CLUSTAL format seed alignment for MF_00736

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RL11_METMP       ------------------------------------------------------------
RL11_METKA       ------------------------------------------------------------
RL11_ARCFU       ------------------------------------------------------------
RL11_METS3       ------------------------------------------------------------
RL11_METMJ       ------------------------------------------------------------
RL11_METBU       ------------------------------------------------------------
RL11_METTP       ------------------------------------------------------------
RL11_THEVO       ------------------------------------------------------------
RL11_NITMS       ------------------------------------------------------------
RL11_HYPBU       ------------------------------------------------------------
RL11_SULAC       ------------------------------------------------------------
RL11_DESA1       ------------------------------------------------------------
RL11_NANEQ       ------------------------------------------------------------
RL11_KORCO       ------------------------------------------------------------
RL11_AZOC5       ------------------------------------------------------------
RL11_JANSC       ------------------------------------------------------------
RL11_ERYLH       ------------------------------------------------------------
RL11_RICAE       ------------------------------------------------------------
RL11_LIBAS       ------------------------------------------------------------
RL11_BUCBP       ------------------------------------------------------------
RL11_WIGBR       ------------------------------------------------------------
RL11_BLOFL       ------------------------------------------------------------
RL11_COXBU       ------------------------------------------------------------
RL11_AZOPC       ------------------------------------------------------------
RL11_SULMW       ------------------------------------------------------------
RL11_AMOA5       ------------------------------------------------------------
RL11_AKKM8       ------------------------------------------------------------
RL11_PARUW       ------------------------------------------------------------
RL11_BRAHW       ------------------------------------------------------------
RL11_PHYMT       ------------------------------------------------------------
RL11_TREPA       ------------------------------------------------------------
RL11_CORA7       ------------------------------------------------------------
RL11_SALRD       ------------------------------------------------------------
RL11_RHOBA       ------------------------------------------------------------
RL11_RUBXD       ------------------------------------------------------------
RL11_LEPBJ       ------------------------------------------------------------
RL11_LEUMM       ------------------------------------------------------------
RL11B_BACCR      ------------------------------------------------------------
RL11B_BACHD      ------------------------------------------------------------
RK11_SPIOL       MAQPLVAAPSSSSITSPIPRKLCSSLLTPSSLSLSSNPRNSLQFLNSKLFLSPPSTSHRR
RK11_CYACA       ------------------------------------------------------------
RL11_SULDN       ------------------------------------------------------------
RL11_THETH       ------------------------------------------------------------
RL11_MYCMO       ------------------------------------------------------------
RL11_MYCPU       ------------------------------------------------------------
RL11_MYCPE       ------------------------------------------------------------
RM11_CAEEL       ---------------------------------------------------------MAS
RM11_DROME       ----------------------------------------------------------MS
RM11_RAT         ------------------------------------------------------------
RM19_SCHPO       ------------------------------------------------------------
RM19_YEAST       ------------------------------------------------------------
RM11_RECAM       ------------------------------------------------------------
