGQDYPLIIGGEKITTEDKIVSVNPANK
ROCA_BACSU       MTVTYAHEPFTDFTEAKNKTAFGESLAFVNTQLGKHYPLVINGEKIETDRKIISINPANK
ROCA1_BACHD      MLQPYKHEPFTDFTVEANRKAFEEALGLVEKELGKEYPLIINGERVTTEDKIQSWNPARK
ROCA2_BACHD      MLTPYKHEPFTDFSVEENRSAFEAALKNVEGELGKDYPLVINGERVTTDDKIVSVNPAMK
ROCA2_BACSU      MTTPYKHEPFTNFQDQNNVEAFKKALATVSEYLGKDYPLVINGERVETEAKIVSINPADK
ROCA_STAAM       MVVEFKNEPGYDFSVQENVDMFKKALKDVEKELGQDIPLVINGEKIFKDDKIKSINPADT
ROCA_STAAW       MVVEFKNEPGYDFSVQENVDMFKKALKDVEKELGQDIPLVINGEKIFKDDKIKSINPADT
ROCA_STAES       MVVPFKNEPGIDFSVQTNVERFNEELRKVKAQLGQDIPLVINGEKLTKTDTFNSVNPANT
ROCA_OCEIH       MVLPFKHEPFTDFTVKENRKDYQDALAKVKEELGKDYPLVINGEKIYTDDKLISINPSNK
                 *   : :**  :*        :   *  *.  **:. **:*.**:: .  .: * **: .

ROCA_BACAN       EELVGRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRAAAIVRRRKHEFSAILV
ROCA_BACCR       EELVGRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRAAAIVRRRKHEFSAILV
ROCA_BACSU       EEIIGYASTADQELAEKAMQAALQAFDSWKKQRPEHRANILFKAAAILRRRKHEFSSYLV
ROCA1_BACHD      DQLVGSVSKANQDLAEKAIQSADEAFQTWRNVNPEERANILVKAAAIIRRRKHEFSAWLV
ROCA2_BACHD      EQVIGVVSKASREIVDDAFKSAETAFHTWKNVNPEERANILIRAAAIIRRRKHEFSAWLV
ROCA2_BACSU      EEVVGRVSKASQEHAEQAIQAAAKAFEEWRYTSPEERAAVLFRAAAKVRRRKHEFSALLV
ROCA_STAAM       SQVIANASKATKQDVEDAFKAANEAYKSWKTWSANDRAELMLRVSAIIRRRKAEIAAIMV
ROCA_STAAW       SQVIANASKATKQDVEDAFKAADEAYKSWKTWSANDRAELMLRVSAIIRRRKAEIAAIMV
ROCA_STAES       SQLIAKVSKATQDDIEKAFESANHAYQSWKKWSHKDRAELLLRVAAIIRRRKEEISAIMV
ROCA_OCEIH       NEVVGNVSKATKQHIEEAFTSAKEAFKEWKSWSAEDRARVLYRAAAIVRRRKHEFSAWLS
                 .:::. .*.* ::  :.*:  *  ::. *:    : ** :: :.:* :**** *::: : 

ROCA_BACAN       KEAGKPWNEADADTAEAIDFMEYYGRQMLKLKDGIPVESRPIEYNRFSYIPLGVGVIISP
ROCA_BACCR       KEAGKPWNEADADTAEAIDFMEYYGRQMLKLKDGIPVESRPIEYNRFSYIPLGVGVIISP
ROCA_BACSU       KEAGKPWKEADADTAEAIDFLEFYARQMLKLKEGAPVKSRAGEVNQYHYEALGVGIVISP
ROCA1_BACHD      HEAGKPWKEADADTAEAIDFLEYYARQMIELNRGKEILSRPGEQNRYFYTPMGVTVTISP
ROCA2_BACHD      KEAGKPWKEADADTAEAIDFLEYYARQMITLKDGKPVNSREGEHNRYFYTPIGVCVTISP
ROCA2_BACSU      KEAGKPWNEADADTAEAIDFMEYYARQMIELAKGKPVNSREGEKNQYVYTPTGVTVVIPP
ROCA_STAAM       YEAGKPWDEAVGDAAEGIDFIEYYARSMMDLAQGKPVLDREGEHNKYFYKSIGTGVTIPP
ROCA_STAAW       YEAGKPWDEAVGDAAEGIDFIEYYARSMMDLAQGKPVLDREGEHNKYFYKSIGTGVTIPP
ROCA_STAES       YEAGKPWDEAVGDAAEGIDFIEYYARSMMELADGKPVLDREGEHNRYFYKPIGTGVTIPP
ROCA_OCEIH       YDAGKPWDQADGDTAEGIDFLEYYARHMVELEKGKPLADRPNEDNKYFYQPLGPGVVIPP
                  :*****.:* .*:**.***:*:*.* *: *  *  : .*  * *:: * . *  : *.*

