CLUSTAL format seed alignment for MF_00735

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PRMA_PSEPK        --------MPWLQVRLAISPEQA----ETYEDALLE-VGAVSVTFMDAEDQP--------
PRMA_PSESM        --------MPWLQVRLAISPEQA----ETYEDALLE-VGAVSVTFMDAEDQP--------
PRMA_MARHV        --------MPWIQLQIPADPDTA----DQLEDLLME-MGADAVSMEDAADQP--------
PRMA_VIBCH        --------MPWIQIKLNATNDNA----EAIGDMLMEETGAVSVTFLDAKDTP--------
PRMA_VIBVU        --------MPWIQIKLNATNENA----ELIGDMLMEETGALSVTFLDAHDTP--------
PRMA_SALTY        --------MPWIQLKLNTTGANA----EELSDALME-AGAVSITFQDTHDTP--------
PRMA_ECOLI        --------MPWIQLKLNTTGANA----EDLSDALME-AGAVSITFQDTHDTP--------
PRMA_HAEIN        --------MAWIQIRLNSTNEKA----EQMSDFLEE-IGSVSVTFMDSQDTP--------
PRMA_SHESA        --------MPWIQLRINTNSDDA----ETISDLLME-EGAVSITFEDGKDTP--------
PRMA_SHEON        --------MPWIQLRINTNSDDA----ETISDLLME-EGAVSITFEDGKDTP--------
PRMA_PSYWF        --------MDWQQLHLQCAKQDV----DLAESLLLE-EGALSISLEDAGDQP--------
PRMA_XANAC        --------MPFLELTLSCSEVTL----PRFQNALDD-VGALAVTMLDADADTSNER----
PRMA_XANCP        --------MPFLELTLPCTRATQ----PRFENALED-VGALAVTMLDAHAGTINER----
PRMA_XYLFA        --------MAFLEVSVQCQGRSQ----ARYEEVLES-FGALAVTLLDADADTVRER----
PRMA_XYLFT        --------MAFLEVSVQCQERSQ----ARYEEVLES-FGALAVTLLDADADTVRER----
PRMA_HALHL        --------MAQLQVTLEVAAGDL----DAVDGALEL-AGALSQTYQADDGTV--------
PRMA_BURVG        --------MSYRELVVELAREHA----EALSDALLD-LGALSVSVEDADADTPDEQP---
PRMA_BURL3        --------MSYRELVVELAREHA----EALSDALLE-LGALSVSVEDADADTPDEQP---
PRMA_BORBR        ----------MRELVLNCREAQA----DALSDALLE-AGVLSVSVEDADLGTEAERP---
PRMA_NEIMA        --------MPYQQITVNVNDAVA----ERLADALME-HGALSAAIEDAYAGTQNEQA---
PRMA_CHRVO        --------MAWLQATIDSDSAVA----ERLADALMD-AGALSTAIEDAWAGTDKEQP---
PRMA_NITEU        --------MSWLSLTFRIGSDYV----DLVGDRLLE-RGALSVDVHDAGEGTSQEQP---
PRMA_DICNV        -----MTQRHWLELTLIADNDDD----VLLLETALECAGAVAVTYQAANEEE--------
PRMA_OPITP        --------MSLVEVRVEIPSAEA----EAVNELLLEQELAAWSVFEDVVVGR--------
D5ELE0_CORAD      -------MSTQTELRAIVSAELA----DELEAYFFETETAYWGVMQRERNDP--------
PRMA_ENTFA        --------MKWTEVKVETASEA-----VEAISNIMMEAG-ASGVAIEDALDIENF-----
PRMA_LACPL        --------MKWTEVTVSTSNEA-----VEAVANILMEAG-ASGVKIDDALDYQNL-----
PRMA_OCEIH        --------MKWSEISIHTTNEA-----IEPISNILHETG-ASGLVIEDPLDLERV-----
PRMA_BACSU        --------MKWSELSIHTTHEA-----VEPISNILHEAG-ASGVVIEDPLDLIKE-----
PRMA_BACCR        --------MKWSEISIHTTEEA-----VEAVSHILHEAG-ASGVAIEDPAELTKE-----
PRMA_STRZJ        -------METWQELKVTVKREG-----EELVSNLLIELG-AQGVAIEDSLDYVG------
PRMA_STRR6        -------METWQELKVTVKREG-----EELVSNLLIELG-AQGVAIEDSMDYMG------
PRMA_LACLA        -------MNNWNSITIKISREA-----GEAISALLIEAG-SAGVEINDSADYLN------
PRMA_STAAM        --------MNWTELSIIINHEA-----VELATNILENHG-SNGVVIEDSDDLINQ-----
PRMA_CALS4        --------MKWLEIQVTTSQEA-----EEAVTGILYDLG-AGGVVIKNPNDVKEL-----
PRMA_LACP7        --------MKWKKLSLETTTEA-----VDLVCDMLLSLG-IEGIEVVDKVPITE------
PRMA_LACDA        --------MKLLEIKIESSYDV-----EDALAYFATEDLKALGTEARRRSDFEQA-----
PRMA_LACAC        --------MKLLIIKIDTSYEV-----EDALGVFATDNLKALGIESRKRSDFEQA-----
PRMA_THEM4        ------MKKKFFERVYSISKED-----VEKVEEYFFDKGISNYYFYETK-----------
PRMA_THEAB        ------MNKVFNEFVYKISQDQ-----IEKIEEYFFENNIKNYYFYETK-----------
A7HNK9_FERNB      ------------------------------MDDLLY--GEYDYYIIDSS-----------
PRMA_THEMA        --------MRFKELILPLKIE------EEELVEKFYEEGFFNFAIEEDK-----------
PRMA_CAMC1        --------MKDKFYELS-IKTSN---FYDEILELVFSFGVTCVEELD-------------
PRMA_CAMHC        --------MKKNYYEME-VSSKN---ASELFKNFSFELGVEAIEEKE-------------
PRMA_CAMJE        --------MQKKYYELFFIVEEQ---YKNLFLDFAFDLGIEAIEEKD-------------
PRMA_NITSB        --------MDRYYYEYT-VDIDA---FKDEIESFLMDRFYNGIEESD-------------
PRMA_WOLSU        --------MGEFYHELT-LSPSS---YLELFSDFLLEATGEGIEEEG-------------
PRMA_HELHP        --------MDKQTYWEIIIHPSD---FLDQFTDFIIQKTSCAIEFFDILPTPSH------
PRMA_HELPY        -------MLKPMYYEFFFIFPK----ERELFESFLLDATHLALEESSLENLKAFDDKETI
PRMA_HELPJ        -------MLESMYYEFFFIFPK----ERELFESFLLDTTHLALEESSLENLKAFDDKETI
PRMA_AQUAE        -----MMKIKRFVYSLP----------EEEFYELVYSQN-LSVEVLE-------------
D3SNG3_THEAH      --------MKKYIYQLS----------EEEFYNFLLAYK-KGVELIS-------------
C0QSF8_PERMH      --------MKKLIYSLP----------TSLFEIFAVEFNGYGFEILN-------------
C1DW65_SULAA      --------MKKYICEIP----------SNLFEIFLVELNGYGVEILN-------------
PRMA_CHLTE        ------MQPPKTHNHIELAFEID----SDLYELYIAVLSQVGIEYFL-------------
B3QUV4_CHLT3      ----MTESAKHKKTTIQISAEVL----VENFDVAIGLLSLEGIDTFH-------------
PRMA_PORGI        --------MKYIAYAFELTHRPDELTLETAYDLLSAELAEIGFESFE-------------
PRMA_BACTN        --------MKYFEFTFHTSPCT-----ETVNDVLAAVLGEAGFESFV-------------
F9ZBU4_ODOSD      --------MNYIEVTFDITPYE-----EAVADALISELGTIGYDGFS-------------
F0RGF5_CELLC      -------MADLVYIEYNFTVAPL----QPASDILIAQLGEVGFDSFV-------------
A6H072_FLAPJ      --------MSNIYLGYHFIVEPK----ELGSEILIAELGEKAFESFV-------------
Q26FA8_FLABB      ---MSHSVTDQIYIEYQFTITPL----QPWNDVLIAQLGEVGFESFV-------------
C6XTZ6_PEDHD      --------MQYIQVTFSFTAIE-----EYQQDLLIADLADIGFNTFE-------------
F4KWZ6_HALH1      --------MNYLQYTFPATPDLQ--------EILVALLGDLPFDTFE-------------
PRMA_SYNY3        ----MAAANSWWEIRILCHPSL-----EETAFWRLEKFGCLGTSTEK-------------
PRMA_NOSS1        ------MANTWWELQISCESAL-----EDSVSWRLEDFGCRGTASES-------------
PRMA_THEEB        ------MVQRWWEITVTCQAEA-----EELVYWRLQSFGCQGTATQL-------------
PRMA_PROMM        --MNFAAALRWWRLSLPIADEL-----EESLIWKLTDLGLCRLAVQHAP-----------
PRMA_SYNPX        ---------------MACPPEL-----EESLVWKLTDLGLHRHAVQHAP-----------
PRMA_PROMA        --MIQSTEFFWWKFELVFPPDV-----EESFLWFLNMAGIKSYAIERSP-----------
PRMA_PROMP        -----MEIKNWYELTFEIETNL-----EEIIIWKLNELGISSYAFEILL-----------
PRMA_BRUME        --------MAQSRLFFSADKAEAERTYNILEQAFEDDGFPIAITEIDE------------
PRMA_RHILO        --------MTQTRLHFTTGKIEAERIFAALELAFEDEGLPIAVLEVDE------------
Q1YM86_AURMS      --------MPQIRFYVTADKAAADACYAAVETAFEDLGTPVSLAEIDE------------
PRMA_AGRFC        --------MSEIRLYVTTTEIKAGEILDLMSDYFGEEDVAIATTEVDE------------
J7Q4B7_METSZ      MLEGLPPNNASHMLRLDCDEKRARAVADLIVETFEPTETAAAAFELD-------------
D7A7G7_STAND      MLEGLPPNGATHVMRVEAPEREARAISDIISESFDPADVATAAFEREDLA----------
PRMA_BEII9        -----MSTDTSTVLRLDCEEAIAEQIADLVAETFSSDEAAASTFELKPAERKE-------
PRMA_BRADU        ----MQPSPTHRASFSIGSEAAARRVVDVLTEVFFEGDAAVAAFERP-------------
I3TVK6_TISMK      ---MSSPSDPARLVWRLTLEVPGLEHVSAVETALEPFVESLTSFEVIE------------
G8AFP8_AZOBR      ---MSSSK-----LWRIALVIPE-AHAPAFAEAIGDHADAVSTFELEE------------
J8VVC4_9SPHN      -------MSWKVTVFAARPVIEAALVAHEDAWDWDHEIVLSGREVAED------------
Q2N9W3_ERYLH      -----MTASWKLTAFAPKPVIQSALLAHDEAWDWDDAVVISGREVAED------------
A4EPW0_9RHOB      --------MPTFTALTTLTGKSQAEALGEAMERLIPEPTGVGVFEMED------------
PRMA_CAUVC        -----MTDYTPQQIVARGARLEAETAADAIDNHPGLEGATYSILEEDE------------
PRMA_DEIRA        ---------------MLVYLLPGSFDTREAHLDLLWEAGATGLEERGP------------
PRMA_DEIGD        ---------------MLVYHLPGTLDTREADLDLLWAAGATGLEERGG------------
PRMA_THET8        ---------------MWVYRLKGTLEALDPILPGLFDGGARGLWEREG------------
H2J703_MARPK      --------MNFIEYIFILPENQE-----EDVETFLAINEFQNYYIDKPTK----------
PRMA_DESAL        --------MQWMEIKIVFDAAEP-ELAQEMVSYLVMEHGAEGLEMTTPGETGMVQ-----
PRMA_FUSNN        ------MKMKVLEAKIIYESDDL-EKYKKIISDIFYSFGVTGLKIEEPILNKDP------
PRMA_MYXXD        ------MSQTYLSLTVELPEEAS-----EAVQDLLHESGALGLEVRDRE-----------
PRMA_SORC5        ------MEPRYPFVAVDVPEPE-----ADEIGALLFELGASGVEQRD-------------
PRMA_SALRD        --------MDTIELTLTIPPVEH--------APFLAELEEPATGFVQ-------------