RL11_WOLPM       ------------------------------------------------------------
RL11_HALSA       ------------------------------------------------------------
RM11_DICDI       ----------------------------------------------------------MT
RM11_DICCI       ----------------------------------------------------------MT
RL12_DICDI       ------------------------------------------------------------
RL12_CHLRE       ------------------------------------------------------------
RL12_ENCCU       ------------------------------------------------------------
RL11_PYRAE       ------------------------------------------------------------
RM11_ACACA       ------------------------------------------------------------
                                                                             

RL11_METMP       ----------------MAEQVVEILVSGGKATAGPPLGPAIGPLGVNIMQVVQKINNMTK
RL11_METKA       ----------------MPKEEVEVLIEGGKADPGPPLGPALGPLGVNIQEVVEEINRKTK
RL11_ARCFU       -----------------MVQVVEVLVPGGQASPGPPLGPAIGPLGLNVKQVVDKINEATK
RL11_METS3       ----------------MAKDTVEILIEGGSATPGPPLGPALGPFGINMMQVVEEINNKSA
RL11_METMJ       -----------------MAETVEVLVPGGKATAGPPLGPALGPLGINVKAVVDDINKKTA
RL11_METBU       -----------------MASVVEALIPGGKANPGPPLGPALGPLGVNIKDVIEKINEKTK
RL11_METTP       -----------------MANVVEALVSGGKATAGPPLGPALGPLGVNVAAVVAKINELTK
RL11_THEVO       -----------------MAQSVKTMVEGGKATTGPPIGPALGPLGLNVAQVVKEINEKTK
RL11_NITMS       ----------------MGEQKISSLVTGGGASAGPPLGPALGPLGVNIMEVINAINDKTK
RL11_HYPBU       ----------------MGIRVINVKVRGGEAKPAPPLAPAIEKLGLDVNKVVEDINKATE
RL11_SULAC       ----------------MPTKTIKIMVEGGSAKPGPPLGPTLSQLGLNVQEVVKKINDVTA
RL11_DESA1       ----------------MVKKTIRVMVEGGKATPGPPLGPTLSPYKVNIPQVVKAINDATK
RL11_NANEQ       ----------------MGEIAIRLLVTGGKATPGPPIGPALSPFKINPGKVVAEINKLTK
RL11_KORCO       ----------------MPKKIVRVLIEGGKATPGPPLGPALGGLGLNMGQIVKEINEKTS
RL11_AZOC5       -----------MAKK--ITGYVKLQVPAGSANPAPPIGPALGQRGLNIMEFCKAFNAQTA
RL11_JANSC       -----------MAKK--LVGSMKLQIPAGQANPSPPVGPALGQRGINIMEFCKAFNAKTQ
RL11_ERYLH       -----------MAKK--IDGYIKLMVPAGTANPSPPLGPALGQRGVNIMEFCKAFNAATD
RL11_RICAE       ----------MSQKA--IKGYINLIIPAAGATPAPPIGPALGQRKVNIAAFCKDFNDATQ
RL11_LIBAS       -----------MAKV--VSRIVKLQIESGSAKPSPPVGPAIGQAGIPIMAFCKAFNAATE
RL11_BUCBP       -----------MAKT--IQAYIKLQVSAGTANPSPPIGPALGQKGINIMEFCKAFNTRTN
RL11_WIGBR       -----------MTKK--IKAYVKLQIKAGSANPSPPIGPALGQQGVNIIEFCKSFNAKTN
RL11_BLOFL       ---------MIVKKK--VQSCIKLQIEARSATPSPPIGPALGQQGINIMKFCKDFNTRTA
RL11_COXBU       -----------MAKK--ITGYIRLQIKAGEANPSPPVGPALGQHGVNIREFCESFNTATK
RL11_AZOPC       -----------MAKE--VAGKLRLQIRGGAANPSPPVGPALGSKGVNIMEFCKQFNAKTQ
RL11_SULMW       -----------MLKT--IKKIIKLQIKGGLANPAPPIGPALGSAGVNIMDFCKQYNFSTQ
RL11_AMOA5       -----------MAKE--IVGYLKLQVKGGEAKPAPPVGPALGSKGLNIMEFCKQFNARTQ
RL11_AKKM8       -----------MAKE--ITKIIKLQINAGAANPSPPVGPALGQAGVNIMAFCKEFNAATQ
RL11_PARUW       -----------MSKK--VVKVIKLQIPAGKANPAPPIGPALGAAGVNIMAFCKEFNAKTQ
RL11_BRAHW       -----------MAKK--VVGIVKVRIPGGEATPAPPLGPALGQKQIQIAAFVKDFNAKTS
RL11_PHYMT       -----------MAKQ--VVKKIKLQILAGKANPAPPVGPALGQAQVNIPSFCSQFNEATK
RL11_TREPA       ---------MAAKKK--VVTQIKLQCPAGKATPAPPVGPALGPHGVSAPQFVQQFNDRTK
RL11_CORA7       -----------MAPKKKVTGLIKLQIEAGAANPAPPVGPALGAHGVNIMEFCKAYNAATE
RL11_SALRD       -----------MAAP--VEQTIKLQIKGGQANPAPPIGPALGQHGVNIMEFCKAFNSRTE
RL11_RHOBA       -----------MAKQ--VTGQAKFQVPGGQATPAPPVGTSLGKYGVNLGQFVQQFNDRTK
RL11_RUBXD       -------MGRGRGKR--VVRKLKLQIPGGQANPAPPVGPALGQAQVNIGEFVRQFNDATR
RL11_LEPBJ       ----------MAAKK--VVKQIKLQVEAGKANPAPPVGPALGQAGLNIMEFCKQFNERSK
RL11_LEUMM       -----------MAKK--VVNVVKLQIAAAKATPAPPVGPALGQAGINIAQFTKEFNARTA
RL11B_BACCR      -----------MAKK--VLKVVKIQLPAGKANPAPPVGTVLGPTGVNIMMVCKEYNALTQ
RL11B_BACHD      -----------MEKV--IKQIVTINLEAGKANPAK-VGKDLAPTGINLLGFCNQYNEMTK
RK11_SPIOL       LSIVAMAPKPGKAKK--VIGVIKLALEAGKATPAPPVGPALGSKGVNIMAFCKDYNARTA
RK11_CYACA       -----------MIKK--IITTVKLALPAGKATPAPPVGPALGQHGVNIMMFVKEYNARTE
RL11_SULDN       -----------MAKK--IMGYIKLQIEAGKATPAPPVGPALGQRGVNIMEFTKAFNEKTK
RL11_THETH       ------------MKK--VVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATA
