CLUSTAL format seed alignment for MF_00739

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

URE3_BACSB       MKLTSREMEKLMIVVAADLARRRKERGLKLNYPEAVAMITYEVLEGARDGKTVAQLMQYG
URE3_GEOKA       MKLTPREQEKLLIVVAADLARRRKERGLKLNYPEAVALITYELLEGARDGRTVAELMQYG
URE3_COREF       MHLQPREQEKLMIVVAADLARRRQARGLQLNYPEAVAIISYELMEGARDGRSVAELMSWG
URE3_CORGL       MHITPREQEKLMIVVAADLARRRKDRGLKLNHPEAVALITYELIEGARDGRTVADLMSWG
URE3_ACTNA       MHLTPREQEKLLIVVAADLARRRKDRGIRLNHPEAVAYITAEILEGAREGRTVTDLMAYG
URE3_STAAB       MHFTQREQDKLMIVVAAEVARRRKARGLKLNHPEALALISDELLEGARDGKTVAELMSYG
URE3_STAAC       MHFTQREQDKLMIVVAAEVARRRKARGLKLNHPEALALISDELLEGARDGKTVAELMSYG
URE3_STAAM       MHFTQREQDKLMIVVAAEVARRRKARGLKLNHPEALALISDELLEGARDGKTVAELMSYG
URE3_STAAN       MHFTQREQDKLMIVVAAEVARRRKARGLKLNHPEALALISDELLEGARDGKTVAELMSYG
URE3_STAAR       MHFTQREQDKLMIVVAAEVARRRKARGLKLNHPEALALISDELLEGARDGKTVAELMSYG
URE3_STAAS       MHFTQREQDKLMIVVAAEVARRRKARGLKLNHPEALALISDELLEGARDGKTVAELMSYG
URE3_STAAW       MHFTQREQDKLMIVVAAEVARRRKARGLKLNHPEALALISDELLEGARDGKTVAELMSYG
URE3_STAEQ       MHFTQREQDKLMIVVAAEVARRRKARGLKLNHPEALALISDELLEGARDGKTVAELMSYG
URE3_STAES       MHFTQREQDKLMIVVAAEVARRRKARGLKLNHPEALALISDELLEGARDGKTVAELMSYG
URE3_STAS1       MHFTQREQDKLMLVIAADLARRRQQRGLKLNYPEAVAIISFELLEGARDGKTVAELMSYG
URE3_STAXY       MHFTQREQDKLMLVIAADLARRRQQRGLKLNYPEAVAIISFELLEGARDGKTVAELMSYG
URE3_BACC1       MRLTPREIDKLLVVVAADLAYRRKERGLKLNYPESIAIITYEILEGARDGKNVAELMELG
URE3_ACIAD       MELNPTEKDKMLIFTAGLVAERRKARGLKLNYPEAVAFISAALLEGARDGMSVAELMHYG
URE3_NITOC       MELTPREKDKMLIFTAGLVAERRRERGLKLNYPEAVAYISAAVLEKAREGMSVAELMHHG
URE3_PSE14       MDLTPREKDKLLIFTAGLVAERRLARGVKLNYPEAMAYISAALLEGARDGQTVAELMHYG
URE3_PSEU2       MDLTPREKDKLLIFTAGLVAERRLARGVKLNYPEAMAYISAALLEGARDGQTVAELMHYG
URE3_PSESM       MDLTPREKDKMLIFTAGLVAERRLARGVKLNYPEAMAYISAALLEGARDGQTVADLMHYG
URE3_PSEPF       MDLTPREKDKLLIFTAGLVAERRLARGVKLNYPEAMAYISAALLEGARDGQTVAELMHYG
URE3_PSEF5       MDLTPREKDKLLIFTAGLVAERRLARGLKLNYPETMAYISAALLEGARDGQTVAELMHYG
URE3_PSEAE       MDLSPREKDKLLIFTAGLLAERRLARGLKLNYPEAVALISAALLEGARDGRSVAELMHYG
URE3_NOSS1       MQLTPQEKDKLLIFTAALVAERRKNRGLKLNYPEAVAYISAAILEGARDGNTVSELMSYG
URE3_TRIV2       MQLTPQEKDKLLIFTAALVAERRKNRGLKLNYPEAVAYISAAILEGARDGNTVAELMSYG