E6VWN0_PSEA9      -------MSTLLKIEFVTAEDHA-----DEAGIFIATKVPHGWEETPCG-----------
PRMA_DESPS        --------MHTMKKWLKISIEANPLMVEVVSDYLVGIHGAGVDLAADKDENP--------
PRMA_LEPIN        --------MRYREIILSIPKEIA-----ENFTSFLDEVGVVGYYEILFDREVPRAP----
I4CAY3_DESTA      --------MNTANLKWMNARIFVVRDLADAVANFCHEHGSEGLVLEDTS-----------
C0Z9H1_BREBN      ------MENMWLKYTLLVEPEIEDLFVAEVLTSSYTLGWIEPQIEVLTTENGYDY-----
E1X260_HALMS      ---MNDKKFYEVKVVFNNTESLDLESLNSRAMGEFDCDGVQEFSLDEPTVDKILGERAYS
                                                                              

PRMA_PSEPK        --------------------IFEPD-LNTTPLWSHTHLLALFEANADPEQVFAHLR----
PRMA_PSESM        --------------------IFEPE-LNTTPLWTHTHLLALFEADTNAELALAHLS----
PRMA_MARHV        --------------------LYEPD-PGTTPLWSQTTVTGLFQSDRNIEQLLADIRDAWH
PRMA_VIBCH        --------------------VFEPL-PGETRLWGDTDVVALYEADMDTSLILQQIKA---
PRMA_VIBVU        --------------------VFEPL-PGETRLWGDTDVLALYDAEADTQLIMSQIKA---
PRMA_SALTY        --------------------VFEPL-PGETRLWGDTDVIGLFDAETDMKDVVAILEQ---
PRMA_ECOLI        --------------------VFEPL-PGETRLWGDTDVIGLFDAETDMNDVVAILEN---
PRMA_HAEIN        --------------------IFEPL-PGETRLWGNTDVIALFDAETDMAEIVRLLKE---
PRMA_SHESA        --------------------IFEPK-LGETPLWQDTVVVALFEADTDLAPTIEMLKT---
PRMA_SHEON        --------------------IFEPK-LGETPLWRDTVVVALFEADTDLTPTIEMLKT---
PRMA_PSYWF        --------------------LFEPL-PGQSPLWDEVILTGLFTADT-AQDIESMAQT---
PRMA_XANAC        -------------------AILEPG-VGEMPLWDRLTMTALFDGDSDALVVLAALEAF--
PRMA_XANCP        -------------------AILEPG-VGEVRLWEETELTALFDGDSDPLMLLAALEAF--
PRMA_XYLFA        -------------------GVFEPG-VGETVLWDVVVLSALFPVETDALGLLAGLEGA--
PRMA_XYLFT        -------------------GVFEPG-VGETVLWDVVVLSALFPVETDALGLLAGLEGA--
PRMA_HALHL        --------------------LLEPG-VGEHPLWEQVRVDALFPPETDPDALHTLLAG---
PRMA_BURVG        -------------------LFGEPGLVPERTAWQHSRVVALLSPDLEPAVLL--AAAAN-
PRMA_BURL3        -------------------LFGEPGLVPDRTAWQHSRVVALLAADHEPAVLL--AAAAN-
PRMA_BORBR        -------------------LFGEPGTEPQVQAWERNCVVALLPDGADPAQILEQAIAAA-
PRMA_NEIMA        -------------------IFGEPG-MPAEQIWQQSKVIALFGEHDEAAAII--QTAAQ-
PRMA_CHRVO        -------------------IFGEPG-EPVDQLWSQSRIITLFDESADVALLI--AAAAN-
PRMA_NITEU        -------------------LFGEPG-APLDQFWQQAEVTVLLEENANIDEII--QGVAE-
PRMA_DICNV        --------------------IFEPE-IGTTPMWSKTGVTGLFPLDTDPNAVIELLMQ---
PRMA_OPITP        -----------------------------------AWLIGLFPDQTAARDAAAALRP---
D5ELE0_CORAD      -----------------------------------YEVFGFFPDEDTADAELAELRK---
PRMA_ENTFA        ---------------ESDLYGEILDKEQFTHIKEGAIVMAYFPETTFLTEILPFMKENIL
PRMA_LACPL        ---------------KPDRYGEIIDLATIPHVTSGAKISAYYPETVFVPEVIPTIKQRVS
PRMA_OCEIH        ---------------EKAEFGELYDLDPALYPEEGVRIKAYLPMNSFLGETVEEIKSAIN
PRMA_BACSU        ---------------RENVYGEIYQLDPNDYPDEGVIVKAYLPVNSFLGETVDGIKETIN
PRMA_BACCR        ---------------REQQYGEIYALNPDEYPAEGVLIKAYFPQTDSLHETIAGVKSSID
PRMA_STRZJ        ---------------NVDRFGEIF---PEVEQQEEIVVTAYYPDTVDVTVVEADLQARIS
PRMA_STRR6        ---------------NVDRFGEIF---PEVEQQEEIVVTAYYPDTVDVTVVEADLQARLA
PRMA_LACLA        ---------------HEDQFGEVL---PEIEQSDFVEITAYYPENMPIVELKAEIEHKIA
PRMA_STAAM        ---------------PEDKYGEIYALKKEDYPDKGVRLKAYFNEMTYDDKLRQQIKDELL
PRMA_CALS4        ---------------AQTSEWDYFDPSLLEEGEE-VKISAYFLITTDITDKVNFLKERIW
PRMA_LACP7        ---------------EEKKRMFIDILPELGEDDGIATINFYLENEEDLPSLKVSIQEGLD
PRMA_LACDA        ---------------GWLHDSTVVDMDDIPNLPDELEFIAYFDEETDPEEMVKCFKDKLA
PRMA_LACAC        ---------------GWLHDSTVVEMDDIKDLPKDTYFYAYFDEEADKDELVEKFQAKLE
PRMA_THEM4        --------------------------------------------EGVFLVLVS-----EK
PRMA_THEAB        --------------------------------------------EGTFLVLVF-----EE
A7HNK9_FERNB      --------------------------------------------EGKFLAVVSPYMDDLS
PRMA_THEMA        --------------------------------------------KGKKVLKIYL----RE
PRMA_CAMC1        ---------------------------------HEIIIREEYDLKD-IAWGVEEYAKGLS
PRMA_CAMHC        ---------------------------------NSFIIRDEEDLQN-LEFAFIEFQKALQ
PRMA_CAMJE        ---------------------------------NGVYIRSHESLEE-FSWALEIFAQKLT
PRMA_NITSB        ---------------------------------GKLILRSEKSLDD-IMDELRTYVDSLI
PRMA_WOLSU        ---------------------------------NSIIVRSDQDLSW-LIEALQEFCQTLS
PRMA_HELHP        ---FAIIYDDASWQSVLGFDILKAKKSKQPTQIVSRIASNEINIQD-FLESLQHFALMLA
PRMA_HELPY        GFISQSNWHYFATHDPLKKDLKENLKEKPPHLKNFVILRSQKDLNNSLIPALEAFCLNLK
PRMA_HELPJ        EFVSQSSWRYFATHDPLK----ENLKEKPPHLKNFVILRSEKNLSDSLFPALEAFCLNLK
PRMA_AQUAE        -------------------------------RKEIEVIFASYKEIE--------------
D3SNG3_THEAH      -------------------------------QEENLITFATYEPVE--------------
C0QSF8_PERMH      -------------------------------RDTEETVFAIYVDDKELKSVKEAVQEIFE
C1DW65_SULAA      -------------------------------KDENITVFAIYDYDK------DAINNIFE
PRMA_CHLTE        --------------------------------EDDHKLLAYLPESDWNADKEASINIMLQ
B3QUV4_CHLT3      --------------------------------EDNDILRFYMDAQDWTDEKRESVRGILK
PRMA_PORGI        --------------------------------QNETCLRAYIPVSTDIASDIPAL-LEQF
PRMA_BACTN        --------------------------------ESEGGLTAYIQQALCDENTIKNA-ITEF
F9ZBU4_ODOSD      --------------------------------YTDQGFTAYIPAKDYNAQAITRLEIFDF
F0RGF5_CELLC      --------------------------------ENEEGVQAYILKDLWTEEKVKNV--QIL
A6H072_FLAPJ      --------------------------------ETETGFSAFVQKSLWTEDIMNDV--YIL
Q26FA8_FLABB      --------------------------------ETESGVTGYVLKSLDHDSILEDV--DLM
C6XTZ6_PEDHD      --------------------------------DTANGFIAFAAAGTYDEDQLKSL--LEQ
F4KWZ6_HALH1      --------------------------------EGSENLMAFVPMPADVAALSAEV---QE
PRMA_SYNY3        -------------------------------KAHSLLVRGYLPQEKAEILDLAALALWCE
PRMA_NOSS1        -------------------------------KGDSCLVKGYLPIFQAQLLDLAALGLWLQ
PRMA_THEEB        -------------------------------QQGRVLIQGYVPQQRVSLLDIAALGVWIE
PRMA_PROMM        ------------------------------ENSER-TLLAWLPSSEWSESDRDQLMANLR
PRMA_SYNPX        ------------------------------ETPDRKQLLLWLPQPEWPEAERQQLLASLE
PRMA_PROMA        ------------------------------DNLQDQTLMVWLPSHEWLKKDREEFENSLL
PRMA_PROMP        ------------------------------NNKNNKKVIIWLPHLNWPESLRIKLVRNIK
PRMA_BRUME        -------------------------------DRQIFEVSVYVEDD-AEEVAARV-DALVG
PRMA_RHILO        -------------------------------DQDIHEVSLYADGD-VDTVEARVKDILAG
Q1YM86_AURMS      -------------------------------AKAIFEVSAYVDAP-DGEEAERLFAGAIA
PRMA_AGRFC        -------------------------------KRDIWEASVYLMAEQEEEFRERVSTLLAP
J7Q4B7_METSZ      -------------------------------DGPQWSVEIYFATAPDEAQILALIEAAAD
D7A7G7_STAND      -------------------------------EGAPWAVEAYFAEAPDEDSLRDLIALVA-
PRMA_BEII9        -------------------------------GLPGWRVEIFLTASVSEEAVRALVATIAG
PRMA_BRADU        --------------------------------DGQWDVTLHFADAPDQAWLRELVVNSAG
I3TVK6_TISMK      -------------------------------DGLWWRVTGYARGPRPDMAEIGTRISLTA
G8AFP8_AZOBR      -------------------------------HGDWL-VEATVYG-QPDEPRLNARVAVLA
J8VVC4_9SPHN      -------------------------------QPEDWVLEAWLDRKPSKADNVAITALFAD
Q2N9W3_ERYLH      -------------------------------RPEDWVLECWYPRRPTKADKQAAAALFAG
A4EPW0_9RHOB      -------------------------------GSGLWEVGAYFTEEPDQAGLALLATMHGA
PRMA_CAUVC        -------------------------------DRGVWRIDAFPTTDEEDASLMALLGGYDL
PRMA_DEIRA        ------------------------------------NIRVYFDERTELPAEVADGEWHEE
PRMA_DEIGD        ------------------------------------VIRAYFDTRTELPPQVSDGEWREE
PRMA_THET8        ------------------------------------EVWAFFPAPVDLPYE---GVWEEV