RL11_MYCMO       -----------MAKKKEVVRVAKLQFNAGQAKP----GPELAGLGIVMPEFTKQFNDATR
RL11_MYCPU       -----------MAKK-EVVKIAKLQFIAGQAKP----GPSLAGVGINMPEFTRQFNEQTR
RL11_MYCPE       -------MLLVAFKDPRITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTK
RM11_CAEEL       KGAARVR--KKEIVKVVHGALLRTNIKAQMASAAPPLGPQLGQRGLNVANFCKEFNKETG
RM11_DROME       KAAGKLKSLKKTVERVTHTSKLKTNIPAGMAAAGPPLGPMLGQRAINIAAFCKDFNAKTA
RM11_RAT         --MSKLSRVTRTLKKPEAGGVIRSIVRAGQAIPGPPLGPILGQRGVSINQFCKEFNEKTK
RM19_SCHPO       -------------MASTRTTIIKLIVPAGKATPTPPIGPALGARGLKSIDFCKEFNARTA
RM19_YEAST       ------------MSQAAKNVIVKLIVGAGQAAPSPPVGPALGSKGIKAIDFCKEFNARSA
RM11_RECAM       --------------MNKIIGFIRLEIESGKASPSPPVGPALGLRGVNIMQFCKEFNNRCK
RL11_WOLPM       --------------MSVIVAKINLLMEAGKAVPGPKIASVLGPRGIPVPKFCEAFNKVTS
RL11_HALSA       -----------------MAETIEVLVAGGQADPGPPLGPELGPTPVDVQAVVQEINDQTE
RM11_DICDI       YISKKQAAKKVIVREKPILVRLKLIIGAGTASMTPPLGPNLGQYGINSIEFFNDFNTETK
RM11_DICCI       YISKKQAMKKVLVREKPILVRLKLLIGAGTASMTPPLGPNLGQYGINSIEFFNDFNTETK
RL12_DICDI       ---------MPPKVDPSEKVEVFLRVCGGEAGAMSTLAPKLGPLGVSPKKVGDDIAKAT-
RL12_CHLRE       ------------------VVEVCVRVTGGEVGDASSLAPKIGPLGLSPKKIGEDIAKETL
RL12_ENCCU       --------MAEQKGMDPDTKYIKLQVVGGEVPGA-TLAQRVGPLGLSSKVVGEDIKKAT-
RL11_PYRAE       ----------------MSKRVVTVPLQGGKVAVNPQFQDALKQIGLDPNAVVQRVQEELK
RM11_ACACA       -----MRINLNFHYDKLHLKEIIILIPKYHTNMVSFLTPILGLYGINVKEFINDFEIKTR
                                               .         :         .         

RL11_METMP       D-----YEGMSVPVKV-IVDTDKRTFEVEVGIPPASALIKKEIGIEK--------GSQEP
RL11_METKA       D-----FKGMEVPVKI-IVDTETREFEVKVGSPPTSAIIKSELGIDK--------GAHEP
RL11_ARCFU       D-----YEGLSVPVKI-IVK-DDRSFEIEVGIPPVSALIKRELGIEK--------GASNP
RL11_METS3       D-----FAGMKVPVKV-SIDRDTKEFEIEIGTPPTTSLIMEELGIEK--------ASHEP
RL11_METMJ       E-----FNGMQVPVTV-TVD-DKKNFTIEVGIPPTTALVMKEAGITK--------GSTEP
RL11_METBU       D-----YNGMQVPVKV-IVN-DDKSVEIEVGTPPTSALILKELNIEK--------GSGES
RL11_METTP       D-----LNGMQVPVKI-IVK-SRTEFEIEVGTPPTSALLLKEAGVEK--------GSGD-
RL11_THEVO       E-----FQGMQVPVTVTVIDPETKKYEITVGVPPTSALLKKELGLEK--------GASKK
RL11_NITMS       D-----FEGMKVPVTV-IVDSDTKKYEIEIGIPSAAALIMKEAGIQK--------GSGAS
RL11_HYPBU       K-----YKGFEVAVKL-IVDENTKEYEIEVKPPTTTELLLKAVGASE--------PSGDP
RL11_SULAC       Q-----FKGMSVPVTI-EIDSSTKKYDIKVGVPTTTSLLLKAINAQE--------PSGDP
RL11_DESA1       D-----FEGLSVPVEI-TIDIDTKEFEVRVGIPTTTALLMKEAGAKQ--------PTGDP
RL11_NANEQ       E-----YEGLPVPVEI-IINPETKEYKIIVGLPPTSALLMKAAGVTR--------GPQRT
RL11_KORCO       S-----YSGMRVPVEI-EVDTETKKFEIRVGTPPTSMLILRELKAEK--------GSSD-
RL11_AZOC5       Q----LEKGMPIPVVI--TAYQDRSFTFELKTPPVSYFLKKAAGLDTKKKPGS--GSKTP
RL11_JANSC       E----MEQGAPCPTVI--TYYQDKSFTMDIKTPPASYYLKKAAGLKPVGKRNRPRGAETP
RL11_ERYLH       G----MEKNAPVPTVI--TVYADRSFSFVTKQPTATYLIKKAAKIKK--------GSGET
RL11_RICAE       G----MEKGIPLPTVI--TVYEDSSFSFKIKTPPASYFLKKYAKITK--------GSSAT
RL11_LIBAS       G----MEKGIPIPTTV--TCYKDKSFTFTMSQPPVSFFLKKEVGIKS--------GSKLP
RL11_BUCBP       N----LEKGLPIPTII--TVYSDKSFSFITKTPPASVLLKKAAGI-TK-------GSSKP
RL11_WIGBR       K----IDKDTPIPVII--SVYNDRTFSFITKTPPTAFFLKQAANI-KS-------GSDNP
RL11_BLOFL       D----FEMGLILPVVI--TVYVDRSFSFVIKTPTAVFLLKKAAGI-KS-------GSEKP
RL11_COXBU       N----IEKGLPTPVII--TVYADRTFSFITKTPPASVLLKKFVLKGKS-------GSARP
RL11_AZOPC       D-----RIGKLLPVVV--TYYVDKSFDFVIKNPPVAVQLLEIVKLKS--------GSAEP
RL11_SULMW       K-----SKGKLLPVII--TIYNDKSFSFIIKEPPVSKQLLELCKLDK--------GSKES
RL11_AMOA5       D-----KQGQILPVLI--TIYQDKTFDFVIKTPPAAASIMQKAGISK--------GSSES
RL11_AKKM8       K-----QAGDLLPTVI--TVYKDKSFSFITKQPPGSVLLKKAAGVAS--------GSGEP
RL11_PARUW       A-----MAGDVLPTLI--TVYHDKSFSFITKKPPVAELLKKAKGIAK--------GSGVP
RL11_BRAHW       K-----MKGQLLNTYI--TVYEDKTYTFVTKGTSTSTLIKKKLGIEK--------GSGEP
RL11_PHYMT       D-----QANYLVTAVI--SVYNDRSFTFIIKTPPASSLLKKAANIKL--------GSANS
RL11_TREPA       S----MEPGLVVPVVV--TVYSDKSFSFVLKTPPAAVLIRKACGIEK--------GSTNS
RL11_CORA7       S-----QRGNVVPVEI--TVYEDRSFDFKLKTPPAAKLLLKAAGIKK--------GSGVP
RL11_SALRD       D-----RMGTLLPVEI--TVYADRSFDFIVKSPPASVLLKQKADIET--------AAGDP
RL11_RHOBA       E-----YNGTPIPVIV--TVYNDRSFDFITKSPPAASMLMQSAGIAK--------GSGVP