URE3_THEVB       MQLSPQEKDKLLIFTAALVAERRKARGLKLNYPEAVAYISAAILEGAREGRTVADLMNYG
URE3_SYNY3       MQLSPQEKDKLLIFTASLVAERRKARGLKLNYPEAVAYISAAILEGARDGRTVAELMNYG
URE3_SYNPV       MHLSPQEKDKLLIVTAALLAERRLNRGLKLNHPEAVAWLSFLVLEGARDGKSVAELMQEG
URE3_PARMW       MHLSPQEKDKLLIVTAALLAERRLNRGLKLNHPEAVAWLGFLVLEGARDGKSVAELMQEG
URE3_PROMM       MHLSPQEKDKLLIVTAALLAERRLNRGLRLNHPEAVAWLSFLVIEGARDGQSVAELMAEG
URE3_PROMT       MYLSPQEKDKLLVVTAALLAERRLNRGLKLNHPEAVAWLSFQVLEGARDGKSVSTLMNEG
URE3_PROMP       MHLSPQEKDKLLIFSAAQLAERRLNRGLKLNYPETVAFLSFQVLEGARDGKSVSQLMSEG
URE3_PROS9       MHLSPQEKDKLLIFSAAQLAERRLNRGLKLNYPETVAFLSFQVLEGARDGKSVSQLMSEG
URE3_BLOFL       MKLLPREIDKLLLFTAALLAERRKKRGLKLNYPEAIALISFVVLEGARDGKNVAELMEIG
URE3_BLOPB       MKLLPREKDKLLLFTAALLAEKRRNRGLKLNYPEAIALISAVILEGAREGKSVAELMDVG
URE3_BORBR       MELTPREKDKLLIFTAALLAERRRARGLKLNYPETVALITAALMEGARDGKTVAELMSEG
URE3_BORPA       MELTPREKDKLLIFTAALLAERRRARGLKLNYPETVALITAALMEGARDGKTVAELMSEG
URE3_BORPE       MELTPREKDKLLIFTAALLAERRRARGLKLNYPETVALITAALMEGARDGKTVAELMSEG
URE3_BURMA       MKLTPREKDKLLIFTAALLAERRRARGLKLNYPETVAFITAALMEAARDGRTVAEVMHYG
URE3_BURP1       MKLTPREKDKLLIFTAALLAERRRARGLKLNYPETVAFITAALMEAARDGRTVAEVMHYG
URE3_BURPS       MKLTPREKDKLLIFTAALLAERRRARGLKLNYPETVAFITAALMEAARDGRTVAEVMHYG
URE3_BURTA       MKLTPREKDKLLIFTAALLAERRRARGLKLNYPETIAFITAALMEAARDGKTVAEVMHYG
URE3_BURL3       MKLTPREKDKLLIFTAALLAERRRARGLKLNYPEAVAFITAALMEAARDGKTVAEVMHYG
URE3_CUPPJ       MELTPREKDKLLIFTAALLAERRRARGLKLNYPEAVALITAAIMEGARDGRTVAELMHEG
URE3_CUPNH       MELTPREKDKLLIFTAALLAERRKARGLKLNYPEAVALITAAIMEGARDGRTVAELMHEG
URE3_RALSO       MELTPREKDKLLIFTAALLAERRQARGLKLNYPEAVALISAAIMEGARDGKTVADLMYYG
URE3_DECAR       MELTPREKDKLLIFTAGLLAERRQAKGLKLNYPEAVALITCAIMEGAREGKTVAELMHAG
URE3_PSET1       MELTPRDKDKLMLFTAGLLAERRKAKGLKLNYPEAIALITCAIMEGAREGRTVAEMMALG
URE3_NITMU       MDLTPREKDKLQIFTAGLLAERRKARGLRLNYPEAVALITCAILEGARDGNTVAELMSEG
URE3_KLEAE       MELTPREKDKLLLFTAALVAERRLARGLKLNYPESVALISAFIMEGARDGKSVASLMEEG
URE3_KLEPN       MELTPREKDKLLLFTAALVAERRLARGLKLNYPESVALISAFIMEGARDGKSVASLMEEG
URE3_ECO57       MELTPREKDKLLLFTAALLAERRLARGLKLNYPESVALISAFIMEGARDGKSVAALMEEG