H2J703_MARPK      ---------------------------------GQEAIKLYINPNYPEQEVLNFFEDRFE
PRMA_DESAL        -----------------------DGSGSSVPDSKEHSVTAFLPLDDLFEGRKADLTRALD
PRMA_FUSNN        ---------------------LNFYKDEKQFLISENSVSAYFPLNIYSEKRKKVLEETFA
PRMA_MYXXD        -------------------------------APLMPGVRGPNPGEAIIIGYFDERDTAES
PRMA_SORC5        ---------------------------------EQTLVRGARSGQVTLVASFEDHGEAME
PRMA_SALRD        ---------------------------------NDTELRAYVPAERWAAVDQKQLKARLA
E6VWN0_PSEA9      ---------------------------------PGRRFTLYLEDHPLGMELIRAMETQFP
PRMA_DESPS        -------------------------------AGQIVAFIEQAELSTADAEKCATQISVFL
PRMA_LEPIN        ---------------------------DEEIISDDTKFRVYLAEEDKENETKILIFLKAT
I4CAY3_DESTA      ---------------------------------EEQAVITAYFPTENWEAVHADLLRYVV
C0Z9H1_BREBN      -----------------------------AENTEGPLAGYLFEPQHDREEEHVARLKTYI
E1X260_HALMS      ---------------------GGDIPESVIDEVDDVAQCDYLSLVYYFYEGEEVEKSANE
                                                                              

PRMA_PSEPK        LLTGAELPEHQAEVIED----QDWERSWMDNFQPMRFGRRLWIVPSWHDAP--------E
PRMA_PSESM        LLTGAELPEHSAEVIED----QDWERSWMDNFQPMCFGQRLWIVPSWHAAP--------Q
PRMA_MARHV        QQTQQSLADIDVTLVED----KDWERAWMDDFHPLQFGERLWIVPSWHEAP--------D
PRMA_VIBCH        SNMLAEGFAHKVEQVED----KDWEREWMDNFHPMQFGRRLWICPSWREVP--------D
PRMA_VIBVU        SNMLAEGFAYKIEQLED----KDWEREWMDNFHPMKFGQRLWICPSWRDIP--------D
PRMA_SALTY        HPLLGAGFAHKIEQLED----KDWEREWMDNFHPMRFGERLWICPSWRDIP--------D
PRMA_ECOLI        HPLLGAGFAHKIEQLED----KDWEREWMDNFHPMRFGERLWICPSWRDVP--------D
PRMA_HAEIN        AKHLDSNTAYKIGTNRRL---KNWEREWMDNFHPMQFGKRLWICPSWRDVP--------D
PRMA_SHESA        LPFLGEHFSHKIEQIED----KDWVREWMDNYHPIQFGKRLWICPSWREVP--------D
PRMA_SHEON        LPFLGEHFSHKIEQIED----KDWVREWMDNYHPIQFGKRLWICPSWREVP--------D
PRMA_PSYWF        LAAQVNARRVWTTALAD----TDWEREWMSHYVPIECTNNLWIVPKWMTPP--------N
PRMA_XANAC        -DPGLDWSQVAFRMVED----SDWERAWMDLFKPMQFGERTFIVPWNHALPEA----ADT
PRMA_XANCP        -DPSLDTRHATFRSVED----SAWERAWIDQFKPMRFGARTFIVPWNQDLPEE----ANT
PRMA_XYLFA        -EPGLDWGGVRFRVVVD----EDWERVWMDQFQPMRFGERTFIVPWNQAVPVE----ASG
PRMA_XYLFT        -EPGLDWGGVRFRVVVD----EDWERVWMDQFQAMRFGERTFIVPWNQAVPVE----ASG
PRMA_HALHL        -QLGERLRGWQAETLED----RAWEREWLDHFRPMAFGERLWIVPTGAEPELP----AG-
PRMA_BURVG        EIGIADTPKFDVREVEE----QDWVRLTQSQFEPIPIGERIWVVPSWHD--------APD
PRMA_BURL3        EIGVAETPAFTVREVEE----QDWVRLTQSQFEPIPIGERIWVVPSWHD--------APD
PRMA_BORBR        GLDPALAHGWSLREVPD----ADWVRLTQSQFGPIPISERLWIVPSWHRDDPAVPGLVPD
PRMA_NEIMA        ECGL-KDLAYTGEILED----QDWVRLTQAQFDPIRISERLWITPSWHE--------APE
PRMA_CHRVO        ACQL-AMPAYSVERVEE----QDWVRLTQSQFEPIRISDRLWITPTWHE--------APA
PRMA_NITEU        VIGLPALPEYQLAQVME----QDWVRLTQAQFEPIRISSRLWVVPSWHE--------PPD
PRMA_DICNV        --ALGEDYPIAQHLLPE----SDWTRAWLEHFQPIAFGNHFWVAASEHVIEEH-------
PRMA_OPITP        LLPLAAQAEPGYREMAE----SEWRDSYKTHFHPWQFGRLHWVPVWQRETYVLPA-----
D5ELE0_CORAD      EFP-SLPDDFALSTMED----SYWQNAYKEFVKPWSDRQLNWIPLWERENIQISE-----
PRMA_ENTFA        RLPEYGLSIGKNEMTISEVAESDWATAWKKYYHPVRVTRFLTIVPSWEAYHAQ-------
PRMA_LACPL        QLTDFGLNPAPNEVSMTALSDEDWATAWKKYYHPVRVTRYLTIVPSWEQYQPV-------
PRMA_OCEIH        QLLIYDIDLGKNEVSLSEVHEEEWATAWKKYYKPVKISNRITITPTWEEYTPV-------
PRMA_BACSU        NLLLYNIDLGRNHITISEVNEEEWATAWKKYYHPVKISEKFTIVPTWEEYTPV-------
PRMA_BACCR        VLPSYDIEIGTGNITVNEVNEEDWATAWKKYYHPVQISDTFTIVPTWEEYTPS-------
PRMA_STRZJ        ELTDF-MDLGELKIGTTALAEEDWADNWKKYYEPARITHDLTIVPSWT-DYEA-------
PRMA_STRR6        ELTDF-MDLGEVKMGTTALAEEDWADNWKKYYEPARITHDLTIVPSWT-DYEA-------
PRMA_LACLA        NLSDY-FSLTGLSVTTNNLSETNWAEAWKKYFEPARITHDLTIVPSWTEDYVA-------
PRMA_STAAM        NLDEL--DQHNIQFSEQIIAETDWENEWKNYFHPFRASKKFTIVPSWETYAKE-------
PRMA_CALS4        ELKSFGINVGNVKVEVSEVDEEDWADSWKKYYKPLKVGKRIVVRPLWEEYSPK-------
PRMA_LACP7        ELRDF-VEVGSGKLSLSETEDKDWINNWKEFFKPFRVDDTIVIKPTWEKLEER-------
PRMA_LACDA        ELAGYGLKTAPGEISVDYVADQDWNTVWKKYYHVINLSRHLAIVPEWEDYQPA-------
PRMA_LACAC        ELKSYGLNTGEGKITTSYIEDQDWNTAWQKYYHVIDFSRHLAIVPEWEDYQPA-------
PRMA_THEM4        K--NFEENFSYKLVEERETSSDEWIKNLIS--KPFEFIDGVYIDP---DYHEI-------
PRMA_THEAB        KQEKIFLPFNLEFVENRTTTSEDWVKNLIT--KPFEFIEGVYVDP---DHNNV-------
A7HNK9_FERNB      SLKNQLLEIGLSFVGTRESKPEDWLKNIIT--EPFEMIEDVWIDPLEHDLSHL-------
PRMA_THEMA        GEPLPDFLKDWEIVDEKITTPKDWIVEL----EPFEIVEGIFIDP--TEKINR-------
PRMA_CAMC1        SVRKISNDLKISLNLKE---NKDWLGEYKRAVKPILVDK-IYIRPSWEES----------
PRMA_CAMHC        KKFNTKIDLQISKSIKE---NADWIEKYQKSVEPIEVGK-FYVRPSWKES----------
PRMA_CAMJE        TTFNLNHKIISNLSLVEKE-NKDWIQEYKKGIKPILVDN-VYIHTTWQEE----------
PRMA_NITSB        KLFDTEIHLKITKEKKE---NIDWIEKYKKSITPVEVGE-FYIHPSWYEP----------
PRMA_WOLSU        ARVSEEVNFSHSLTWKR---NEDWIERYRQSIQPIECAP-FYVRPSWHPP----------
PRMA_HELHP        QNTQDSVGFCYHIEEKF---NYDWIKAYQDSIEPVQCGR-FYIRPSWEQEV---------
PRMA_HELPY        QNLQSEFDFFYLSRNLA---SKDWLEAYKQAILPVQCTK-FYIHPSWHQKPSH-------
PRMA_HELPJ        QSLQSEFDFFYLSRNLA---SKDWLEAYKQAVLPVRCAK-FYIHPSWHQKPSH-------
PRMA_AQUAE        -----GLTPEKVEEVKE------DWENWKEKFKPIEVED-FVIIPSW-------------
D3SNG3_THEAH      -----DLTPQAVQEVKI------VPQ--ERIFRPFTVGS-FLIHRPD-------------
C0QSF8_PERMH      DLGNGTLILEEDIKEEN------WEEKWKEHFKPIKIPP-FVIIPEWEIYE---------
C1DW65_SULAA      DLGSGRIVLEEDIKEED------WEEKWKENFKPIEIPP-FIVIPEWEIYQ---------
PRMA_CHLTE        ETFGSVPRFTASFMADR-----NWNAEWEAHLQPVEISD-RFLIIQHQKEYDV-------
B3QUV4_CHLT3      SVCGKDVALTEEKVAEK-----NWNEAWEATLKPIEISE-RLVIVQREKPYTP-------
PRMA_PORGI        PLPGLLWQYSSEIQPDI-----NWNEQWEKNFFRPIRIE-DKCLVRAPFHPTD-------
PRMA_BACTN        PLPDTEITYTYVEAEDK-----DWNEEWEKNFFQPIVID-NRCVIHSTFHKDV-------
F9ZBU4_ODOSD      FTRNYRIETSVQEIEDQ-----DWNKVWEENF-TPIVVD-DRILVRAGFHAPV-------
F0RGF5_CELLC      SNENFDISFNFKEIEQQ-----NWNAEWEKNF-EKIVVD-DVCTVRAPFHE-K-------
A6H072_FLAPJ      ENPEFKISYTFEEIEQV-----NWNEEWEKNF-EAIDVN-GNCHVRAPFHP-K-------
Q26FA8_FLABB      SSELVDIAFAKAEIEPT-----NWNAEWERNF-SPITVD-NRCEVRAPFHK-A-------
C6XTZ6_PEDHD      YEGQFQYTYTVAEIAGK-----NWNEEWEKNF-EPLIIA-DQCYVRATFHQSQ-------
F4KWZ6_HALH1      IVEPLGVGFSVQEIPYQ-----NWNVIWESNF-QPITVG-DFCGVRADFHAPM-------
PRMA_SYNY3        QDALL-FQVPKPRFHWQLIDEEDWSISWKEHWQPTPVGDRFIIYPAWIDPPEN-------
PRMA_NOSS1        QDALC-IGLSSPTLTWQLIDEEDWASSWKQYWHPQEIGDRFLINPAWLPSPEN-------
PRMA_THEEB        QDVVA-QGYLSPKLHWQLVNEQDWAHSWQAYWHPIPVGDRLLICPAWEMPPLD-------
PRMA_PROMM        PLAEP-FGLKLANPTWCEVADEDWSLNWKQDWQPDPVGQRLLILPAWLDLPQE-------
PRMA_SYNPX        PLAEP-FGLPLPQGHWDDVADEDWSLSWKQHWQPDPVGEGLLILPAWLEVPPE-------
PRMA_PROMA        ALNKA-FREDVLNTKWEKIIDEDWSSSWKKFWKADPVGSKILILPSWLELPDI-------
PRMA_PROMP        EVLDK-NNYQTNCFEWNLIEQEDWISSWKKYWGPEIVGDNLLILPCWLELPEE-------
PRMA_BRUME        PGL---FDTEELPDI-------DWVTHSLEGLKPVRAGHFFVHGSHDRD----------K
PRMA_RHILO        LALSKPVEREVLPDI-------DWVARSLEGLKPVRAGRFFVHGAHDRR----------K
Q1YM86_AURMS      EAGGGEICREDLPDK-------DWMADVLAALKPVRAGRFLVHGAHDRN----------K
PRMA_AGRFC        AFPGLVIEKEIIPDV-------DWIAKSLEGLKPVRAGRFIVHGAHDRD----------K
J7Q4B7_METSZ      AETARAARFSTVAEQ-------DWVENALAGLAPVRAGRVLVHGAHDRG----------R
D7A7G7_STAND      PEHAAAVTFLTLDKK-------DWVAASLEGLAPVNIGRFVVHGSHDRG----------K
PRMA_BEII9        AEVATAATSTPIEQR-------DWVAAALEGLAPVRAGRFLVHGAHRRD----------A
PRMA_BRADU        NEIADTLAFDTVEAK-------DWVKASLEDLVPVPAGRFVVHGSHDRD----------R
I3TVK6_TISMK      AAEGIALETPVLDQIEDR----DWASDVLKSFVPIHAGQFVVHGSHLDAAE--------V
G8AFP8_AZOBR      EAMGIPEPKLIVEELPLI----DWVSHSYQGFPPIQAGRFFVHGSHHEG----------I
J8VVC4_9SPHN      TKP--KLIAEELPET-------DWLVASQEGLEPIRAGRFHVHTPDHPA----------V