RL11_RUBXD       D-----RMGQLIPVEI--TVYEDRSFTFVTKTPPAAFLLKQAAGVEK--------GSGEP
RL11_LEPBJ       A-----QIGLKLPVVI--TVFSDRSFTFITKSPPAALLVKKAIGLET--------GSPTP
RL11_LEUMM       D-----QAGSIIPVEI--SVFDDRSFEFVTKTPPAADQLRKIVG--K--------GSGEP
RL11B_BACCR      G-----QAGMIIPAEI--TIYEDRSFSMKIKTAPVAELLKREAGISK--------GSGEP
RL11B_BACHD      L-----QLGLVVPAKI--TIYEDRSFNVKLKTPPAAFLLKKYAGVEK--------GAAQP
RK11_SPIOL       D-----KPGFVIPVEI--TVFDDKSFTFILKTPPASVLLLKASGAEK--------GSKDP
RK11_CYACA       E-----QKGSIIPAEI--QIYEDKSFTFILKTPPASILLKQATGIEK--------ATKAP
RL11_SULDN       D-----KMGFKVPVVI--TVFTDKSFTFVVKQPPASALLMHAAGLKG--------GSSNP
RL11_THETH       N-----MGDAIVPVEI--TIYADRSFTFVTKTPPASYLIRKAAGLEK--------GAHKP
RL11_MYCMO       E-----RSGEPVPVQI--IVYKDKSFDFKLFTAPTSFMLKKAAGIKS--------GSANS
RL11_MYCPU       D-----RGNEPVPVEI--TAYKDKSFDFRLFTAPASFKILQAIKAKS--------GSANS
RL11_MYCPE       D-----KNGEVIPCII--TAFKDKSFTFEIKTTPVTMLLKKAANIKV--------GAKNS
RM11_CAEEL       ---HF-KQGVPLPTRI--TVKPDRTYDLEICTPTTTWLLKQAAGIGR--------GKASK
RM11_DROME       ---EM-KEGVPLPCRI--SVNSDRSYDLAIHHPPATFFLKQAAGIQR--------GTMTP
RM11_RAT         ---DI-KEGIPLPTKI--FIKPDRTFELKIGQPTISYFLKAAAGIEK--------GARQT
RM19_SCHPO       ---GW-MPNTPVPCKI--TVTPQRTFTFTIHTPPTSWLISKTLDLEK--------GSSSP
RM19_YEAST       ---NY-QPGVPVPVLI--TIKPDRTFTFEMKSPPTGYLLLKALKMDK--------GHGQP
RM11_RECAM       QL-NI-KDGVPVPTII--TVYDDKTFSFKMKTPSITYFIKKHLEISK--------GASKP
RL11_WOLPM       AANANYKVGDLVTVRI--SIKDDRSHDFTVSGPPVAYLLKQEAKLSK--------SSGNP
RL11_HALSA       A-----FDGTEVPVTI--EYEDDGSFSIEVGVPPTAALVKDEAGFDT--------GSGEP
RM11_DICDI       EL---FETGLALRVIL--WINVMKAFYFELQMPKISNLLKEYYKVEC--------EAAKG
RM11_DICCI       EL---FETGMALRVIL--WINVMKAFYFELQMPKISNLLKEYYKNEV--------EAAKG
RL12_DICDI       ------QPWKGMKVSV--KLTIQNRIAVPEVLPSASALVIKALKEPPR-------DRKKE
RL12_CHLRE       ------KDWKGLRITV--KLTVQNRQAKISVIPSAAALVIKALKEPAR-------DRKKE
RL12_ENCCU       ------ADYKSLKVHV--QLAIKDRKATVEVQPSVATLIIKSLKEPPR-------DRKKE
RL11_PYRAE       K------VGKYPVQKVEVEVVSPSKYEVKIYLPPIGDLLLKLFGKDT--------GAHDA
RM11_ACACA       FI----NFDVIVPTLV--KISKIKTFEIILKTPYVISILSNLNNFSVTKPNIDLLSVYKI
                                :                .     :                     

RL11_METMP       KHQ--------------------------------------VAGNITMEQIVKIAKMKQD
RL11_METKA       RHE--------------------------------------TVGDLSMEQVIKIAKMKFD
RL11_ARCFU       GRE--------------------------------------VVGNLTMEQLLNIARIKRQ
RL11_METS3       GAD--------------------------------------IVADLPIDKALKIARMKFD
RL11_METMJ       GAL--------------------------------------VAGDLPLEAAVRIARMKFD
RL11_METBU       GTV--------------------------------------VVGNLEIAQVAKIARMKKD
RL11_METTP       KKN--------------------------------------FVGDISMDQVIKVAEIKRK
RL11_THEVO       KEA--------------------------------------VAGNATLEQIKNVAIKKMP
RL11_NITMS       GTE--------------------------------------WAGDVTMDAVVKVANTKLE
RL11_HYPBU       MHQ--------------------------------------KIGDLPFEKIVEIAILKKP
RL11_SULAC       AHK--------------------------------------KIGNLDLEQIADIAIKKKP
RL11_DESA1       AHQ--------------------------------------KIGNISFEQVVKVAILKRD
RL11_NANEQ       VHE--------------------------------------WVGNVSMKDVVEIAKKKID
RL11_KORCO       ASK--------------------------------------KIGNLKMETVVNIAKMKLA
RL11_AZOC5       GKG-------------------------------------ATVGKVTRAQLAEIAEKKMK
RL11_JANSC       GR--------------------------------------ETVASITSKQLREIAEAKMV
RL11_ERYLH       GKV-------------------------------------SA-GTIKQSQVKEIAETKMP
RL11_RICAE       KKE-------------------------------------AVVGKVTMDDCREIAKLKMP
RL11_LIBAS       GK--------------------------------------ESCGSITRENIRKIAQLKMQ
RL11_BUCBP       NQ--------------------------------------NKVGTITMQQILDIAQIKKI
RL11_WIGBR       KN--------------------------------------KKIGKISIFKINEIAKKKSP
RL11_BLOFL       KC--------------------------------------VSVGKVLISQIYEIAKIKLI
RL11_COXBU       NT--------------------------------------EKVGKATRQQLEEIAKMKTP
RL11_AZOPC       NR--------------------------------------KKIAEITWEQVKAIAEYKMA
RL11_SULMW       NK--------------------------------------IKVGKITLAKIESIAKNKII
RL11_AMOA5       NR--------------------------------------NKVGVITWSAIKEIAASKME
