CLUSTAL format seed alignment for MF_00737

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

HUTG_STAAM      ----MYKQGEPNLWTGRLDSETDPKKFRHFQTVTFEDLSKLEKSSMPSG--VGILGYAVD
HUTG_STAAW      ----MYKQGEPNLWTGRLDSETDPKKFRHFQTVTFEDLSKLEKSSMPSG--VGILGYAVD
HUTG_STAES      ----MYQLAQSNLWTGRLDSETDPTQFRHFQTVKFGDLSQLDFSDEHKG--VGLLGYAID
HUTG_STRP8      -MLEDYYPSTTSYYHGGID--DDLYTAKWGMVMTFLDLNDSSLTPFEGT-HFALIGFKSD
HUTG_STRP1      -MLEDYYPSTTSYYHGGID--DDLYTAKWGMVMTFLDLNDSSLTPFEGT-HFALIGFKSD
HUTG_STRP3      -MLEDYYPSTTSYYHSGID--DDLYTAKWGMVMTFLDLNDSSLTPFEGT-HFALIGFKSD
HUTG_CLOTE      MLGINYKPCNEDFWQGRTDSEENFLAFRWHQWIKPINLNKDDLSPFTGKLGFAFIGFCCD
HUTG_FUSNN      -----------MEWNGRVDG-YDEDILRIHQVIQVKNLDELMENDYTGK-KVCFVSYNSN
HUTG_BORBR      MSVAN---DSASIWTARDDSGERGDTRRLAHIVALGQDA----GA----GDAAVLGFACD
HUTG_RALSO      -MHTE---ADPTVWQGRVDAEEGALGQRWHQVVRSADAA----SPLN--GAVALAGFACD
HUTG_PSEAE      -MYPA---PDMSLWQGRIDSQEGADARRWHQWMRPYADD----AE----AASVLLGFASD
HUTG_VIBVU      -MSKHFFLHNEFHWQGRHDAEDGAAGSRVHHVVQQIDYT----HIGENPYGVALLGFACD
HUTG_VIBVY      -MSKHFFLHNEFHWQGRHDAEDGAAGSRVHHVVQQIDYT----HIGENPYGVALLGFACD
HUTG_VIBPA      -MSQSDLHQQKFHWQGRHDAEDGKLGQRIHHVVKHQKTS----ELEKASQGVSILGFATD
HUTG_VIBCH      -MNPN--FTTEHTWQGRHDPEDGQAGRRVHHIACPIQVG----ELANQEPGVALIGFECD
HUTG_SALTI      --MTQWYPASPALWQGRDDSIEAPDARRLFQTVTRSEAF----FPENWQQKIALMGFACD
HUTG_SALTY      --MTQWYPASPALWQGRDDSIEAPDARRLFQTVTRSETF----SPENWQQKIALMGFACD
HUTG_PHOLL      --MNLWHATSPTIWQGRNDLAEADNALRLFQTVKLSPYF----TPEEFSHYVALLGFECD
HUTG_CHRVO      -------MVDMKIWTGRVDAAEGEAAKRWHQAVQA--------MPENGAPGIAIIGFACD
HUTG_COREF      MENETFGTELPDTWVGRIDGDNPEHALWYTTVSPLPE-------PDEVEEGVVTLGFASD
HUTG_BACHD      -------MKGYPFLDKANAPFVDRHVTKAGEIFYPWD-------GKR-IDGFGLIGAPLS
HUTG_BACSU      -------MDKYPFLREAGSSFKDRDVTKMSDLIATWD-------GQD-IKGPALIGVPLS
HUTG_HALSA      ------MFQNATDWTPTSTDPRDEQFGGVVEPVPT-P-------SDADDYDAVLVGEPYD
                                                                       .   .