Q2N9W3_ERYLH      EAP--PFEVEKLPEE-------DWVTLSQQGVEPIRAARFYVHTPDFPP----------D
A4EPW0_9RHOB      KE----FAVSELPET-------DWVAHVRRELAPVEAGRFYVYGSHDAE----------T
PRMA_CAUVC        KVS-----RDTLADA-------DWLAMALSGLPPVRAGRFFVYGMHDRG----------R
PRMA_DEIRA        AEQ-------------------DWQAEFKKNLRPVHAGRVTIVAPWQRE----------E
PRMA_DEIGD        ADQ-------------------DWLAEFKRTLRPVRAGRVTIVPPWLRE----------E
PRMA_THET8        GDE-------------------DWLEAWRRDLKPALAPPFVVLAPW--H----------T
H2J703_MARPK      LISKKEISEQ------------EWLKPWVESLKPFEFLENIWILPDPEKSEGV-------
PRMA_DESAL        DLKGSVLTDYSVHFSKQD--DQPWETAWKAHFHPIEIGESLVIKPSWEDYENP-------
PRMA_FUSNN        EKFSEDEDIVYNLDFYEYD-EEDYQNSWKKYLFVEKVSEKFVVKPTWREYEKQ-------
PRMA_MYXXD        ARDEVASSFPEAKLTLDEQPQQDWSNEWKSLIKSVHVGRLWVGPPWDKANAPA-------
PRMA_SORC5        AIAALGEQSPPLAARLEEVVGDAWRDAWKEHFAPFALTPTITVVPPWAERAPE-------
PRMA_SALRD        ADGHPDALSIRPLESKN------WNAVWEDTLSPVRAGPFLVCPTSVAPPSAR-------
E6VWN0_PSEA9      DSEVTWSERESE----------NWAMAWKDFFNPVNCGETFTILPPWLEDGSE-------
PRMA_DESPS        AEMAAVFNVASPSLVWEFLEEEDWSKNWKEHFVPFTIVPGLIIAPTWENYEAQ-------
PRMA_LEPIN        AGESFFLESRWIETK-------EYEEAYKEFYKPFIIGSYRVIPTWEKDTALG------T
I4CAY3_DESTA      SLRELFPGAPEPRLEVSIIEHENWATLWQDNFQLMNIGETLLIAPPWLVPDST-------
C0Z9H1_BREBN      QRWNGQVTIKDVELVAE------ENDSWKEEFREVKIGDWWVAPTWTDPAALE-------
E1X260_HALMS      FKEFVSLNKNTASALIEERPWDDWNQEWRKHYSPIKVDESLYVVPEWEKDKTDVN-----
                                                                              

PRMA_PSEPK        K--DAVNLLLDPGLAFGTGTHPTTALCLEWLDGQQ-------------LEGTQVL--DFG
PRMA_PSESM        P--DAVNLLLDPGLAFGTGTHPTTALCLEWLDGQD-------------LKGCNVL--DFG
PRMA_MARHV        P--DAANLLLDPGLAFGTGTHPTTALCLEWLDGQD-------------VAGKQVT--DYG
PRMA_VIBCH        P--QAVNVMLDPGLAFGTGTHPTTALCLEWLDNLD-------------LSGKTVI--DFG
PRMA_VIBVU        P--TAVNVMLDPGLAFGTGTHPTTALCLEWLESLD-------------LSGKTVI--DFG
PRMA_SALTY        E--NAVNVMLDPGLAFGTGTHPTTSLCLQWLDGLD-------------LNGKTVI--DFG
PRMA_ECOLI        E--NAVNVMLDPGLAFGTGTHPTTSLCLQWLDSLD-------------LTGKTVI--DFG
PRMA_HAEIN        E--NAVNVMLDPGLAFGTGTHPTTALCLEWLDGLD-------------LKDKSVI--DFG
PRMA_SHESA        P--SAVNVILDPGLAFGTGTHPTTALCLEWLDSLD-------------LSNEEVI--DFG
PRMA_SHEON        P--TAVNVILDPGLAFGTGTHPTTALCLEWLDSLD-------------LSNEEVI--DFG
PRMA_PSYWF        P--DAVNIMMDPGLAFGTGYHATTRLCLDWLTDQD-------------LSDKVII--DYG
PRMA_XANAC        P--EAAVVRLDPGLAFGSGTHQTTALCLRWLDSLAGSGE---------LQGRSVL--DFG
PRMA_XANCP        P--DAAVVRLDPGLAFGSGTHQTTALCLRWLDALAGEGQ---------LQGCSVL--DFG
PRMA_XYLFA        M--DAAVVRLDPGLAFGSGTHPTTGLCLRWLDRLGGDGV---------LGGGEVL--DFG
PRMA_XYLFT        M--DAAVVRLDPGLAFGSGTHPTTGLCLRWLDRLGGDGV---------LGGGDVL--DFG
PRMA_HALHL        ----AVPIHLDPGLAFGTGTHETTALCLEWLDGEP-------------IAGRNGL--DYG
PRMA_BURVG        P--DALILELDPGLAFGTGSHPTTRLCMEWLEQTVK-------------PGQSVL--DYG
PRMA_BURL3        P--DALILELDPGLAFGTGSHPTTRLCMEWLEQSVK-------------PGQSVL--DYG
PRMA_BORBR        AARDAIHIELDPGLAFGTGSHPTTHLCLAWLEAELP-------------AGARLL--DYG
PRMA_NEIMA        D--TAVNLRLDPGLAFGTGSHPTTRLCLKWLDTQLK-------------NGESVL--DYG
PRMA_CHRVO        P--NAVNLQLDPGLAFGTGSHPTTRLCLQWLDKQLQ-------------GNESVL--DYG
PRMA_NITEU        P--AAISLRLDPGLAFGTGSHPTTRLCLTWLDQFLQ-------------PGDSVL--DYG
PRMA_DICNV        ---DAKVLRLDPGLAFGTGTHPSTAMCLHYLVNHAA------------LHGKTVY--DYG
PRMA_OPITP        ---GHHALWLDPGLAFGTGNHETTRLCVERLVALADEFG---------TAGLVVD---AG
D5ELE0_CORAD      ---GDVAVYLDAGMAFGTGAHETTRLCARRLLDYLDTHP---------GSTDSIDLFDAG
PRMA_ENTFA        -DEAEKIITLDPGMAFGTGTHPTTRLTLQALETVLR-------------GGETVL--DVG
PRMA_LACPL        -QSGELVLRLDPGQAFGTGTHPTTKLCLQALETVIN-------------GGEHLI--DVG
PRMA_OCEIH        -SSDELIIELDPGMAFGTGTHPTTVLSIQGLEAYVK-------------PGDLVM--DVG
PRMA_BACSU        -HTDELIIEMDPGMAFGTGTHPTTVLCIQALERFVQ-------------KGDKVI--DVG
PRMA_BACCR        -SPDEKIIELDPGMAFGTGTHPTTTMCIRALEKTVQ-------------PGDNII--DVG
PRMA_STRZJ        -TAGEKIIKLDPGMAFGTGTHPTTKMSLFALEQVLR-------------GGETVL--DVG
PRMA_STRR6        -TAGEKIIKLDPGMAFGTGTHPTTKMSLFALEQVLR-------------GGETVL--DVG
PRMA_LACLA        -TGSEKLIRLDPGMAFGTGTHPTTKMSLYALEQVLR-------------GGETLL--DVG
PRMA_STAAM        -ADEELCIELDPGMAFGTGDHPTTSMCLKAIETYVL-------------PQHSVI--DVG
PRMA_CALS4        --EGEIVIDLDPGMAFGTGTHETTKMCLQFLEDIVK-------------PGAIVF--DVG
PRMA_LACP7        -KETDLVIEIDPGTAFGTGAHETTKLCILNIKKYMQ-------------PGATLL--DVG
PRMA_LACDA        -FKDQEIIRLDPGLAFGTGNHQTTQLAMLGIERAMV-------------KPLTVA--DVG
PRMA_LACAC        -FSDQQLIKLDPGLAFGTGNHKTTQLAMMGIERAMV-------------KPMSVV--DVG
PRMA_THEM4        --NDKLVIRITPGLAFGTGLHTTTKLAATLLKKYLR-------------QGMDVL--DLG
PRMA_THEAB        --DGEIVIRITPGLAFGTGLHDTTKLSAKFLKKYLR-------------PGMDVL--DLG
A7HNK9_FERNB      --KDKIVLRIPQGLAFGTGLHQTTKMSAMYLKRYLK-------------PGMDVL--DLG
PRMA_THEMA        --RDAIVIKLSPGVAFGTGLHPTTRMSVFFLKKYLK-------------EGNTVL--DVG
PRMA_CAMC1        -LSGVTNIIIDPALAFGSGHHESTNSCLQLLQKYA-------------KSGDTAL--DVG
PRMA_CAMHC        -KKELIDIIIDPAIAFGSGHHESTNMCLKLIDKYA-------------KDGATAL--DVG
PRMA_CAMJE        -KKNCINIKINPALAFGSGHHESTYSCVKFLQKFS-------------KSKLRAL--DLG
PRMA_NITSB        -KEGKTNIKIDPALAFGSGHHETTRGCLNAIQKYV-------------QPGMELL--DVG
PRMA_WOLSU        -KPDLIDLLIDPALAFGSGHHGTTNGCLACLGALE-------------LEGKRVL--DVG
PRMA_HELHP        -KESYDEIIINPAFAFGSGHHASTAMCLEFLSEMN-------------IQGKTLL--DVG
PRMA_HELPY        -VVTNDCIMIDPALAFGSGHHESTSMCLELLSDID-------------LKRKNAL--DVG
PRMA_HELPJ        -AAIDDCIMIDPALAFGSGHHESTSMCLELLSSLD-------------LKRKNAL--DVG
PRMA_AQUAE        ----KKPVIVKPGLAFGTGLHPTTQLCIKALKKYL-------------KEGMTVL--DVG
D3SNG3_THEAH      ----LIPISVNPGMAFGTGLHPTTKVCLRLIEKYF-------------LPGWTAL--DVG
C0QSF8_PERMH      -G-DLIPIKLKIGKAFGTGLHPSTQIVLSLIPEYI-------------EKEDSVL--DIG
C1DW65_SULAA      -GNDLIPIKLKIAMAFGTGLHPSTQIILSLIPKYI-------------SQGDKVI--DIG
PRMA_CHLTE        -KPGQIVIAINPKMSFGTGYHATTRLMLRQMEELD-------------LADKKIM--DIG
B3QUV4_CHLT3      -KPGQIVIEINPKMSFGTGFHETTRLMLRMIEAVL-------------QPDDVVL--DIG
PRMA_PORGI        -PDIPLELIISPQMAFGTGHHETTSLMMSYLLDMD-------------LRGLRVL--DMG
PRMA_BACTN        -PQATYDIVINPQMAFGTGHHETTSLIIGELLDNE-------------LKDKSLL--DMG
F9ZBU4_ODOSD      -PGIEYEILIEPKMSFGTGHHSTTALMLRTILDNKER-----------ITGKRVL--DMG
F0RGF5_CELLC      -PNTKFDIVIEPKMSFGTGHHETTHMMLQHILEHD-------------FTGKSVL--DMG
A6H072_FLAPJ      -TDAEFDIVIEPKMSFGTGHHETTHMMIQHLLEIE-------------VTGMKTL--DMG
Q26FA8_FLABB      -TGVEFDIVIEPKMSFGTGHHQTTHMMIQHLLNED-------------LTGLKVL--DMG
C6XTZ6_PEDHD      -PQYKYEIVIDPKMAFGTGHHQTTTMMIQYLLDAD-------------VEDKTVL--DMG
F4KWZ6_HALH1      -EGVQHEIIINPKMAFGTGHHETTHMVMQLMADLD-------------FRGKRVF--DFG
PRMA_SYNY3        -S-DRLILRLDPGVAFGTGTHATTQLCLESLEMRVEP-----------DKHQVLA--DLG
PRMA_NOSS1        -S-DRLIIRLDPGVAFGTGNHATTQLCLESLEMRLSEVPKSFISKGGNQEPVIIA--DIG
PRMA_THEEB        -N-TRLVIKLDPGMAFGTGTHETTQLCLEALEMQLDQTFEP-------LPPTVIA--DIG
PRMA_PROMM        -YADRFVVRLDPGSAFGTGSHPSTRLCLEALERNPPL-------------GLRVA--DLG
PRMA_SYNPX        -HGERLVIRMDPGSAFGTGSHPTTRLCLEALEKAPPV-------------GALVA--DLG
PRMA_PROMA        -YSNRIVIKLDPGSAFGTGSHPTTRLCLEDLERNPPL-------------GKKVV--DIG
PRMA_PROMP        -YKNKKVIKIDPGAAFGTGSHPTTSLCLEELEKISLS-------------SKKIL--DIG
PRMA_BRUME        IEPGDIAIEIDAGLAFGTGHHGTTAGCLELIEETVETEHP-------------TNALDLG
PRMA_RHILO        RHSGELAIEIEAGLAFGTGHHGTTSGCLEMLEKVVRREHP-------------RNALDLG
Q1YM86_AURMS      VKTNDLAIEIEAGQAFGTGHHGTTAGCLETIARLATRRKP-------------RNALDLG
PRMA_AGRFC        VQPHDLAIEIEAGQAFGTGHHGTTAGCLEMIEDVLRARKV-------------RNALDLG
J7Q4B7_METSZ      RRANDIGVEIEAALAFGTGHHGTTLGCLKALERIAKRRRP-------------RRILDVG