RL11_AKKM8       NK--------------------------------------KKVATLSKAKLMEVVNTKLP
RL11_PARUW       NR--------------------------------------DKVAKITRSEARKIAEEKIQ
RL11_BRAHW       NK--------------------------------------TKVATINQKQLEEIAQEKMA
RL11_PHYMT       NK--------------------------------------NKVATIKFDQIKEIATLKMP
RL11_TREPA       VK--------------------------------------QKVARLSLAQLTEIAQVKLP
RL11_CORA7       HT--------------------------------------DKVGSVTWDQCKEIAQTKFE
RL11_SALRD       LR--------------------------------------DDAGTVTWDDCLDIADQKLQ
RL11_RHOBA       NK--------------------------------------DKVATVTRAQCEEIAQKKME
RL11_RUBXD       NR--------------------------------------SAAGRVSRAQVEEIARTKMP
RL11_LEPBJ       HT--------------------------------------HKVGKITRKQLEEIAKTKME
RL11_LEUMM       NT--------------------------------------KKAGNVTLDQIRAIAENKMS
RL11B_BACCR      NK--------------------------------------SKIGSITEEKLREIAEYKFP
RL11B_BACHD      GK--------------------------------------EVVGSITTQQLRTIAEIKLP
RK11_SPIOL       QM--------------------------------------EKVGKITIDQLRGIATEKLP
RK11_CYACA       RR--------------------------------------EQVGSISYKEIQNIAKIKIN
RL11_SULDN       LK--------------------------------------NKVAKLTQAQLMEIVNRKIE
RL11_THETH       GR--------------------------------------EKVGRITWEQVLEIAKQKMP
RL11_MYCMO       KT--------------------------------------TIVATIKKSQLEDIAKYKMP
RL11_MYCPU       KT--------------------------------------NIIGTLTLAQLEEIAKYKLP
RL11_MYCPE       KT--------------------------------------ETVATISREKALEIAKTKLV
RM11_CAEEL       ---------------------------------------DEIVGKLTVKHLYEIAKIKSR
RM11_DROME       G--------------------------------------KEVAGMITLKHLYEIAAIKIQ
RM11_RAT         G--------------------------------------KEVAGLVSLKHVYEIARVKAK
RM19_SCHPO       --------------------------------------LHDIKGQLSLKHIYEIAKLKST
RM19_YEAST       NVGTMLGSAPAKG-------------------------PTRALGELSLKHVYEIAKIKKS
RM11_RECAM       G--------------------------------------KENFLNIDIRSLYEIAEIKKI
RL11_WOLPM       GK--------------------------------------ELVAKLPMSAIIKVAKCKMV
RL11_HALSA       QE--------------------------------------NFVADLSIEQLKTIAEQKKP
RM11_DICDI       GN-------------------------------------VYIEKERLLKDCFKIAILLCT
RM11_DICCI       GN-------------------------------------VYIEKDRLLKDCFKIAILICT
RL12_DICDI       KN-------------------------------------IKHNGNIPLEEICKIAKTMRF
RL12_CHLRE       KN-------------------------------------IKHTGSVTMSDIIEIARVMRP
RL12_ENCCU       KN-------------------------------------ILHNGSLRMTEVVDIARIARS
RL11_PYRAE       RN--------------------------------------EVIGNLSFAQLVEIALLKKD
RM11_ACACA       SLLKSVFHSNFLDVFHRRIYLSLRKYLSLVIKVNFHLSVSSALAKKSLSNLNNLLLLKFN
                                                                      :      

RL11_METMP       AML----AYNLKNASKEVVGTCVSVGISVEGMTPSEAQKAIDAGQFDSYFN---------
RL11_METKA       DLL----SYDLKTAAKEILGTCGSMGVTVEGKDPKEVQKEIDEGKWDDLFEKYEEEEE--
RL11_ARCFU       QSL----SYTLKEVVKEVLGTCNSMGITVEGKSPKELTRMIEEGQVEIPEE---------
RL11_METS3       SLL----ANDYKAGVKEVMGTCVSMGLSVDGKDPREAQKDVDAGKYDDVLVE--------
RL11_METMJ       GML----SYDLKSAVKEVLGTCVSVGVTVEGKKPREMIQAVNNGEYDGVLVA--------
RL11_METBU       DIL----SYSLKAAIKEVMGTCVPMGVTIENLDPRECQKAVDEGKFDESLTAEAW-----
RL11_METTP       NLL----SSNLKSAVSEIVGTCGTLGIKIDGLTSKEVQKALASGSYDHLFEAKS------
RL11_THEVO       SML----AKDLKSAVLEVLGTCVAMGINVEGKDPKEVQKLIKSGQIKIEQ----------
RL11_NITMS       NSY----ASSLKSVAKTIVGTCLALGVKVEGKTPKEITAEINEGKWDEKFQ---------
RL11_HYPBU       SLN----AKTLKAAVKTILGSARSIGITVDGKDPKQVTKEVEEGLYDAVLAKYEEEWEKA
RL11_SULAC       QLS----AKTLTAAIKSLLGTARSIGITVEGKDPKDVIKEIDQGKYNDLLTNYEQKWNEA
RL11_DESA1       SLT----AKTLRAAVKTVLGTARSIGITVDGKDPKEVQKLVDEGVYDEILSRYEEEWSKG
RL11_NANEQ       SMP----TSSLKAAVKSVLGTARATGIKVENKDPKEVTKEVDEGKWDHIINE--------
RL11_KORCO       SSN----TPELKQVVKQVLGTALSMGVTVEGKDPREVQREVDSGAWDKLLGG--------
RL11_AZOC5       DLN----CDNVASAVQMLEGSARSMGLQVEG-----------------------------
RL11_JANSC       DLS----ANDVEAAMKIILGSAKSMGIEVKG-----------------------------
RL11_ERYLH       DLN----ANDIDQAMKIIEGSCRAMGLEVVEG----------------------------