URE3_PSEPK       MELTPREKDKLLLFTAALLAERRLARGLKLNYPEAVALISAAVLEGARDGRTVAELMSLG
URE3_PROMH       MELTPREKDKLLLFTAGLVAERRLAKGLKLNYPEAVALISCAIMEGAREGKTVAQLMSEG
URE3_PROHU       MELTPREKDKLLLFTAGLVAERRLAKGLKLNYPESVALISCAIMEGAREGKTVAQLMSEG
URE3_ECOLX       MELTPREKDKLLLFTAGLVAERRLARGLKLNYPEAVALISCAIMEGARDGKTVAQLMSEG
URE3_VIBPH       MELTPREKDKLLLFTAGLVAERRRARGLKLNYPEAIALISCEIMEGARDGRTVAELMSYG
URE3_ALIF1       MELTPREKDKLLLASAGMIAERRKARGLKLNYPEAVALICFEIMEGARDGRTVADLMNYG
URE3_ALKHC       MRLSPVEKEKLFLFMAGELAKQRMDRGLKLNYPEAVAILSCYVLEGAREGKSVSELMKDG
URE3_BACSU       MKLTPVEQEKLLIFAAGELAKQRKARGVLLNYPEAAAYITCFIMEGARDGKGVAELMEAG
URE3_SPOPA       MHLNPAEKEKLQIFLASELLLRRKARGLKLNYPEAVAIITSFIMEGARDGKTVAMLMEEG
URE3_HAEI8       MHLTSREQEKLMLFLAGELAAKRKARGVKLNYPETIAYIASHLQEAARDGMSVAEVMQYG
URE3_HAEIN       MHLTSREQEKLMLFLAGELAAKRKARGVKLNYPETIAYIASHLQEAAREGMSVAEVMQYG
URE3_ACTPL       MHLTSREQEKLMLFLAGELAAKRKARGVKLNYPEAIAYIASHLQEAARDGMSVAEVMQYG
URE3_HALMA       MKLTAKEQERLTVFTAAEVARRRKERGVPLNHPEAVAYISDWCIERGRDGQSVAEIRSGA
URE3_NATPD       MNLTPKERERLTIFMAAELARRRKERGVKLNHPETVAYISDWACERAREGMSVAEIRQEA
URE3_AGRFC       MNLSPREKDKLLISMAAMVARRRLERGVKLNYPEAIALISDFVVEGARDGRAVADLMEAG
URE3_RHILV       MNLTPREKDKLLISMAAMVARRRLERGVKLNYPEAIALISDFVVEGARDGRPVAELMEAG
URE31_BRUA2      MNLTPREKDKLLIAMAAMVARRRLERGVKLNHPEAIALVSDFVVEGARDGRTVAELMEAG
URE31_BRUAB      MNLTPREKDKLLIAMAAMVARRRLERGVKLNHPEAIALVSDFVVEGARDGRTVAELMEAG
URE31_BRUME      MNLTPREKDKLLIAMAAMVARRRLERGVKLNHPEAIALVSDFVVEGARDGRTVAELMEAG
URE31_BRUSU      MNLTPREKDKLLIAMAAMVARRRLERGVKLNHPEAIALVSDFVVEGARDGRTVAELMEAG
URE3_RHILO       MNLTPREKDKLLIAMAAIVARKRLERGVKLNHPEAIALITDFVVEGARDGRPVAELMEAG
URE3_RHIME       MNLTPREKDKLLISMAAMVARRRLERGVKLNHPEAIALITDFVVEGARDGRSVAELMEAG
URE3_RHOCA       MNLSPREKEKLLVSLAAMVARNRLARGVKLNHPEAIAIISDFVVEGAREGRSVADLMEAG
URE3_RHOPA       MNLSPREKDKLLVSMAAMVARRRLERGVKLNHPEAVALITDFIVEGARDGRSVAELMHAG
URE3_BRADU       MNLSPREKDKLLISMAAIVARRRLDRGVKLNHPEAIAIISDFILEGARDGRTVAELMQSG
URE3_CERS4       MNLTPREKDKLLISLAAIVARGRLERGVKLNHPEAVALISDFVVEGAREGRSVADLMQAG
URE3_RUEPO       MNLTPREKDKLLIAMAAEVARKRRARGVKLNHPEAIALISDAVVEGARDGRSVADLMQAG
URE3_UREPA       MNLSLREVQKLLITVAADVARRRLARGLKLNYSEAVALITDHVMEGARDGKLVADLMQSA