D7A7G7_STAND      LAPSRIGIEIEAALAFGTGHHGTTKGCLEAIAAYGNRRRP-------------ARTLDVG
PRMA_BEII9        VRVNDLAIEIEAALAFGTGHHGSTRGCLLMFDRVTKARHP-------------KQILDLG
PRMA_BRADU        VAPNKLKIEIEAALAFGTGHHGTTRGCLLLLDHVLKSSRP-------------SNVLDLG
I3TVK6_TISMK      VRPGAIGIVVDAGQAFGSGEHGTTRGCLTMIDHLARRGKP------------VGRVLDMG
G8AFP8_AZOBR      VPAGSIPLLVDAATAFGTGEHGSTKGCLMALDRLARRMNLP--------RRGRGGALDMG
J8VVC4_9SPHN      DEPGVFDFAIPASQAFGTGHHATTAGCLAMLTHMKAQGLV------------VRNCADIG
Q2N9W3_ERYLH      DTPGTVNFAIPASQAFGTGQHETTAGCLAMLDLMKRQGVS------------ARNIADIG
A4EPW0_9RHOB      VPEGRIPLLIEAAMAFGTGHHGTTLGCLKALDHLIDEGFE------------GRKVADIG
PRMA_CAUVC        LPASTVNLRIEAGAAFGTGHHGTTVGCLQAYDRLIKARRF-------------NKVLDVG
PRMA_DEIRA        VPAGQLALVIEPGMAFGTGHHATTRMAVEALGELDLS---------------GKRVLDVG
PRMA_DEIGD        VEAGQLPLVIEPGMAFGTGHHATTRLAVEALSALNLATLGP--------RGTGARVLDVG
PRMA_THET8        WEGAEIPLVIEPGMAFGTGHHETTRLALKALARHLRP---------------GDKVLDLG
H2J703_MARPK      -PKNAKIIKIIPGTAFGTGLHPTTKLAAKNLLKVIG-------------EGAEVL--DVG
PRMA_DESAL        --EKRMLIELDPGMAFGTGTHPTTAVCLEMIETECL-------------KKAPERFLDVG
PRMA_FUSNN        --DNELVIELDPGRAFGTGSHPTTSLLLKLMEEQDFS-------------NKSVI--DIG
PRMA_MYXXD        ---GTVQLVIEPKMAFGTGDHPTTSLCLAAVDAYMA-------------EHPGAAVLDVG
PRMA_SORC5        -REGERVLLLEPGRAFGTGLHATTALVAELLDEHAAELR-----------GREIL--DVG
PRMA_SALRD        --DDATVLRIDPEMSFGTGHHATTRLALRLLAEALAP-------------GDRVL--DVG
E6VWN0_PSEA9      --NGTTHIVIEPKMAFGTGHHSTTSLCLATIGTMAKDGVIE--------PGQSFL--DLG
PRMA_DESPS        --GDELVIEMDPGMAFGTGHHATTSLSLSYLQDVVT-------------QRGAKTVLDVG
PRMA_LEPIN        TPEGIFPLLVNPGLAFGTGHHETTRLVLGRMGDLNL---------------SAKRIADVG
I4CAY3_DESTA      ---ERHLIIIEPAEAFGTGTHETTRGCLELLEEAVTQLRK---------THESFTMLDMG
C0Z9H1_BREBN      --SARHILWIDPGAAFGTGYHGTTQDILLFLQEMDLE-------------GKQVI--DVG
E1X260_HALMS      ---EENSLFIYPGMGFGTGEHQTTYLCLKLFMNILDD------------LKEVDSCLDFG
                         . :    .**:* * :*                                   *

PRMA_PSEPK        CGSGILAIAALLLGAR-----EAVGTDIDVQAIEASRDNAQRNGIADE--KLALYLPEHM
PRMA_PSESM        CGSGILAIAALLLGAE-----QAVGTDIDVQALEASRDNAGRNNIAAE--RFPLYLPEDL
PRMA_MARHV        CGSGILGLAALLLGAD-----HVVGVDTDPQALEASRDNARRNGVEDS--RLDLYLPGQD
PRMA_VIBCH        CGSGILAIAAIKLGAA-----KVIGIDIDPQALLASKDNAARNGVED---QIEVYLPKDQ
PRMA_VIBVU        CGSGILAIAAIKLGAE-----KVIGIDIDPQALLASKDNAQRNGVAD---QLDVYLPQDQ
PRMA_SALTY        CGSGILAIAALKLGAA-----KAIGIDIDPQAIQASRDNAERNGVSD---RLELYLPKDQ
PRMA_ECOLI        CGSGILAIAALKLGAA-----KAIGIDIDPQAIQASRDNAERNGVSD---RLELYLPKDQ
PRMA_HAEIN        CGSGILAIAALKLGAK-----SAVGIDIDPQAILASRNNAEQNGVTD---RLQLFLSDEK
PRMA_SHESA        CGSGILAVAALKLGAK-----KVTGIDIDYQAIEASKANAERNDVAD---QLALYLPEDQ
PRMA_SHEON        CGSGILAVAALKLGAK-----KVTGIDIDYQAIDASKANAERNDVAD---QLELYLPEDQ
PRMA_PSYWF        CGSGILGIAALLLGAK-----QVYSVDIDPQAVLATKQNAERNDVTH---ALEVYLPEDF
PRMA_XANAC        CGSGILAVAALKLGAT-----HAVGVDNDPQALLATADNAQRNGVDA---QLAVYMPQDE
PRMA_XANCP        CGSGILALAALKLGAA-----NAVGVDYDPQALLATAENAERNAMEA---QMQVYLPQDE
PRMA_XYLFA        CGSGILALAALKLGAV-----YAVGVDNDPQALLASRENALRNGVAE---RLEVYLPAEA
PRMA_XYLFT        CGSGILALAALKLGAV-----YAVGVDNDPQALLASRENALRNRVAE---RLEVYLPAEA
PRMA_HALHL        AGSGILAVAAVRLGAA-----CCMAVDNDPQAVVASRENAERNGVAE---DVPSYAVDQR
PRMA_BURVG        CGSGILAILARKCGAD-----PVIGIDIDPQAVESARQNSERNHADVT-YGLPDACPD--
PRMA_BURL3        CGSGILAILAKKCGAN-----PVIGIDIDPQAVESARQNSERNHADVT-YGLPDACPD--
PRMA_BORBR        CGSGILAIAARKLGAG-----ETVAVDIDPQAVQSTVDNAEVNQVRLQ-AMLPDALPA--
PRMA_NEIMA        CGSGILTIAALKLGAG-----FAVGVDIDEQAVRAGKDNAEQNNVDAQ-FFLPDGLPQ--
PRMA_CHRVO        CGSGILAIAALKLGAA-----SAVGIDIDQQAVRASQDNAEQNGVKAD-FFLPNANPA--
PRMA_NITEU        CGSGILAIAALKFGAD-----RVTGMDIDPNAITASLDNARNNFCDPDRLLFTTVLPPLV
PRMA_DICNV        CGSGILGIAAAMMGAK-----AVYQTDIDPQALTASYENAQKNQVAEK-----IFLCEQP
PRMA_OPITP        CGSGILALSAAKLGFR-----DVVGFDNDLEAVRVSEENAVLN-ELNGQVRFFVGDLVSG
D5ELE0_CORAD      CGSGILALSAAVLGFK-----NLYAFDFDPEAIRVCHENVDYNPQIPAVVDFAVADLEAG
PRMA_ENTFA        TGSGVLSIASRYLGAK-----DVYAYDLDEVAVAAAKENMDLNPIAADVHVSAN------
PRMA_LACPL        TGSGVLSIAAKAMGVG-----AVEAYDLDDVAVASAQTNLDLNPVAKDVHVAAN------
PRMA_OCEIH        CGSGVLSIAAAKLGAD-----KVNAYDLDEIAVKSTKLNSKLNQIHESVKVKQN------
PRMA_BACSU        TGSGILSIAAAMLEAE-----SVHAYDLDPVAVESARLNLKLNKVSDIAQVKQN------
PRMA_BACCR        TGSGVLSIAAAKLGAS-----SVQAYDLDPVAVESAEMNVRLNKTDDIVSVGQN------
PRMA_STRZJ        TGSGVLSIASSLLGAK-----EIFAYDLDDVAVRVAQENIELNPGMENIHVAAG------
PRMA_STRR6        TGSGVLSIASSLLGAK-----EIFAYDLDDVAVRVAQENIELNPGMENIHVAAG------
PRMA_LACLA        TGSGVLSVAASYLGAA-----EIFAYDIDEVAVRVALENIELNPGHEKIHVSAN------
PRMA_STAAM        TGSGILSIASHLIGVK-----RIKALDIDEMAVSVAKENFRRNHCETLIEAVPG------
PRMA_CALS4        CGSGILSIAASKLGAS-----YVYGADVDEMAVKIARENVKLNGL-ENVEIFQS------
PRMA_LACP7        CGSGILTIIGRKLGAK-----TAVAIDIDENAVSASKENCDVNQLEAVLCQSSDSSTRTE
PRMA_LACDA        TGSGILAIAAHKLGAK-----SVLATDISDESMTAAEENAALNGIHDIALQKTS------
PRMA_LACAC        TGSGILAIAASKLGAT-----NVLATDISDESMTAAKQNSALNNLTNIKVQKTS------
PRMA_THEM4        CGSGILSILAKKLGAS-----GVLAVDNDKMAVESAIENVEKNNVEVEIRVSD-------
PRMA_THEAB        CGSAILSILAKKLGAD-----RVLGVDNDPLAVEAAKENVERNNVDVEIRQSD-------
A7HNK9_FERNB      CGSGILGILAKKLGAN-----RVLAVDNDPLAVEVAMENAERNKVDIEVRLSD-------
PRMA_THEMA        CGTGILAIAAKKLGAS-----RVVAVDVDEQAVEVAEENVRKNDVDVLVKWSD-------
PRMA_CAMC1        CGSGILSIALAKLGCK------VDACDTDEQATQSSLSNAQLNE---VKFNKIW------
PRMA_CAMHC        CGSGILSIALKKIGLK------VAACDTDIQAVDASIKNAQKNG---VKIDKIW------
PRMA_CAMJE        CGSGILGIIMAKFGCN------VEICDTDELAIDSSLENARLNG---VDFHKAW------
PRMA_NITSB        CGSGILSIAAAKKGAV------VDICDTDALALEESQKNFSLNG---VEFREGW------
PRMA_WOLSU        CGSGILAIASAKKGAI------VEMCDTDELAVGEALKNASLNQ---VIASKVW------
PRMA_HELHP        CGSGILSIASCKLGAQ------VYACDTDENAIKECNKNILLNG---VMLNALW------
PRMA_HELPY        CGSGILSIALKKQGVSA-----LVACDTDSLAVEETLKNFSLNQIPLLVQDKVI------
PRMA_HELPJ        CGSGILSIALKKQGVSA-----LTACDTDSLAVEETLKNFSLNQIPLLAQDKVI------
PRMA_AQUAE        TGSGILAIVSALLGAKR-----VVGIDIDEKAVNECRENAELNK----VKVECF------
D3SNG3_THEAH      CGSGILSIALAKLGARE-----VLAIDIDERAVEETKENAKRNG----VSLQVK------
C0QSF8_PERMH      TGSGILSIASKKIGAGL-----VKGIDIQPEAVEECKTNSWENE----VEVLCE------
C1DW65_SULAA      CGTGILSIASAKLGAN------VDAIDIEKQAVEECKVNSWENQ----VKVNCY------
PRMA_CHLTE        TGTGVLAIAARKLGNRN----PILAFDNNAWAAENAVENVAEND---VADIRVE------
B3QUV4_CHLT3      TGTGVLAIACRKYGNQH----PILAFDNYSWAVENAIENSQVNA---SEDISFE------
PRMA_PORGI        CGTGILAILARKLGAS-----SVTAIDIDDWCIRNTGENAALND---IRDIDVR------
PRMA_BACTN        CGTSILAILARMRGAR-----PCIAIDIDEWCVRNSIENIELNH---VDDIAVS------
F9ZBU4_ODOSD      CGTGILSILAAKTGAR-----EITGIDIDEWAYNNAMENIRANG---LNNITIK------
F0RGF5_CELLC      SGTGVLAILAAMKNAG-----SVDAIDIDNWCYLNALENKERNN---CSQINVF------
A6H072_FLAPJ      CGTAILAILAEMKGAQ-----PIDAIDIDNWCYLNSIENAERNN---CKHITVY------
Q26FA8_FLABB      SGTGVLGILAQMRGAL-----DVDAIDIDTWCYENAIENVERNK---ADKVNVI------
C6XTZ6_PEDHD      CGTAILAILAAKKGAA-----RLVAIDNDEVCYQSTIENAALNN---IRNIEAL------
F4KWZ6_HALH1      CGTGILAILAAKLGAV-----AIDAVDIEPPSFENTLENAKING---VSDVLHA------
PRMA_SYNY3        CGSGILGIGAVLLGAA-----KVYGVDNDPLTVESARHNRHLNQIHPDNLVINE------
PRMA_NOSS1        CGSGILSIGAVLLGAQ-----KVYAVDTDPLAVQSTFSNRALNEVNPERLVPAE------
PRMA_THEEB        CGSGILAIASLLLGAQ-----KAYAVDTSDLAVTATQRNAELNGIRADQLIVHQ------
PRMA_PROMM        CGSGVLGFAALAFGAR-----QVLAADTDCQAVCASRANTELNQLDLDRLRVVH------
PRMA_SYNPX        CGSGVLGLAALGLGAT-----AVVAADTDSLAVRATGDNRELNGRPADLLKVSL------
PRMA_PROMA        CGSGVLGIAAIKLGAK-----EVRAIDIDSLAVRATSENIVLNNLSQKQLSVSL------