RL11_RICAE       DLN----TKNIEAATKIICGSAASMGLEVVGN----------------------------
RL11_LIBAS       DMG----AIDIEGAMRMVEGSACSMGISVVD-----------------------------
RL11_BUCBP       DMT----GSNIDNISKSIIGTANSIGLIIAEGTNK-------------------------
RL11_WIGBR       DMT----GSTLNSISKSIIGTAKSMGLSIED-----------------------------
RL11_BLOFL       DMT----SLNLESASKSIMGTARSIGLEVEDNL---------------------------
RL11_COXBU       DLT----AADLEAAIRTIAGTARSMGIDVEGVE---------------------------
RL11_AZOPC       DLN----CFSVEKAIQMVIGTAKSMGIHVKRDFSEKQLNS--------------------
RL11_SULMW       DMN----CFNIKSAISMVAGTARSMGIEIL------------------------------
RL11_AMOA5       DLN----TINLESATKMIAGTARSMGVTIKE-----------------------------
RL11_AKKM8       DLN----TKDPERAARILAGQARQMGIEVEGM----------------------------
RL11_PARUW       DMN----AADLEMATNIVLGTARSMGIDLIKE----------------------------
RL11_BRAHW       YMS----ANDIEAAKKIVAGTARAMGIKVE------------------------------
RL11_PHYMT       DLN----AYTLESACKIIEGTARNMGIIVEK-----------------------------
RL11_TREPA       DMS----ALTLDAAKRIIAGTARSMGVEVERSL---------------------------
RL11_CORA7       DLN----ARDIENGARIIAGTARSMGITVDGVPAK-------------------------
RL11_SALRD       DLN----AHTVEKGASMVAGTARSMGITVEGKPAHE------------------------
RL11_RHOBA       DLN----ARDIDQATRMIEGTARSMGIIVDG-----------------------------
RL11_RUBXD       DLN----AADVEAAVKIIEGTARSMGIKVEQ-----------------------------
RL11_LEPBJ       DLN----ANDIDAAVNIIAGTCRSMGVTVEA-----------------------------
RL11_LEUMM       DLN----ANDITNAMRMIEGTARSMGVTVDGVDLTVEGTAIKEDAE--------------
RL11B_BACCR      DMN----AASVEAAMRTIEGTARSMGITVQK-----------------------------
RL11B_BACHD      DLN----TTSIDRAMKIIAGTARNMGINIEDD----------------------------
RK11_SPIOL       DLN----CTTIESAMRIIAGTAANMGIDIDPPILVKKKKEVIF-----------------
RK11_CYACA       ELN----TKDLSKAIKIIEGTAKNMGISVET-----------------------------
RL11_SULDN       DLN----TDDKEAAAKTIAGSARSIGIEIVD-----------------------------
RL11_THETH       DLN----TTDLEAAARMIAGSARSMGVEVVGAPEVKDA----------------------
RL11_MYCMO       DLN----TKNLEEAMHTIAGTARNMGILVEGYDDIVKAREEAKLAAKEAASAAAFEAKLE
RL11_MYCPU       DLN----TDDYKVAMHTIAGTAKNMGVLVEGWDDVKKAKEEAKAAKLAQLKAEAKEAALK
RL11_MYCPE       DTN----ANDEEAVLRMVAGSAKQMGIKIEGVDPVVHKDGKKK-----------------
RM11_CAEEL       DKA--LQHVPLEQICRMLIKTCRTLGIDVQYHDLDPVELKEFLVARKEKVDAQLK---DL
RM11_DROME       DPP--NVLLTMQQMCEMLISIARTCGIKV-VREIDPAAYGEFLEERKLIVEQQRR---EL
RM11_RAT         DEAFAMQDVPLSSIVRSIIGSARSLGIRV-VKDLSVDELAAFQKERAVFLAAQKRRIWQL
RM19_SCHPO       DPS--LQGIELLSLCKSVIGTAKSMGVKVVP-----------------------------
RM19_YEAST       DER--HSLLEMEGIVKSIVGVAKSMGIKVVP-----------------------------
RM11_RECAM       DSN-----LDIKSICKSLIGSVKSMGIKTIIVKN--------------------------
RL11_WOLPM       DMK----VDNEDSAVKMVVGTAKSMGIEVVEG----------------------------
RL11_HALSA       DLL----AYDARNAAKEVAGTCASLGVTIEGEDARTFNERVDDGDYDDVLGDELAAA---
RM11_DICDI       FNK---AEKQWEQIEKKYLRITVLEILGTCRSCKIYVKKAENE-----------------
RM11_DICCI       FNK---EEKQWETIDKKYL-----------------------------------------
RL12_DICDI       -KS---LAVDFKGSVLEILGTAHSVGCKVNGKSPRDIQAGIQSGEIEVVEPK--------
RL12_CHLRE       -RS---CAKDLANGCKEILGTAVSVGCKVDGKDPRDVISAIDDGAIEIPDA---------
RL12_ENCCU       SRS---YSNSLSGTVKEVLGTCKSIGCKVDGKCPKEVTREIDAGEIKLPDQ---------
RL11_PYRAE       ELK----SKTLKSAVKQLLSTCKAMGVTVDGRKAEEVLRDVDGGKYDEIINKFEKQWQQ-
RM11_ACACA       IQNNILFAKLLNNRYGLFVSFNNSSASNLNYLKTVLAIQNISIFKAKSNLLSSLTGNKYF
                                                                             

RL11_METMP       ------------------------------------------------------------
RL11_METKA       ------------------------------------------------------------
RL11_ARCFU       ------------------------------------------------------------
RL11_METS3       ------------------------------------------------------------
RL11_METMJ       ------------------------------------------------------------
RL11_METBU       ------------------------------------------------------------
RL11_METTP       ------------------------------------------------------------
RL11_THEVO       ------------------------------------------------------------