URE3_UREUR       MNLSLREIQKLLVTVAADVARRRLARGLKLNYSEAVALITDHVVEGARDGKLVADLMQSA
URE3_MYCBO       MRLTPHEQERLLLSYAAELARRRRARGLRLNHPEAIAVIADHILEGARDGRTVAELMASG
URE3_MYCTU       MRLTPHEQERLLLSYAAELARRRRARGLRLNHPEAIAVIADHILEGARDGRTVAELMASG
URE3_NOCFA       MRLSPHEQERLLLSYAAELARRRQARGLKLNHPEAVALITDHVLEGARDGRSVAELMASG
URE3_STRAW       MQLTPHEQERLLIHVAADVAEKRRARGLKLNHPEAVALITSHILEGARDGRTVAELMSSG
URE3_STRCO       MQLTPHEQERLLIHVAADVAEKRRARGVKLNHPEVVALITAHILEGARDGRSVGELMSSG
URE3_CLOPF       MYLTTKEKEKLMISVVAEIARKRQARGLKLNYPEAVAIITDAILEGARDGKLVKDLMSYG
URE3_STRT1       MQLTMREQEKMMISLAAMIAQRRKDKGIKLNHPEAVALITDYVLEGAREGKTVAQLMDEA
URE3_STRT2       MQLTMREQEKMMISLAAMIAQRRKDKGIKLNHPEAVALITDYVLEGAREGKTVAQLMDEA
URE3_STRTR       MQLTMREQEKMMISLAAMIAQRRKDKGIKLNHPEAVALITDYVLEGAREGKTVAQLMDEA
URE3_STRE5       MQLTMREQEKMMISLAAMIAQRRKDKGIKLNHPEAVALITDYVLEGAREGKTVAQLMDEA
URE3_LIMFE       MRLTKREQEKMMISLAGMIAEKRKDRGLKLNQPEAVALITSRLLEGARDGKTVGELMNEG
URE32_BRUAB      MHLTPREFDKLVIHMLSDVALKRKNKGLKLNHPEAVAVLSAYVLDGAREGKTVEEVMDGA
URE32_BRUSU      MHLTPREFDKLVIHMLSDVALKRKNKGLKLNHPEAVAVLSAYVLDGAREGKTVEEVMDGA
URE32_BRUA2      MHLTPREFDKLVIHMLSDVALKRKNKGLKLNHPEAVAVLSAYVLDGAREGKTVEEVMDGA
URE32_BRUME      MHLTPREFDKLVIHMLSDVALKRKNKGLKLNHPEAVAVLSAYVLDGAREGKTVEEVMDGA
URE3_YERBE       MQLTPREVEKLMIYTLSDVAFKRKARGLKLNYPEAVSIITVTAMEGARDGKSVEDVMKEA
URE3_YERFR       MQLTPREVEKLMIYTLSDVAFKRKARGLKLNYPEAVSIITVTAMEGARDGKSVEDVMKEA
URE3_YERIN       MQLTPREVEKLMIYTLSDVAFKRKARGLKLNYPEAVSIITVTAMEGARDGKSVEDVMKEA
URE3_YERKR       MQLTPREVEKLMIYTLSDVAFKRKARGLKLNYPEAVSIITVTAMEGARDGKSVEDVMKEA
URE3_YERMO       MQLTPREVEKLMIYTLSDVAFKRKARGLKLNYPEAVSIITVTAMEGARDGKSVEDVMKEA
URE3_YERPE       MQLTPREVEKLMIYTLSDVAFKRKARGLKLNYPEAVSIITVTAMEGARDGKSVEDVMKEA
URE3_YERPS       MQLTPREVEKLMIYTLSDVAFKRKARGLKLNYPEAVSIITVTAMEGARDGKSVEDVMKEA
URE3_YEREN       MQLTPREVEKLMIYTLSDVAFKRKARGLKLNYPEAVSIITETAMEGARDGKSVEDVMKEA
URE3_YERAL       MQLTPREVEKLMIYTLSDVAFKRKARGLKLNYPEAVSIITVTAMEGARDGKSVEDVMKEA
URE3_YERRO       MQLTPREVEKLMIYTLSDVAFKRKARGLKLNYPEAVSIITVTALEGARDGKSLEDVMKEA
URE3_PHOLL       MQLTPREIEKLMVYTLADVALKRKSRGLKLNYPEAVAIITAAALEGAREGKTLEEVMDDS
                 * :   : .:: :   . :   *  :*: ** .*  : :     : .*:*  :  :   .