PRMA_PROMP        SGSGILSIAARSFGAS-----KIYSIDNDYLAINSTESNFRLNFGNLDNLKTYL------
PRMA_BRUME        TGSAVLAIAIARLA-----PIPILATDIDPIAVTVAAENAAKNGVA-----EHIVTATAE
PRMA_RHILO        TGSAVLAIAVAKLA-----HIPVLATDIDPVAVKVAAANARLNHVK-----ALIETVTAP
Q1YM86_AURMS      TGSAVLAIGLAKLA-----RVPVLATDIDPVAVRVARANVEANGVA-----NFVDCATAI
PRMA_AGRFC        TGSGVLAIAVRKMR-----PIPVLATDIDPIAVKVAKENVRLNGIV-----SGMALETAP
J7Q4B7_METSZ      TGTGVLAIAAARLF-----HQRVACGDIDPVAVATASANARANGAG-----ADVRPVVAT
D7A7G7_STAND      TGTGVLAMAAARLF-----HAPVVASDIDRVAVATARANARANRAA-----QHIHFLHAP
PRMA_BEII9        TGSGILAMAAARLL-----HRKVEACDIDKDSVLAARGNARHNGVA-----RLVRPVVAS
PRMA_BRADU        TGTGVLAIAAAKAL-----HRAVLASDIDPPSVRVAAENGRLNEVG-----HHVRVIRAT
I3TVK6_TISMK      CGTGVLAIAAAQRFNPRRLRRRVLAVDNDPRSVAVTAENIHINHVR-----DRVIPLISE
G8AFP8_AZOBR      CGSGILALAVTKRW-----RVPVTAVDIDPEAVRVTRVNAALNGVK-----ARIRSQGGD
J8VVC4_9SPHN      TGTGLLAFAALSLWP----RALATASDIDAVCVNVVEDNARANGVTMGARRGELVMTVAD
Q2N9W3_ERYLH      TGTGLLAFGALRLWP----HATMTATDIDANCVPVIEANAATNGIAQGSGPGEMTMIVAA
A4EPW0_9RHOB      CGTAVLAMAAARVWE----GDFI-ASDIDEVAVEVAEANLKANGME-----GAVTCLEAA
PRMA_CAUVC        AGTGLLAIAAARTG-----AKLAVGTDIDKPSVRISKENALVNKAN-------ARFVHAS
PRMA_DEIRA        TGSGVLAMAAAKLGA-----AQTLGVDIDPITIPIARDNARDNGL--TSGIRFEEGTLGL
PRMA_DEIGD        TGSGVLAIAAALLGA-----GFALGVDIDPITIPIARENAQINGIP-ASRVRFAEGTLGA
PRMA_THET8        TGSGVLAIAAEKLG------GKALGVDIDPMVLPQAEANAKRNGV----RPRFLEGSLEA
H2J703_MARPK      TGTGILSIIAYLFNAK-----NIVAIDYDILAVEKAIETFNLNGIENITVKQSDLLSNID
PRMA_DESAL        TGSGILMIGAYKLGAR-----KVFGCDNDMDALEAAAKNLKGNQVHEGDFGLWLGDLLAG
PRMA_FUSNN        TGSGILMIAGKILGAG-----EVYGTDIDEFSMEVAKENLILNNISLNDVKLLKGNLLEV
PRMA_MYXXD        TGTGVLAIAAKKLGAG-----RTVATDNDPISVELAQENQAENGTPDIEVSGKE------
PRMA_SORC5        TGSGILALVALLLGAE-----RAVAIDNDEDVIEVVLENAARNGLEGRIEASAGVVEA--
PRMA_SALRD        TGTGVLAIAACRIGAD-----AARGVDTNPDAVRNARENVRRNEETDCVTVQEGS-----
E6VWN0_PSEA9      TGSGILGIGLCKLGLT------GIGLDIDPQAIECARENAEANAVAQSMRCAVGSIDFLE
PRMA_DESPS        CGTGILVMGAVLFGAE-----RGLGIDNCPDAVAAASNNVVHNHLAEKIDIGITPLSE--
PRMA_LEPIN        TGSGILSLAAAKSGAS-----LILAIDVDPNSVRSASFNRDENEISSEVLVVEEGGFDHK
I4CAY3_DESTA      CGSGILAIAGVKLGAS-----DVRAVDNDPVAVESARKNLELNNVGDSVKLACASLRE--
C0Z9H1_BREBN      AGSGILSLYCALNGAKH----PVWAVDINPQSEYQVLVNATNNHLPDHAVQVIIGDASED
E1X260_HALMS      CGSGILGIAAIKKRNM-----PVVFCDIDKDALNNCLQNLELNFNGKDLSGSSLVSRDK-
                   *:.:* .                  *           .   *                 

PRMA_PSEPK        P-------------------------------------AMQADVLVANILAGPLVSLAPQ
PRMA_PSESM        P-------------------------------------PQQADVLVANILAGPLVSLAPQ
PRMA_MARHV        P-------------------------------------DTRADIMLANILAQPLIGLAPR
PRMA_VIBCH        PE------------------------------------GLVADVVVANILAGPLRELSPI
PRMA_VIBVU        PE------------------------------------GLLADVVVANILAAPLRELSSI
PRMA_SALTY        PE------------------------------------AMKADVVVANILAGPLRELAPL
PRMA_ECOLI        PE------------------------------------EMKADVVVANILAGPLRELAPL
PRMA_HAEIN        PS------------------------------------DLKADVVVANILAGPLKELYPI
PRMA_SHESA        PA------------------------------------DLKADVLVANILAGPLRELAPL
PRMA_SHEON        PA------------------------------------DLKADVLVANILAGPLRELAPL
PRMA_PSYWF        AKA------------------------------FAAGDIPKADIITANILAKPLMELAPY
PRMA_XANAC        P-------------------------------------VQTYQVVVANILASALDALADT
PRMA_XANCP        P-------------------------------------VQTYPVVLANILATALDALAET
PRMA_XYLFA        P-------------------------------------VRRYPVVVANILASTLVALAER
PRMA_XYLFT        P-------------------------------------VRRYPVVVANILASTLVALAER
PRMA_HALHL        P-------------------------------------AYCADFLVANILASTLVDLADE
PRMA_BURVG        ---------------------------------------GEFDIVVANILSNPLKLMASM
PRMA_BURL3        ---------------------------------------GEFDIVVANILSNPLKLMASM
PRMA_BORBR        ---------------------------------------GEFQVVVANILSNPLKVLAPM
PRMA_NEIMA        ---------------------------------------GQFDVVVANILANPLRMLGEM
PRMA_CHRVO        ---------------------------------------AQYDVVLANILANPLRMLGDL
PRMA_NITEU        EDD------------------------------RASAEWAPVTIVVANILANPLIMLAPV
PRMA_DICNV        D------------------------------------LAPAVDLLVANILLEPLCALRAQ
PRMA_OPITP        LK------------------------------------DVQAQVLMANILADVLIRYASH
D5ELE0_CORAD      LK------------------------------------GRQADFMMANIQTDVLIPFSDP
PRMA_ENTFA        ---DLLKGIDHS-----------------------------ADVIVANILADIIVLMIED
PRMA_LACPL        ---DLLAGIDTQ-----------------------------ADIIVANILAEIIIPLVPQ
PRMA_OCEIH        ---NLLEGVQQE-----------------------------ADVIVSNILAEIIVRFVDD
PRMA_BACSU        ---NLLDGIEGE-----------------------------HDVIVANILAEVILRFTSQ
PRMA_BACCR        ---SLLEGIEGP-----------------------------VDLIVANLLAEIILLFPED
PRMA_STRZJ        ---DLLKGVEIE-----------------------------ADVIVANILADILIHLIDD
PRMA_STRR6        ---DLLKGVEIE-----------------------------ADVIVANILADILIHLTDD
PRMA_LACLA        ---NLLEGIDKK-----------------------------ADVIVANILADILVLMTED
PRMA_STAAM        ---NLLKDETEK-----------------------------FDIVIANILAHIIDEMIED
PRMA_CALS4        ---DLLKNFRGK-----------------------------ADVIVANIIADAIIRLIPD
PRMA_LACP7        GRIELFDGNVIEDRGLRERI-----------------GLNSYDFVVANILADIIIPLSAV
PRMA_LACDA        ----LLADVDGK-----------------------------FDLIVANILAEILLDLIPQ
PRMA_LACAC        ----LLAGVEGK-----------------------------FDIIVANILAEILLDLIPQ
PRMA_THEM4        ----LLKNVDGK-----------------------------YDLIVSNIIADVLVKALED
PRMA_THEAB        ----LFSNVDGK-----------------------------FDLIVSNIIAEILIEALKD
A7HNK9_FERNB      ----LFSNVDGK-----------------------------FDIIVSNIIAEILVEMLKN
PRMA_THEMA        ----LLSEVEGT-----------------------------FDIVVSNILAEIHVKLLED
PRMA_CAMC1        -----TGSIAN--------------------------LEQKYDIVVANIIADVIFMLSND
PRMA_CAMHC        -----NGSIADANLAIRNMDGEILSENLNENKNFNQSFNKEFDFVIANIITDVILILQNE
PRMA_CAMJE        -----CGSIDK--------------------------ANGLYNLIVANIIADVILILEKD
PRMA_NITSB        -----VGSAAN--------------------------AKKKYDIVIANIVADVLIMIAKD
PRMA_WOLSU        -----IGSVGD--------------------------AEGEYDLIIANILAAILIMLSPW
PRMA_HELHP        -----QGSIADSPMG----------------------APQKYDVIVANIVAFIVKVLHND
PRMA_HELPY        -----YGSTQK--------------------------IEGRFDVIVANLVADVIKSLYSE
PRMA_HELPJ        -----YGSTQK--------------------------IEGRFDIIVANLVADVIKSLYSE
PRMA_AQUAE        -----RAEPKD--------------------------VNESFDLVVANLEIHIFERVLKD
D3SNG3_THEAH      -----QATPAD--------------------------LEESYQFLVANLELPIFEKEATH
C0QSF8_PERMH      -----RKSFED--------------------------INERYDIVLANLQIDIFREAFKK
C1DW65_SULAA      -----QASIED--------------------------IKDSYNIVLSNLQMEIFDKYFDR
PRMA_CHLTE        -----LLDAEEELA--------------------ATLE-EGYDLILANINKNVLDRILPT
B3QUV4_CHLT3      -----LLDAEETLE--------------------EALAREKFTLILANVNRGVIGKIFPK
PRMA_PORGI        -----IGDAS------------------------LLADCPMFDLIIANINRNILLDDMSA
PRMA_BACTN        -----QGDAS------------------------SLVGKGPFDIIIANINRNILLNDMKQ
F9ZBU4_ODOSD      -----IGDAR------------------------LLEAEAPFDVILANINRNILLEDMPH
F0RGF5_CELLC      -----EGDVS------------------------LLKDQ-KYNIIIANINRNILLADIPA
A6H072_FLAPJ      -----EGDAA------------------------LLKDK-KYDLIIANINRNILLNDMQA
Q26FA8_FLABB      -----LGGSE------------------------QLEGK-MYDFIIANINRNILLQDIPV
C6XTZ6_PEDHD      -----CGSKE------------------------AIPEI-AFDVILANINRNILLDQIPS
F4KWZ6_HALH1      -----LLGDL------------------------SVVEGSGYDIILANINRGVILDAFPT