ROCA_BACAN       WNFPFAIMAGMTTAALVSGNTVLLKPASTTPVVAAKFMEVLEEAGLPAGVVNFVPGNGSE
ROCA_BACCR       WNFPFAIMAGMTTAALVSGNTVLLKPASTTPVVAAKFMEVLEEAGLPAGVVNFVPGNGSE
ROCA_BACSU       FNFPLAIMAGTAVAAIVTGNTILLKPADAAPVVAAKFVEVMEEAGLPNGVLNYIPGDGAE
ROCA1_BACHD      WNFALAIMVGTAVAPIVTGNTVVLKPASTTPVVAAKFVEVLEDAGLPKGVINYVPGSGAE
ROCA2_BACHD      WNFALAIMAGTTVAPIVTGNTVLLKPASTTPVVAAKFVEVLEEAGLPKGVVNFVPGSGTD
ROCA2_BACSU      WNFLFAIMAGTTVAPIVTGNTVVLKPASATPVIAAKFVEVLEESGLPKGVVNFVPGSGAE
ROCA_STAAM       WNFPFAIMAGTTLAPVVAGNTVLLKPAEDTPYIAYKLMEILEEAGLPKGVVNFVPGDPKE
ROCA_STAAW       WNFPFAIMAGTTLAPVVAGNTVLLKPAEDTPYIAYKLMEILEEAGLPKGVVNFVPGDPKE
ROCA_STAES       WNFPFAIMAGTTLAPVVAGNTVLLKPAEDTVLTAYKLMEILEEAGLPQGVVNFVPGDPKE
ROCA_OCEIH       WNFAFAIVCGTTVAPIVAGNPVLLKPSENTPVIAYKLVEVLEEAGLPKGVLNFVPGDPAE
                 :** :**: * : *.:*:**.::***:. :   * *::*::*::*** **:*::**.  :

ROCA_BACAN       VGDYLVDHPRTRFISFTGSRDVGIRIYERAAKVNPGQIWLKRVIAEMGGKDTIVVDKEAD
ROCA_BACCR       VGDYLVDHPRTRFVSFTGSRDVGIRIYERAAKVNPGQIWLKRVIAEMGGKDTIVVDKEAD
ROCA_BACSU       IGDFLVEHPKTRFVSFTGSRAVGCRIYERAAKVQPGQKWLKRVIAEMGGKDTVLVDKDAD
ROCA1_BACHD      VGDYLVDHPKTSLITFTGSKDVGVRLYERAAVVRPGQNHLKRVIVEMGGKDTVVVDRDAD
ROCA2_BACHD      IGDYLIDHPKTSLITFTGSRDVGVRLYERAAVVHPGQQHLKRVIVEMGGKDTVVVDKDAD
ROCA2_BACSU      VGDYLVDHPKTSLITFTGSREVGTRIFERAAKVQPGQQHLKRVIAEMGGKDTVVVDEDAD
ROCA_STAAM       IGDYLVDHKDTHFVTFTGSRATGTRIYERSAVVQEGQNFLKRVIAEMGGKDAIVVDENID
ROCA_STAAW       IGDYLVDHKDTHFVTFTGSRATGTRIYERSAVVQEGQNFLKRVIAEMGGKDAIVVDENID
ROCA_STAES       IGDYLVDHKDTHFVTFTGSRATGTRIYERSAVVQEGQQFLKRVIAEMGGKDAIVVDNNVD
ROCA_OCEIH       IGDYLVDHKDTHFINFTGSRATGVRIFERATKIQDGQTHLKRIVAEMGGKDTIIVDESAD
                 :**:*::*  * ::.****: .* *::**:: :. **  ***::.******:::**.. *

ROCA_BACAN       LELAAKSIVASAFGFSGQKCSACSRAVIHEDVYDHVLNRAVELTKELTVANPAVLGTNMG
ROCA_BACCR       LELAAKSIVASAFGFSGQKCSACSRAVIHEDVYDHVLNRAVELTKELTVANPAVLGTNMG
ROCA_BACSU       LDLAASSIVYSAFGYSGQKCSAGSRAVIHQDVYDEVVEKAVALTKTLTVGNPEDPDTYMG
ROCA1_BACHD      LDLAAESILVSAFGFSGQKCSAGSRAVIHKDVYDEVLEKTVALAKNLTVGDPTNRDNYMG
ROCA2_BACHD      LDLAAQSIVTSAFGFSGQKCSAGSRAVIHQDVYDVVLEKAVALTKQLSVGEPTAPDVYMG
ROCA2_BACSU      IELAAQSIFTSAFGFAGQKCSAGSRAVVHEKVYDQVLERVIEITESKVTAKPDSADVYMG
ROCA_STAAM       TDMAAEAIVTSAFGFSGQKCSACSRAIVHKDVYDEVLEKSIKLTKELTLGN-TVDNTYMG
ROCA_STAAW       TDMAAEAIVTSAFGFSGQKCSACSRAIVHKDVYDEVLEKSIKLTKELTLGN-TVDNTYMG
ROCA_STAES       TDLAAEAIVTSAFGFSGQKCSACSRAIVHQDVHDEILEKAIQLTQKLTLGN-TEENTFMG
ROCA_OCEIH       LDLAAESIVHSAFGFSGQKCSACSRAVIHESVYDEVIEKSVELAKTLTVGNPTEDNVYMA
                  ::**.:*. ****::****** ***::*:.*:* :::: : :::    ..    .  *.