RL11_NITMS       ------------------------------------------------------------
RL11_HYPBU       ------------------------------------------------------------
RL11_SULAC       EG----------------------------------------------------------
RL11_DESA1       GQ----------------------------------------------------------
RL11_NANEQ       ------------------------------------------------------------
RL11_KORCO       ------------------------------------------------------------
RL11_AZOC5       ------------------------------------------------------------
RL11_JANSC       ------------------------------------------------------------
RL11_ERYLH       ------------------------------------------------------------
RL11_RICAE       ------------------------------------------------------------
RL11_LIBAS       ------------------------------------------------------------
RL11_BUCBP       ------------------------------------------------------------
RL11_WIGBR       ------------------------------------------------------------
RL11_BLOFL       ------------------------------------------------------------
RL11_COXBU       ------------------------------------------------------------
RL11_AZOPC       ------------------------------------------------------------
RL11_SULMW       ------------------------------------------------------------
RL11_AMOA5       ------------------------------------------------------------
RL11_AKKM8       ------------------------------------------------------------
RL11_PARUW       ------------------------------------------------------------
RL11_BRAHW       ------------------------------------------------------------
RL11_PHYMT       ------------------------------------------------------------
RL11_TREPA       ------------------------------------------------------------
RL11_CORA7       ------------------------------------------------------------
RL11_SALRD       ------------------------------------------------------------
RL11_RHOBA       ------------------------------------------------------------
RL11_RUBXD       ------------------------------------------------------------
RL11_LEPBJ       ------------------------------------------------------------
RL11_LEUMM       ------------------------------------------------------------
RL11B_BACCR      ------------------------------------------------------------
RL11B_BACHD      ------------------------------------------------------------
RK11_SPIOL       ------------------------------------------------------------
RK11_CYACA       ------------------------------------------------------------
RL11_SULDN       ------------------------------------------------------------
RL11_THETH       ------------------------------------------------------------
RL11_MYCMO       SDAAQLLAENKQSAEVEVIKEKDKGNKDE-------------------------------
RL11_MYCPU       EAEKELVDSKGKEVEVKLVGEEEQSESENN------------------------------
RL11_MYCPE       ------------------------------------------------------------
RM11_CAEEL       ADKK---AAKMLRTT---------------------------------------------
RM11_DROME       QEKR---EAKMLRTG---------------------------------------------
RM11_RAT         RQKLPKSDPNLLHSEVRD------------------------------------------
RM19_SCHPO       ------------------------------------------------------------
RM19_YEAST       ------------------------------------------------------------
RM11_RECAM       ------------------------------------------------------------
RL11_WOLPM       ------------------------------------------------------------
RL11_HALSA       ------------------------------------------------------------
RM11_DICDI       ------------------------------------------------------------
RM11_DICCI       ------------------------------------------------------------
RL12_DICDI       ------------------------------------------------------------
RL12_CHLRE       ------------------------------------------------------------
RL12_ENCCU       ------------------------------------------------------------
RL11_PYRAE       ------------------------------------------------------------
RM11_ACACA       FGNIYFIGATSLKYFIGFLKEVSLKSFGSNFFPIFFKIRSNLVSQPFVKLFLSVFNSQVK
                                                                             