HUTG_STAAM      KGVALNKGRIGAKEGPDAIKQAFAGLP-DLNQCET------LVDYGNVYHDHEELIDTQK
HUTG_STAAW      KGVALNKGRIGAKEGPDAIKQAFAGLP-DLNQCET------LVDYGNVYHDHEELIDTQK
HUTG_STAES      KGVELNKGRVGAKEGPNAIKRAFAGLP-DLNQCEE------IIDYGNVEHNHELLIDTQR
HUTG_STRP8      KGVYINNGRVGAVESPAAIRTQLAKFPWHLGNQVM------VYDVGNIDGPNRSLEQLQN
HUTG_STRP1      KGVYINNGRVGAVESPAAIRTQLAKFPWHLGNQVM------VYDVGNIDGPNRSLEQLQN
HUTG_STRP3      KGVYINNGRVGAVESPAAIRTQLAKFPWHLGNQVM------VYDVGNIDGPNRSLEQLQN
HUTG_CLOTE      EGIRRNKGRTGAAKGPETIREEMANLPCCFTDEVK------LFDAGNILVENISLEEGQD
HUTG_FUSNN      EGIRRNNGRLGAADGWKHLKTALSNFPIFDTDIKF------YDLKDPVDVKAGKLEEAQQ
HUTG_BORBR      AGVARNQGRRGAALAPRAIRRMMAGLPAHNLRR--------LVDAGDVVCEDDQLEAAQD
HUTG_RALSO      AGIARNHGRVGAQAGPAAIRRMLANLPARPGRA--------IVDAGDVTCRGDALEAAQD
HUTG_PSEAE      EGVRRNQGRQGARHGPPALRRALANLAWHGEQA--------IYDAGDIVA-GDDLEAAQE
HUTG_VIBVU      AGVARNKGRIGAKKSPDLIRRALANLAWHSPHP--------LYDLGTVVCDDDLLESSQQ
HUTG_VIBVY      AGVARNKGRIGAKKSPDLIRRALANLAWHSPHP--------LYDLGTVVCDDDLLESSQQ
HUTG_VIBPA      AGVARNKGRIGAKKAPDLIRRALANLAWHKDAP--------LYDLGTVVCDDDLLEESQS
HUTG_VIBCH      AGVERNKGRTGAKHAPSLIKQALANLAWHHPIP--------IYDLGNIRCEGDELEQAQQ
HUTG_SALTI      EGVKRNSGRPGAAGGPDALRKALANMASHQGHER-------LVDLGNWVAPTPDLEGAQQ
HUTG_SALTY      EGVKRNAGRPGAAGAPDALRKALANMASHQGHER-------LVDLGNWVAPTPDLEGAQQ
HUTG_PHOLL      EGVKRNQGRPGANQGPDYLRQSLANMASHKGHDK-------LVDLGSIRANPNQLSEAQQ
HUTG_CHRVO      EGVRRNQGRVGAAGGPKTLRKALANLAYHPTLP--------LYDAGDVACADGDLAAAQQ
HUTG_COREF      EGNLRNHGTAGAALGPDAIRGVLGLVAVHDARP--------RYDAGTIRV-GGDLERGHD
HUTG_BACHD      KS---SISHSGASFAPTVIRKCLHAFSTYSVEEDLDLAQLKLTDLGDITMHVTDIVGSQA
HUTG_BACSU      KS---SISHSGASFAPGTIRQALKHSSAYSAELGEHVVSELLYDLGDIDIHVTDIVKSHH
HUTG_HALSA      GAV---IGRRGARDGPSAIRESLAGVKTHHFDAGA---VSGVADLGDVVLPDGDVADTQA
                 .     .  **  .   ::  :                      .        :   : 

HUTG_STAAM      EFAMLAAKSIANH--RQTFLLGGGHDIAYAQYLATRKVYPTQS------IGVINIDAHFD
HUTG_STAAW      EFAMLAAKSIANH--RQTFLLGGGHDIAYAQYLATRKVYPTQS------IGVINIDAHFD
HUTG_STAES      EFADLAAKSIKRH--KQTFLLGGGHDIAYAQYLATRKVYPESS------IGVINIDAHFD
HUTG_STRP8      SLSKAIKRMCDLN--LKPIVLGGGHETAYGHYLGLRQSLSPSD-----DLAVINMDAHFD
HUTG_STRP1      SLSKAIKRMCDLN--LKPIVLGGGHETAYGHYLGLRQSLSPSD-----DLAVINMDAHFD
HUTG_STRP3      SLSKAIKRMCDLN--LKPIVLGGGHETAYGHYLGLRQSLSSSD-----DLAVINMDAHFD