PRMA_SYNY3        ------GSVPELEQLIA----------------------EPVDGIICNILAEVIVDLLPQ
PRMA_NOSS1        ------GSVDILKKLIE----------------------RPVDGIVCNILADVIIQLVPE
PRMA_THEEB        ------GSWEQVLEL--------------------------VDGVVCNILAPVIIEILPH
PRMA_PROMM        ------GSVEALSAQLEG---------------------QTVDLLLCNILAPVIEVLAPS
PRMA_SYNPX        ------GSVEALQHLLEG---------------------RRADLLLCNILAPVIEALAPG
PRMA_PROMA        ------GSIENLANQLNP---------------------LSADLLICNTLSPVIKELAPY
PRMA_PROMP        ------GSFDGLVSKYTL---------------------KNFDFILCNILAEVIKGIIPD
PRMA_BRUME        G-----------------------------FGHPIFRSYSPFDLIVANILANPLIELAPS
PRMA_RHILO        G-----------------------------FHHPIFGRRAPFDLIVANILARPLMRLAPQ
Q1YM86_AURMS      G-----------------------------FGAEAIRERAPYDLIVANILAGPLMKLAPE
PRMA_AGRFC        G-----------------------------FHSDAFRKHGPFDLIIANILARPLIKMAPQ
J7Q4B7_METSZ      G-----------------------------LRHPSL--QGRYDLIFANILAKPLRLLAPQ
D7A7G7_STAND      G-----------------------------LGAGIFHRQGPYDLILANILLPPLKAIAKP
PRMA_BEII9        G-----------------------------TSHPAIHAGAPYDLVFANILARPLRGLAPS
PRMA_BRADU        G-----------------------------FAAPDFARAGPFDLVLANILANPLRHLASP
I3TVK6_TISMK      G-----------------------------FRRPEVMAHGPYDLILANILARPLARMAPV
G8AFP8_AZOBR      G-----------------------------YHTAIVGKHKPYRLITANILARPLARMAPK
J8VVC4_9SPHN      G-----------------------------MAHPVLEARGPYDLILANILAGPLVHLAPD
Q2N9W3_ERYLH      G-----------------------------TDHSLIAARGPYDLLIANILAGPLVDLAGD
A4EPW0_9RHOB      G-----------------------------FDHPGLQSCAPYDLIFANILKGPLVALSPD
PRMA_CAUVC        G-----------------------------LSNRLVAENAPYDLVFANILARPLISLAQD
PRMA_DEIRA        D-----------------------------EDA--EMFGEPYDVLVANLYAELHDLLAGE
PRMA_DEIGD        D-----------------------------PLTFPDEGVDTYDVVVANLYAELHDLLAGE
PRMA_THET8        A-----------------------------LPF------GPFDLLVANLYAELHAALAPR
H2J703_MARPK      N-------------------------------------SEKFDIIIANIVVPILLRLLDD
PRMA_DESAL        IV------------------------------------EGAFDMVAANITAEANVMLIPG
PRMA_FUSNN        IE------------------------------------NKKFDIVVCNILADILVKLLDE
PRMA_MYXXD        ----------------------------------LTQVEGTFDLVLANILANTLIELAPL
PRMA_SORC5        -------------------------------------VTRRFPWVVANIEARVLRPLAPE
PRMA_SALRD        ---------------------------------VDVASDTQYDLVAANITRRVLLELMPA
E6VWN0_PSEA9      P-------------------------------------EAVFNIVVANILSGPLIEMARD
PRMA_DESPS        -------------------------------------LREEYDLVVANIIHDVLASMVLE
PRMA_LEPIN        KI-----------------------------------QEQTWDLLIANITFAVLKANIQK
I4CAY3_DESTA      -------------------------------------TRESADIVTANLDPMTLMANKDL
C0Z9H1_BREBN      G--------------------------------VKSQLPDQADVILVNIGGDENVAMLPM
E1X260_HALMS      -----------------------------------FSASIEHKLVFANILENVLLLEKSL
                                                              :  *            

PRMA_PSEPK        --LSGLVRPGGLLALSGILAEQGEDVAAAYAADFELD------------PIVVRDG----
PRMA_PSESM        --LTTLIKTGGRLALSGILAEQGEDVAAAYAESFDLD------------PIANRDG----
PRMA_MARHV        --LAELTRPGGHLVLSGILFNQAREVMDAYEPWFVMD------------EPEQKED----
PRMA_VIBCH        --IKGLLKPGGQLAMSGILDTQAESVAEFYRDDLELD------------PIAEKSE----
PRMA_VIBVU        --IKGLVKPNGQLAMSGVLDTQAEDVANYYRDELHID------------PIVEQSE----
PRMA_SALTY        --ISVLPVEGGLLGLSGILASQAESVCDAYAELFTLD------------PVVEKEE----
PRMA_ECOLI        --ISVLPVSGGLLGLSGILASQAESVCEAYADSFALD------------PVVEKEE----
PRMA_HAEIN        --ISQLVKPNGDLGLSGILETQAQSVCDTYTQTFALE------------PVAAREE----
PRMA_SHESA        --IAERVKSGGKLALSGLLKEQAQEISDFYSQWFDMD------------EAAHKED----
PRMA_SHEON        --IAERVKTGGKLALSGLLKEQAQEISDFYSQWFDMD------------EAAHKED----
PRMA_PSYWF        --LATLIKPKGGIVLAGLISEQLEDMVRAYEPWFNLD------------TRHSYEKSDDH
PRMA_XANAC        --LAARVAPGGRIALSGILHGQEDDLLKRYAPWFEQL------------RCERDED----
PRMA_XANCP        --LAARVAPGGRIALSGIMQGQEQDLVQRYTPWFEHL------------HCEYDAE----
PRMA_XYLFA        --LAGCVAPGGRLALSGILRGEEKEVLRCYAVWLDVL------------GCEEEDG----
PRMA_XYLFT        --LAGYVAPGGRLALSGILRGEEEEVLRCYAVWLDVL------------GCEEEDG----
PRMA_HALHL        --LRDGVRVGGRLALSGILRGQEQQVMDAFQGGIAWD------------APRCCGD----
PRMA_BURVG        --LASKVKPGGRIALSGVLARQADEVAAVYARYVDIS------------VWREHEG----
PRMA_BURL3        --LASKVKPGGRIALSGVLARQADEVAAVYARYVDIS------------VWREHEG----
PRMA_BORBR        --LAGRVAPGGHLVLSGVLERQADEVAAAYAPWLTMS------------VWRERDG----
PRMA_NEIMA        --LAARTKQGGRIVLSGLLDEQAEELGGIYSQWFDLD------------PAETEEG----
PRMA_CHRVO        --LASHVKTGGRIVLSGILAEQADELSAIYSQWFEMD------------PPVFDEG----
PRMA_NITEU        --LMKALQPGGRIVLSGILETQADEVLQVYSEWFDMH------------IAAKEQG----
PRMA_DICNV        --FEKHLHAQSVMIFSGLLERQQQKLEQAYQDHYRIE------------RINCRAG----
PRMA_OPITP        --LVQAVRPGGVLILSGILATEVAQVRAAFGQEAPDW------------AIESKTMGD--
D5ELE0_CORAD      --VVMAIKDGGTLALSGILTKELDQVRNHYEERFAELRDLRV-------SIDSREDGE--
PRMA_ENTFA        --AWRLLKQDGTFIISGII-EDKKAMVLEALTKVGFVVDQ----------LFNQGD----
PRMA_LACPL        --ARQNLKRGGYFIASGII-DDKFQVVMTTIKEAGFQITQ----------HTQMGD----
PRMA_OCEIH        --AWSNLKAGGYFITSGII-QNKKQLVIDNLTKQGFEVIS----------LNEMED----
PRMA_BACSU        --AYSLLKEGGHFITSGII-GHKKQEVKEALEQAGFTIVE----------ILSMED----
PRMA_BACCR        --AARVVKSGGLFITSGII-AAKEKVISEALEKAGFTIEE----------VLRMED----
PRMA_STRZJ        --AYRLVKDEGYLIMSGII-KDKWDMVRESAESAGFFLET----------HMVQGE----
PRMA_STRR6        --AYRLVKDEGYLIMSGII-KDKWDMVRESAESAGFFLET----------HMVQGE----
PRMA_LACLA        --AFRLVKEEGYLIMSGII-ADKADMVIASAEKAGFFLET----------RMIQGE----
PRMA_STAAM        --AYNTLNEGGYFITSGII-KEKYEGIQSHMERVGFKIIS----------EQHDNG----
PRMA_CALS4        --VLPHLKEEGLFLASGII-KDRFEEVKERAEEF-FEIID----------MKEEKE----
PRMA_LACP7        --VGEFMKPGAYFISSGII-DMKAEEVKEAILRNGFIIEE----------ITTMGD----
PRMA_LACDA        --LDSHLNEDGQVIFSGID-YLQLPKIEQALAENSFQIDL----------KMRAGR----
PRMA_LACAC        --MDAHLNKDGQVIFSGID-YLQLPKIKKSLDENNFKIDL----------TMKQGR----
PRMA_THEM4        --MPKFLKKNGIVILSGII-DSKLYLFEH------LNIVE----------HRRKDE----
PRMA_THEAB        --LPKFLKKDGVVILSGII-DSKLPLFKN------YNIVE----------HWRSNE----
A7HNK9_FERNB      --AGNYLKEGGILILSGII-LPKVNLFDQ------YNVIE----------KMVMDE----
PRMA_THEMA        --VNRVTHRDSMLILSGIV-DRKEDMVKRKASEHGWNVLE----------RKQERE----
PRMA_CAMC1        --LKKSLKKGGYLVLSGILNKYEDRIKDTFK-DLELVEIK----------QAND------
PRMA_CAMHC        --LKNSVKSGGILIISGILEKYKNKILNVFS-DMNNLEIL----------QNGE------
PRMA_CAMJE        --IKNHLEDNAILILSGILDKYSTRIKEKFQ-DLELIDEM----------QINE------
PRMA_NITSB        --LQETTKEGGILILSGIIEKYRNKVKNRF--DFSILEEL----------QEGE------
PRMA_WOLSU        --LKERLKPGARLILSGILGPYKEDVLRKFG-GFTLEKEL----------LCEE------
PRMA_HELHP        --FRTKLAKNGVLILSGILDEYKFDIIKAFN-DFDMLDTC----------CKDG------
PRMA_HELPY        --FVRLC--NHTLILSGILETHLNSVLQIYYNGFEVLEQR----------QRNE------
PRMA_HELPJ        --FVRLC--NHTLILSGILETHLNSVLQIYYNGFEVLEQR----------QRNE------
PRMA_AQUAE        --ILPKF--KKIGIFSGLYKEKDLKRFEELLGGLKVKEVF----------EKEN------
D3SNG3_THEAH      --IKRLF--SVRGVFSGLYGGDDLEKFLKLFQDHKVVKIV----------KMRG------
C0QSF8_PERMH      --ISKLF--RKYLIVSGIYGEKERSQILKLSKDLNLEVLK----------EVSKKDEG--
C1DW65_SULAA      --LKDIF--KKYWLISGIFKD-EKDKILKMAENSGLEVVE----------MKSKPEEGK-
PRMA_CHLTE        --IRRHA-PNAQVLLSGVL-VYDEPWLKQLLKRIKYTNVK----------TIYEDE----
B3QUV4_CHLT3      --LAPYA-KSAQIMVSGIL-VYDEAWLVKLLESFGCKIVR----------KATEGE----
PRMA_PORGI        --YRSRLGNGGTLLLSGFY-TEDIPILTECAEILGLTLSE----------TRSRNN----
PRMA_BACTN        --YVACMHPGSELYMSGFY-VDDIPFIRREAEKNGLTFVH----------HKEKNR----