RL11_METMP       --------------------------------------------------
RL11_METKA       --------------------------------------------------
RL11_ARCFU       --------------------------------------------------
RL11_METS3       --------------------------------------------------
RL11_METMJ       --------------------------------------------------
RL11_METBU       --------------------------------------------------
RL11_METTP       --------------------------------------------------
RL11_THEVO       --------------------------------------------------
RL11_NITMS       --------------------------------------------------
RL11_HYPBU       --------------------------------------------------
RL11_SULAC       --------------------------------------------------
RL11_DESA1       --------------------------------------------------
RL11_NANEQ       --------------------------------------------------
RL11_KORCO       --------------------------------------------------
RL11_AZOC5       --------------------------------------------------
RL11_JANSC       --------------------------------------------------
RL11_ERYLH       --------------------------------------------------
RL11_RICAE       --------------------------------------------------
RL11_LIBAS       --------------------------------------------------
RL11_BUCBP       --------------------------------------------------
RL11_WIGBR       --------------------------------------------------
RL11_BLOFL       --------------------------------------------------
RL11_COXBU       --------------------------------------------------
RL11_AZOPC       --------------------------------------------------
RL11_SULMW       --------------------------------------------------
RL11_AMOA5       --------------------------------------------------
RL11_AKKM8       --------------------------------------------------
RL11_PARUW       --------------------------------------------------
RL11_BRAHW       --------------------------------------------------
RL11_PHYMT       --------------------------------------------------
RL11_TREPA       --------------------------------------------------
RL11_CORA7       --------------------------------------------------
RL11_SALRD       --------------------------------------------------
RL11_RHOBA       --------------------------------------------------
RL11_RUBXD       --------------------------------------------------
RL11_LEPBJ       --------------------------------------------------
RL11_LEUMM       --------------------------------------------------
RL11B_BACCR      --------------------------------------------------
RL11B_BACHD      --------------------------------------------------
RK11_SPIOL       --------------------------------------------------
RK11_CYACA       --------------------------------------------------
RL11_SULDN       --------------------------------------------------
RL11_THETH       --------------------------------------------------
RL11_MYCMO       --------------------------------------------------
RL11_MYCPU       --------------------------------------------------
RL11_MYCPE       --------------------------------------------------
RM11_CAEEL       --------------------------------------------------
RM11_DROME       --------------------------------------------------
RM11_RAT         --------------------------------------------------
RM19_SCHPO       --------------------------------------------------
RM19_YEAST       --------------------------------------------------
RM11_RECAM       --------------------------------------------------
RL11_WOLPM       --------------------------------------------------
RL11_HALSA       --------------------------------------------------
RM11_DICDI       --------------------------------------------------
RM11_DICCI       --------------------------------------------------
RL12_DICDI       --------------------------------------------------
RL12_CHLRE       --------------------------------------------------
RL12_ENCCU       --------------------------------------------------
RL11_PYRAE       --------------------------------------------------
RM11_ACACA       LINFYALRVIYTIFIKIFKNLNFLNKKLTFLLNRNNSNSNANISSNIKES