HUTG_CLOTE      LLSKAINKILSLN--LFPIVLGGGHEVAFGNYLGVLSHLKTINSK--PNIGIINFDAHLD
HUTG_FUSNN      ELAEVVAKLKSKD--YFVVCMGGGHDIAYGTYNGILSYAKTQTKD--PKVGIISFDAHFD
HUTG_BORBR      ALAGRVAALLQAG--AHPVVLGGGHEIAWGSFQGLRRWLDARGDRE-P-VLVLNLDAHFD
HUTG_RALSO      ALSGVLHGLLDRG--AFPIALGGGHELAWASFGGLARHLAARSAQP-PRIGILNLDAHFD
HUTG_PSEAE      CYAQRVADLLACG--HRVVGLGGGHEIAYASFAGLARHL-SRHERL-PRIGILNFDAHFD
HUTG_VIBVU      HCAKMIAEVLPS---VPVITLGGGHEVAWASFSGLARYFEQHHPEKAPKIGIINFDAHFD
HUTG_VIBVY      HCAKIIAEVLPC---VPVITLGGGHEVAWASFSGLARYFEQHHPEKAPKIGIINFDAHFD
HUTG_VIBPA      RCANLISEALPH---TPTIVLGGGHEIAWASFSGLAEYFKTHHPEKKPKIGIINFDAHFD
HUTG_VIBCH      ECAQVIQQALPH---ARAIVLGGGHEIAWATFQGLAQHFLATGVKQ-PRIGIINFDAHFD
HUTG_SALTI      ALRDAVSRCLRAG--MRTLVMGGGHETAFGHGAGVLDAFAQE--S----VGIINLDAHLD
HUTG_SALTY      ALRDAVSRCLRAG--MRTLVLGGGHETAFGHGAGVLDAFAQE--S----VGIINLDAHLD
HUTG_PHOLL      ALSDAVTQCQCQN--VRTLVLGGGHETAFAHGVGIYDAFPHQ--R----VGIINFDAHLD
HUTG_CHRVO      RLGERVAQVIAAG--HLPLVLGGGHETAYGHWLGLSAAHPDK--R----IGVINFDAHFD
HUTG_COREF      ELSDAVETIARAG--HLPIVLGGGHEAGFGSHRGIYRARGSS-------PAIINLDAHLD
HUTG_BACHD      RIEETMTKLLENEQNWQPIVLGGDHSISFPSIKAFASAKGTI--------GVIQFDAHHD
HUTG_BACSU      HIFQTMHALLSDHPDWVPLILGGDNSISYSTIKAIAQTKGTT--------AVIQFDAHHD
HUTG_HALSA      AVREAAAEVHETA--ALPVFVGGDNSLSYANVAPLVAADNGA-------VGVVSVDAHLD
                                  . :**.:. .:                      ::..*** *

HUTG_STAAM      TRAEQQS------TSGTSFRQILEED-E---NTDYLVLGIAQGGNTQSLFDYAKE-KKID
HUTG_STAAW      TRAEQES------TSGTSFRQILEED-D---NTDYLVLGIAQGGNTQSLFDYAKE-KKID
HUTG_STAES      TRDEGYS------TSGTSFRQILEED-D---NADYLVLGISQGGNTQALFNYAKE-KDIQ
HUTG_STRP8      LRPYDQTG----PNSGTGFRQMFDDAVADKRLFKYFVLGIQEHNNNLFLFDFVAKSKGIQ
HUTG_STRP1      LRPYDQTG----PNSGTGFRQMFDDAVADKRLFKYFVLGIQEHNNNLFLFDFVAKSKGIQ
HUTG_STRP3      LRPYDQTG----PNSGTGFRQMFDDAVADKRLFKYFVLGIQEHNNNLFLFDFVAKSKGIQ
HUTG_CLOTE      IRPYTEGM----GSSGTMFRQISDICKKEDLNYSYLCMGVQKHSNTLELFKTADK-LGAN
HUTG_FUSNN      MREYNKG-----ANSGTMFYQIADDCKREGIKFDYNVIGIQRFSNTKRLFDRAKS-FGVT
HUTG_BORBR      LRTGR------PGSSGTPFDQIAEYCAARGHALQYACLGVSPLGNTPALYARAAE-VGAV
HUTG_RALSO      LRAGE------RGSSGTPFRQIAEDCARRGWPFRYACLGISAYANTEALFARARQ-LGVR
HUTG_PSEAE      LRHAE------RASSGTPFRQIAELCQASDWPFAYCCLGISRLSNTAALFDQAQR-LGVR