ROCA_BACAN       PVNDQAAFDKVMSYVAIGKEEGRILAGGEGDDSKGWFIQPTIVADVAEDARLMKEEIFGP
ROCA_BACCR       PVNDQAAFDKVMSYVAIGKEEGRILAGGEGDDSKGWFIQPTIVADVAEDARLMKEEIFGP
ROCA_BACSU       PVIHEASYNKVMKYIEIGKSEGKLLAGGEGDDSKGYFIQPTIFADVDENARLMQEEIFGP
ROCA1_BACHD      PVIDEKAFEKIMSYIEIGKKEGRLMTGGEGDSSTGFFIQPTIIADLDPEAVIMQEEIFGP
ROCA2_BACHD      PVVDQGAFSKIMSYIEVGKEEGRLMVGGEGDDSKGFFIQPTIFADVDPHARIMQEEIFGP
ROCA2_BACSU      PVIDQGSYDKIMSYIEIGKQEGRLVSGGTGDDSKGYFIKPTIFADLDPKARLMQEEIFGP
ROCA_STAAM       PVINKKQFDKIKNYIEIGKEEGKLEQGGGTDDSKGYFVEPTIISGLKSKDRIMQEEIFGP
ROCA_STAAW       PVINKKQFDKIKNYIEIGKEEGKLEQGGGTDDSKGYFVEPTIISGLKSKDRIMQEEIFGP
ROCA_STAES       PVINQKQFDKIKNYIEIGKKEGKLETGGGTDDSTGYFIEPTIFSGLQSADRIMQEEIFGP
ROCA_OCEIH       SVVNQKQFDKIKDYIEVGKQEGELVFGGETDDNKGFFVHPTIFKDLDPKARIMQEEIFGP
                 .* .:  :.*: .*: :**.**.:  **  *...*:*:.***. .:     :*:******

ROCA_BACAN       VVAFCKAKDFDHALAIANNTEYGLTGAVISNNRDHIEKAREDFHVGNLYFNRGCTGAIVG
ROCA_BACCR       VVAFCKAKDFDHALAIANNTEYGLTGAVITNNRDHIEKAREDFHVGNLYFNRGCTGAIVG
ROCA_BACSU       VVAICKARDFDHMLEIANNTEYGLTGALLTKNRAHIERAREDFHVGNLYFNRGCTGAIVG
ROCA1_BACHD      VVAFSKANDFDHALEIANNTEYGLTGAVITRNRAHIEQAKREFHVGNLYFNRNCTGAIVG
ROCA2_BACHD      VVAFSKARDFDHALEIANNTEYGLTGAVITTNRHHIEKAKRDFHVGNLYFNRNCTGAIVG
ROCA2_BACSU      VVAFCKVSDFDEALEVANNTEYGLTGAVITNNRKHIERAKQEFHVGNLYFNRNCTGAIVG
ROCA_STAAM       VVGFVKVNDFDEAIEVANDTDYGLTGAVITNNREHWIKAVNEFDVGNLYLNRGCTSAVVG
ROCA_STAAW       VVGFVKVNDFDEAIEVANDTDYGLTGAVITNNREHWIKAVNEFDVGNLYLNRGCTSAVVG
ROCA_STAES       VVGFIKVKDFDEAIEVANDTDYGLTGAVITNHREHWIKAVNEFDVGNLYLNRGCTAAVVG
ROCA_OCEIH       VVAFSKAKSFDELLDIANNTEYGLTGAVISNNRENLNRAQTEFLVGNLYFNRGCTAAIVG
                 **.: *. .**. : :**:*:******::: :* :  :*  :* *****:**.**.*:**

ROCA_BACAN       YQPFGGFNMSGTDSKAGGPDYLALHMQAKTTSETL
ROCA_BACCR       YQPFGGFNMSGTDSKAGGPDYLALHMQAKTTSETL
ROCA_BACSU       YQPFGGFNMSGTDSKAGGPDYLILHMQAKTTSEAF
ROCA1_BACHD      YHPFGGFKMSGTDSKAGGPDYLALHMQAKTVSEMY
ROCA2_BACHD      YHPFGGFKMSGTDSKAGGPDYLALHMQAKTVSEMY
ROCA2_BACSU      YHPFGGFKMSGTDSKAGGPDYLALHMQAKTISEMF
ROCA_STAAM       YHPFGGFKMSGTDAKTGSPDYLLHFLEQKVVSEMF
ROCA_STAAW       YHPFGGFKMSGTDAKTGSPDYLLHFLEQKVVSEMF
ROCA_STAES       YHPFGGFKMSGTDAKTGSPDYLLNFLEQKVVSEMF
ROCA_OCEIH       YQPFGGFKMSGTDSKAGGPDYLQHFLNAKVVTERF
                 *:*****:*****:*:*.****  .:: *. :*