URE3_BACSB       ATILTKEDVMEGVAEMIPDIQIEATFPDGTKLVTVHDPIR--------------------
URE3_GEOKA       ATILTRDDVMEGVADMIDEIQVEATFPDGTKLVTVHQPIRS-------------------
URE3_COREF       TTILNRDDVQEGIAEMIPEVQVEATFPDGTKLITVHTPIR--------------------
URE3_CORGL       STILTRDDVLEGIPEMIPDIQVEATFDDGTKLVTVHNPIR--------------------
URE3_ACTNA       TTLLTYDDVMEGVPEMIRAVQVEATFPDGTKLVSVHDPIRRRLP----------------
URE3_STAAB       RQILNKEDVMDGVEHMITDIEIEATFPDGTKLITVHHPIV--------------------
URE3_STAAC       RQILNKEDVMDGVEHMITDIEIEATFPDGTKLITVHHPIV--------------------
URE3_STAAM       RQILNKEDVMDGVEHMITDIEIEATFPDGTKLITVHHPIV--------------------
URE3_STAAN       RQILNKEDVMDGVEHMITDIEIEATFPDGTKLITVHHPIV--------------------
URE3_STAAR       RQILNKEDVMDGVEHMITDIEIEATFPDGTKLITVHHPIV--------------------
URE3_STAAS       RQILNKEDVMDGVEHMITDIEIEATFPDGTKLITVHHPIV--------------------
URE3_STAAW       RQILNKEDVMDGVEHMITDIEIEATFPDGTKLITVHHPIV--------------------
URE3_STAEQ       KTILNEEDVMDGVANMITELEIEATFPDGTKLITVHHPIV--------------------
URE3_STAES       KTILNEEDVMDGVANMITELEIEATFPDGTKLITVHHPIV--------------------
URE3_STAS1       KQILNEDDVMEGVADMLTEMEIEATFPDGTKLITVHHPIV--------------------
URE3_STAXY       KQILGEDDVMEGVADMLTEMEIEATFPDGTKLITVHHPIV--------------------
URE3_BACC1       KNILSAEDVMDGIADMISDIQVEATFPDGTKLVTIHQPIH--------------------
URE3_ACIAD       TTLLSKSDVMDGVAEMIAEVQVEATFPDGSKLVTVHQPIV--------------------
URE3_NITOC       TTLLTRDEVMEGVPEMISDIQVEATFPDGTKLVTVHHPIT--------------------
URE3_PSE14       TTLLSRDQVMEGIAEMIPEIQVEATFPDGTKLVTVHQPIA--------------------
URE3_PSEU2       TTLLSRDQVMEGIAEMIPEIQVEATFPDGTKLVTVHQPIA--------------------
URE3_PSESM       TTLLTRDQVMEGIPEMIPEIQVEATFPDGTKLVTVHQPIA--------------------
URE3_PSEPF       TTLLTREQVMEGIPEMIPEIQVEATFPDGTKLVTVHQPIV--------------------
URE3_PSEF5       TTLLSREQVMEGIPEMIPDIQVEATFPDGTKLVTVHQPIA--------------------
URE3_PSEAE       TTLLNREQVMEGVPEMIPDIQVEATFPDGTKLVTVHQPIA--------------------
URE3_NOSS1       TTLLTRDDVMEGIAEMVHEVQVEATFPDGTKLVTVHNPIR--------------------
URE3_TRIV2       TTLLTRDDVMEGIAEMVHEVQVEATFPDGTKLVTVHNPIR--------------------
URE3_THEVB       TTLLTRDDVMEGVPEMLTEVQVEATFPDGTKLVTVHTPIR--------------------
URE3_SYNY3       ATLLSRDEVMEGVPEMLPEVQVEATFPDGTKLVTVHEPIR--------------------