F9ZBU4_ODOSD      --YVARLLPQGLLIMSGFY-LQDLPLIQERAAQSGLTFMT----------YREDKN----
F0RGF5_CELLC      --YAKCLTKDGILFLSGFY-KEDIPVITEKCNEVGLKFEK----------NLEKNN----
A6H072_FLAPJ      --YVDCLNPKGTILFSGFY-TEDIPFINASCTEKGLTYVK----------KFERNN----
Q26FA8_FLABB      --YGKCLKSGGTILFSGFY-TDDLELIKKACNKVGIQYDS----------HKVKDN----
C6XTZ6_PEDHD      --YAAILKKQGNIFFSGFYESPDLDMIKAACEPFGIKYVD----------HKKIGD----
F4KWZ6_HALH1      --LHQKLKQGGILLISGIL-KTDRELVLAEALQHGFSPVQ----------SLEKGN----
PRMA_SYNY3        --FTPLVKPHGWAILSGIM-VEQSQAIADALEQNGWTVVA----------IWKRQE----
PRMA_NOSS1        --ISEISKPSTWAIFSGIL-VEQSTSVAEALEKHGWVVAT----------MWKRKE----
PRMA_THEEB        --LPAIVKPKGWGIFSGIL-LDQADRVAEQLKRQGWSLGS----------VWRRNE----
PRMA_PROMM        --FDQLLSANGRGLLSGLL-VKQAPRLQMVLEALGWRVNC----------LTEQGC----
PRMA_SYNPX        --FEALVAPEGRALLSGLL-VDQAPRLEQVLGDLGWRVSA----------RGSQGR----
PRMA_PROMA        --FFKLTHSYSRLCLSGLL-VAQVEDITNFLSILGWELID----------SYSSDN----
PRMA_PROMP        --IRNCLKIDGEVILSGIL-NSQKDEIIKLLKASNLRIND----------VSSKKD----
PRMA_BRUME        --IKEHLAPGGSIILSGILDSQHDAVLAAYQTQGLTHQKT-----------LHR------
PRMA_RHILO        --MAGHIALGGSIVLSGILERQRDAVISAYVGQNFRHVRT-----------LYR------
Q1YM86_AURMS      --FHRHLAQGGDIVLSGILTTQRNAVLAAFRNQGLYHVAT-----------LVR------
PRMA_AGRFC        --LVTHLAPGGTVILSGILASQRWKVLSAYNGAKLSHIRT-----------IWR------
J7Q4B7_METSZ      --IAGAAAADAALVLSGLLARDVRGVLDAYRAQGFFLAER-----------GDI------
D7A7G7_STAND      --LRRLLAPGGRVVLSGLLPSHANAALAAYRAQGLHLVRR-----------RTI------
PRMA_BEII9        --VARVTQRGADIILSGLLARDVPGVLSAYRIQGMALRDR-----------LDL------
PRMA_BRADU        --MARHLAPGARVILSGLLTHQAPAVIAAYRARGLVPLRH-----------LRI------
I3TVK6_TISMK      --VVRHLAPGGRLVLSGLTPRQDSWVLNAYRRRGLVLDKR-----------LVL------
G8AFP8_AZOBR      --LKRHLQRGGVAVLAGLLNRQERHVIQAHRTQGLHLVAR-----------IPV------
J8VVC4_9SPHN      --FGKALVPGGHLLLAGLLETQEAAVRAACRKAGLRLAAR-----------MVN------
Q2N9W3_ERYLH      --FAAHVAPGGHLLLAGLLETQEARVRAAYRRAGFRLAKR-----------LVN------
A4EPW0_9RHOB      --LSGNLRPGGFAILSGILNEQADDVVSVYAENGTNLVRR-----------DEI------
PRMA_CAUVC        --IKRALVPGGTVILSGLLRTQERMVKAAYLSRGFKVVTR-----------IHR------
PRMA_DEIRA        --YAAQLRPGAPLILTGILTSKLPLVRDALDREGFTDVQV-----------RTDSEGAG-
PRMA_DEIGD        --YAAHLVPGGALILTGILTVKLPLVHAALDREGFTNVQE-----------TLD------
PRMA_THET8        --YREALVPGGRALLTGILKDRAPLVREAMAGAGFRPLEE-----------AAE------
H2J703_MARPK      EKLDNILNDNGYLILSGINAERENEILSKITEHEYNIISR-----------EEDAG----
PRMA_DESAL        --LPRIMAPGSIFIASGIMAEKKDLVLEALDACRFSVERV-----------QETGG----
PRMA_FUSNN        --IKYILKENSIVLFSGIIEDKLNEVISKAEDVGLEVVEV-----------KADKE----
PRMA_MYXXD        ----IVAKTKDRLVLAGVLSHQRADVEAAYRNLGLTVLTG-----------ATQGE----
PRMA_SORC5        --LARVLEPGGWLILSGILESERDDLIARYTSLPRPLEHVATRPDPASPGGDRRAGRGDA
PRMA_SALRD        --LVARLAPGASLLLSGLLRPQRDDIRDAVASHGLALDAE----------AAEEGW----
E6VWN0_PSEA9      --ILLHVRPGGSLILSGILADKQKEAVTEAYERLGIGAPV----------INIEGE----
PRMA_DESPS        --LYSRVKKEGHLILSGLLADQQVDSIIEIFAREGFVLLE----------KGIEGE----
PRMA_LEPIN        ----IASIKTDHFLFSGVITERKEEFLELLKNTVGGEGVF----------FREDTG----
I4CAY3_DESTA      ----LASLFRRYLIVSGVPLDQWDQVKNILAHGDIRLEQE-----------IIRSE----
C0Z9H1_BREBN      --ITERMAPKGTLILSGIVEWNRDAVIALFEQAGFQVEKE-----------SQHDE----
E1X260_HALMS      --LIDSVASGGYLIVSGLLNNQVDNIVESYSELEKVSVLS-------------KDD----
                                 :*.                                          

PRMA_PSEPK        ----WVRISGRRR---------
PRMA_PSESM        ----WVRITGRRR---------
PRMA_MARHV        ----WIRLTGRRKDG-------
PRMA_VIBCH        ----WCRISGRKLG--------
PRMA_VIBVU        ----WCRISGRKQG--------
PRMA_SALTY        ----WCRITGRKK---------
PRMA_ECOLI        ----WCRITGRKN---------
PRMA_HAEIN        ----WCRITGKLKTL-------
PRMA_SHESA        ----WSRLTGKRK---------
PRMA_SHEON        ----WSRLTGTRK---------
PRMA_PSYWF        DDSHWHRLSGTFTG--------
PRMA_XANAC        ----WMRIDGVRRG--------
PRMA_XANCP        ----WVRIDGVRRH--------
PRMA_XYLFA        ----WIRIDGVRRC--------
PRMA_XYLFT        ----WIRIDGVRRC--------
PRMA_HALHL        ----WVLVSGTRTA--------
PRMA_BURVG        ----WVCLAGTRRESH------
PRMA_BURL3        ----WVCLAGTRRESH------
PRMA_BORBR        ----WVCLHGVKA---------
PRMA_NEIMA        ----WARLSGTKR---------
PRMA_CHRVO        ----WTRLTGTRRAAV------
PRMA_NITEU        ----WVLLAGQKSGGGFA----
PRMA_DICNV        ----WILLRLTSL---------
PRMA_OPITP        ----WSDLELRRPAGVLEL---
D5ELE0_CORAD      ----WGDLLIQLPE--------
PRMA_ENTFA        ----WYAIILKKPEEE------
PRMA_LACPL        ----WHGIVAYLPTAED-----
PRMA_OCEIH        ----WVSIVAKKPSEK------
PRMA_BACSU        ----WVSIIAKK----------
PRMA_BACCR        ----WVAIIARNA---------
PRMA_STRZJ        ----WNTCVFKKTKDISGVIGG
PRMA_STRR6        ----WNACVFKKTKDISGVIGG
PRMA_LACLA        ----WNCLIFKKTENREGVIGG
PRMA_STAAM        ----WVCLVGQKVSE-------
PRMA_CALS4        ----WLSILMKKKG--------
PRMA_LACP7        ----WTSIVAKKPNK-------
PRMA_LACDA        ----WIGLAISRKHD-------
PRMA_LACAC        ----WIGLAITRKEK-------
PRMA_THEM4        ----WNALVIKF----------
PRMA_THEAB        ----WNALVIKI----------
A7HNK9_FERNB      ----WNALVIKI----------
PRMA_THEMA        ----WVTLVMKRS---------
PRMA_CAMC1        ----WVSFVYKEMDE-------
PRMA_CAMHC        ----WVSFVFKKG---------
PRMA_CAMJE        ----WCSFVYKNNKKG------
PRMA_NITSB        ----WITMILRNDRGTDGK---
PRMA_WOLSU        ----WVTLQLRKN---------
PRMA_HELHP        ----WVALKLTL----------
PRMA_HELPY        ----WVALKLLKKQPIN-----
PRMA_HELPJ        ----WVALKLLKKQSIN-----
PRMA_AQUAE        ----WYAVVVEKG---------
D3SNG3_THEAH      ----WYGVVLEK----------
C0QSF8_PERMH      LEEKWYGFVLRHSKKD------
C1DW65_SULAA      PDDLWYGFVIKHK---------
PRMA_CHLTE        ----WLSALVEPKN--------
B3QUV4_CHLT3      ----WLCALISKA---------
PRMA_PORGI        ----WAALRFTPDSPKR-----
PRMA_BACTN        ----WAAVKFTY----------
F9ZBU4_ODOSD      ----WVAASFYKN---------
F0RGF5_CELLC      ----WVAVKYVF----------
A6H072_FLAPJ      ----WVSLKYVI----------
Q26FA8_FLABB      ----WVGLKMIKN---------
C6XTZ6_PEDHD      ----WVAAYFTK----------
F4KWZ6_HALH1      ----WLAVRLH-----------
PRMA_SYNY3        ----WCCFQARREEGD------
PRMA_NOSS1        ----WCCLNVRRT---------
PRMA_THEEB        ----WCCLNARFERLPD-----
PRMA_PROMM        ----WGLLDVSKR---------
PRMA_SYNPX        ----WGLLEIQRR---------
PRMA_PROMA        ----WALIRLCRNHP-------
PRMA_PROMP        ----WVCITAQKIP--------
PRMA_BRUME        --EGWVAIHLK-----------
PRMA_RHILO        --EGWVTIHLKH----------
Q1YM86_AURMS      --GEWVTLHLR-----------
PRMA_AGRFC        --NDWVTLHLRKD---------
J7Q4B7_METSZ      --DGWATLVLKR-GGRG-----
D7A7G7_STAND      --EGWTTLELSADSGRPRQ---
PRMA_BEII9        --EGWVTLHLRKQ---------
PRMA_BRADU        --EGWSSLLLRKVG--------
I3TVK6_TISMK      --DGWTTLMMRRAPRRQD----
G8AFP8_AZOBR      --GEWTTLVVKRPKRKAVKG--
J8VVC4_9SPHN      --GDWSILWMRKR-GR------
Q2N9W3_ERYLH      --GDWSILWMRKRIGRNAG---
A4EPW0_9RHOB      --GEWTTLLLQRKG--------
PRMA_CAUVC        --DAWATLVLQRP---------
PRMA_DEIRA        --GEWALVTARRED--------
PRMA_DEIGD        --GEWALVTARAPLG-------
PRMA_THET8        --GEWVLLAYGR----------
H2J703_MARPK      ----WISILLQKRI--------
PRMA_DESAL        ----WVGIAARMP---------
PRMA_FUSNN        ----WRAVYFKRK---------
PRMA_MYXXD        ----WVRIDLQR----------
PRMA_SORC5        GGEGWVAILFRAPGGAASSPG-
PRMA_SALRD        ----WAGRFARSPSP-------
E6VWN0_PSEA9      ----WACLVWERVEGWDRA---
PRMA_DESPS        ----WGAVLLQKR---------
PRMA_LEPIN        ----WELIEWKRKG--------
I4CAY3_DESTA      ----WGCGLFSK----------
C0Z9H1_BREBN      ----WVTVVLKNIA--------
E1X260_HALMS      ----WSAILFKKV---------
                      *