HUTG_VIBVU      LRAFSSSQADIKPSSGTPFNQIQHYCQQQGWDFHYACLGVSKASNTRALFERAEQ-LNVW
HUTG_VIBVY      LRAFSSSQADVKPSSGTPFNQIQHYCQQQGWDFHYACLGVSKASNTRALFERAEQ-LNVW
HUTG_VIBPA      LRAFESSLADVKPSSGTPFNQIHHFCQRNDWAFHYACLGVSRSSNTQALFQKADE-LNVW
HUTG_VIBCH      LRTFESELAPVRPSSGTPFNQIHHFCQQQGWDFHYACLGVSRASNTPALFERADK-LGVW
HUTG_SALTI      LRQTD------RATSGTPFRQLAQLCDAQSRAFHYACFGVSRAANTQALWREAQW-RNVT
HUTG_SALTY      LRQTD------RATSGTPFRQLAQLCDAQSRAFHYACFGVSRAANTQALWREAQW-RNVT
HUTG_PHOLL      LRRSP------QPTSGTPFRQLAEYCQQHQRLFHYTCIGASLASNTQALVDEANR-LNAT
HUTG_CHRVO      LRQAS------EATSGTPFAQIAADCARHGRVFRYLCLGVAETANTQALFDTARR-LGAE
HUTG_COREF      LRAAE------RPTNGTPFRQVRELV---GEEFRYSVLGVSVPNNTDFLFNAARE-FGTE
HUTG_BACHD      LRNLEDG----GPCNGTPFRSLLETGSLVG--EHLVQIGIRDFSNSYPYRKYAEKHGVKV
HUTG_BACSU      VRNTEDG----GPTNGTPFRRLLDEEIIEG--QHLIQLGIREFSNSQAYEAYAKKHNVNI
HUTG_HALSA      CRAVGDR----GPTSGTPYRQLFDAGL--D---ALAVVGARHFETTTTYAGFLRD-QGGR
                 *            .** :  :               .*     ..              

HUTG_STAAM      YVFADELLSHVSPTIKDMIERFVHEHDVIMFTICMDVIDSAFAPGVSAPAVLGLYPHTVL
HUTG_STAAW      YVFADELLNHVSPPIKDMIERFVHEHDVIMFTICMDVIDSAFAPGVSAPAVLGLYPHTVL
HUTG_STAES      FVYADELLHQVSPPIKDMIERFIHNHDTVMFTICMDVVDSAFAPGVSAPAVLGIYPHTVF
HUTG_STRP8      FLTGQDIYQMGHQKVCRAIDRFLEGQERVYLTIDMDCFSVGAAPGVSAIQSLGVDPNLAV
HUTG_STRP1      FLTGQDIYQMGHQKVCRAIDRFLEGQERVYLTIDMDCFSVGAAPGVSAIQSLGVDPNLAV
HUTG_STRP3      FLTGQDIYQMGHQKVCRAIDRFLEGQERVYLTIDMDCFSVGAAPGVSAIQSLGVDPNLAV
HUTG_CLOTE      YVFAKNITYGDNWIVFESLDDFMKAQDYIYVTVCSDVFSSAFAPGVSASQSLGLDPEIVV
HUTG_FUSNN      YYLAEDILKLSDLNIKPILER----NDYIHLTICTDVFHITCAPGVSAPQTFGIWPNQAI
HUTG_BORBR      WVEDRHMQEAHLGERLAQLDALLAAAGHVYLTIDLDVLPAATAPGVSAPAPYGVPLAVVE
HUTG_RALSO      WLRDDEMDLLHLPRVLQTVDAFLADVDHVYLTICLDVLPAGVAPGVSAPSARGVPMEVIE
HUTG_PSEAE      YLLDRQLQPWNLERSEAFLDGFLQSVDHLYLTVCLDVLPAAQAPGVSAPSAHGVEMPVVE
HUTG_VIBVU      FVEDKDLGSVNHDYHLTQLQHFIDDCDYLYLTIDLDVFPAATAPGVSAPAARGVSYDNLA
HUTG_VIBVY      FVEDKDLGSVNHDYHLTQLQHFIDDCDYLYLTIDLDVFPAATAPGVSAPAARGVSYDNLA
HUTG_VIBPA      YVEDSQLNYLNHSYHLTQLQHFIDDCDYLYLTIDLDVFPAATAPGVSAPAARGVSYDTIA
HUTG_VIBCH      YVEDKAFSPLSLKDHLTQLQHFIDDCDYLYLTIDLDVFPAASAPGVSAPAARGVSLEALA
HUTG_SALTI      VVEDLDCHDAL-----AQMTQFIDKVDKIYLTIDLDVLPVWEMPAVSAPAALGVPLIQVL
HUTG_SALTY      VVEDLDCHDAL-----AQMAQFIDKVDKIYLTIDLDVLPVWEMPAVSAPAALGVPLIQVL
HUTG_PHOLL      IIWDNQCRETMLDKVQQQIQDILQQVDLIYMTIDLDVLPAYQMPAVSAPAALGLPLERLL
HUTG_CHRVO      WRLDTDMNGWQLADIRGQLAEFLDSVDAVYLTIDLDVLPAAQMPAVSAPAGYGVDIAVVE
HUTG_COREF      VTTDDEINAMSPQEAADHALALVRDAEHIHLTVDIDVLSEALAPGTGSPAAVGVELGRIR
HUTG_BACHD      YTMKDVNARGLLTILDEAVAKLKRSVDVIYVSVDMDVLDQAHAPGCPAIGPGGMDSTTLL
HUTG_BACSU      HTMDMIREKGLIPTIKEILPVVQDKTDFIFISVDMDVLDQSHAPGCPAIGPGGLYTDELL
HUTG_HALSA      IVTSDAVAADRDGS-LDAAREALDGVDHVYVSVDIDVLDAAY-PGASAPTPGGIQPRELF
                                            : .::  * .     *.  :    *:      

HUTG_STAAM      ELAKRIIP-SDKVSSVSIAEMNPTYDADNRTAKLVANLVHHFLK-------------
HUTG_STAAW      ELAKRIIP-SDKVSSVSIAEMNPTYDADNRTAKLVANLVHHFLK-------------
HUTG_STAES      ELAKRVIP-SEKVKSISIAEMNPTYDSDQRTAKLVANLVHHCLI-------------
HUTG_STRP8      LVLQHIAA-SRKLVGFDVVEVSPPHDIDNHTANLAATFIFYLVQIMAQHS-------
HUTG_STRP1      LVLQHIAA-SGKLVGFDVVEVSPPHDIDNHTANLAATFIFYLVQIMAQHS-------
HUTG_STRP3      LVLQHIAA-SGKLVGFDVVEVSPPHDIDNHTANLAATFIFYLVQIMAQHN-------
HUTG_CLOTE      RFIKYILR-SNKVISFDIAEVSPRFDQGHVTANLAAVVIFSVIDTIAKIYGLGL---
HUTG_FUSNN      GLLNTIAK-TKKNLTLEVAEISPRYDYDDRTSRLIANLIYQVILKHFDCEIN-----
HUTG_BORBR      EVAMHVRA-SGKLRLADLAECNPAYDIDHRTARVAARLAWRLLGGAAR---------
HUTG_RALSO      PIVDRVAA-SGKLRLADVAELNPSLDIDHRTARVAARLVARVVDGVAPQGAAHG---
HUTG_PSEAE      HLVRRAKA-SGKLRLADIAELNPQLDSDQRTARIAARLVDSLVN-------------
HUTG_VIBVU      PFLDRILAHRDKLMLADIAEYNPTYDVDSQTARLAARLCWDIANAMNDKLEHQ----
HUTG_VIBVY      PFLDRILAHRDKLMLADIAEYNPTYDVDSQTARLAARLCWDIANAMNDKLEHQ----
HUTG_VIBPA      PFLERILHYKNKLMLADIAEYNPNYDVDSQTARLAARLCWDIANAMADKEHKRQPIK
HUTG_VIBCH      PYFDRILHYKNKLMIADIAEYNPSFDIDQHTARLAARLCWDIANAMAEQVQSIRHP-
HUTG_SALTI      RLIEPVCR-SGKLQAADLVEFNPRFDEDGAAARVAARLGWQIAHWWR----------
HUTG_SALTY      RLIEPVCR-SGKLQAADLVEFNPRFDEDGAAARVAARLGWQIAHWWR----------
HUTG_PHOLL      QLIQPICQ-SGKLQAADLVELNPLFDIQGIGGRAAARLAWQLAHWWY----------
HUTG_CHRVO      ALAGRIAK-SGKLAGADLVEFNPDYDIDSHGAKAAARLAWSLSRHLRR---------
HUTG_COREF      AICTGLAA-TGRLTLVDVVEVNPRLDHNNQTARVAARLIHEIAEAHLKAT-------
HUTG_BACHD      QGIFHLGK-DSLVQGMDIVEVDPTLDFREMTSRAAAHVILNYLKGKCIKSIG-----
HUTG_BACSU      EAVKYIAQ-QPNVAGIEIVEVDPTLDFRDMTSRAAAHVLLHALKGMKLSPFK-----
HUTG_HALSA      ALVEALAASDDRIRGFELVETAPTLDTGGRTVDAAARTIAHFLAGAQ----------
                                .:.*  *  *         *