URE3_SYNPV       TTWLSRNQVMDGIPELVQEVQIEAVFPDGTKLVTLHDPIR--------------------
URE3_PARMW       TTWLRQDQVMEGVPELVHEVQIEAVFPDGTKLVTLHDPIR--------------------
URE3_PROMM       STWLRRDQVMDGVPELIPEVQIEAVFKDGTKLVTLHDPIR--------------------
URE3_PROMT       TTWLTKEQVMEGVPELIHEVQIEAVFPDGTKLVTLHNPIS--------------------
URE3_PROMP       TTWLSKKQVMDGISEMVDEVQVEAVFPDGTKLVTIHNPIN--------------------
URE3_PROS9       TTWLSKKQVMDGISEMVDEVQVEAVFPDGTKLVTIHNPIN--------------------
URE3_BLOFL       RNVLSKDDVIPGVSEMISNVQIEATFLDGTKLVTIHDPII--------------------
URE3_BLOPB       KNVLTRDDVMIGVPEMITNVQVEATFSDGTKLVTVHDPII--------------------
URE3_BORBR       TRILGRDEVMEGVPEMISNIQVEVTFPDGTKLITVHNPVV--------------------
URE3_BORPA       TRILGRDEVMEGVPEMISNIQVEVTFPDGTKLITVHNPVV--------------------
URE3_BORPE       TRILGRDEIMEGVPEMISNIQVEVTFPDGTKLITVHNPVV--------------------
URE3_BURMA       TTLLTRDDVMEGVPEMIPDIQVEATFPDGTKLVTVHHPIP--------------------
URE3_BURP1       TTLLTRDDVMEGVPEMIPDIQVEATFPDGTKLVTVHHPIP--------------------
URE3_BURPS       TTLLTRDDVMEGVPEMIPDIQVEATFPDGTKLVTVHHPIP--------------------
URE3_BURTA       TTLLTRDDVMEGVPEMIPDIQVEATFPDGTKLVTVHHPIP--------------------
URE3_BURL3       TTLLTRDDVMDGVPEMIPDIQVEATFPDGTKLVTVHHPIP--------------------
URE3_CUPPJ       TTVLSRDDVMDGVAEMIPEIQVEATFPDGTKLVTVHHPIV--------------------
URE3_CUPNH       TTVLGREDVMDGVAEMIPEIQVEATFPDGTKLVTVHHPIV--------------------
URE3_RALSO       TTILSRGDVMDGVAEMIPDIQVEATFPDGTKLVTVHQPIV--------------------
URE3_DECAR       TQILTRADVMDGIAELIPEIQVEATFPDGTKLVTVHNPIV--------------------
URE3_PSET1       REMLTRDDVMEGIAEMIQDVQVEATFPDGTKLVTVHNPIV--------------------
URE3_NITMU       RKVLTRADVMEGVPEMIPDIQVEATFPDGTKLVTVHNPIV--------------------
URE3_KLEAE       RHVLTREQVMEGVPEMIPDIQVEATFPDGSKLVTVHNPII--------------------
URE3_KLEPN       RHVLTRKQVMEGVPEMIPDIQVEATFPDGSKLVTVHNPII--------------------
URE3_ECO57       RHVLSREQVMEGIPEMIPDIQVEATFPDGSKLVTVHNPII--------------------
URE3_PSEPK       REVLTREQVMPGIAEMLHDVQVEATFPDGTKLVTVHDPIV--------------------
URE3_PROMH       RTVLTAEQVMEGVPEMIKDVQVECTFPDGTKLVSIHSPIV--------------------
URE3_PROHU       RAVLTAEQVMEGIPEMIKDIQVECTFPDGTKLVSIHDPIV--------------------
URE3_ECOLX       RTLLTAEQVMEGVPEMIKDIQVECTFPDGTKLVSIHDPIV--------------------
URE3_VIBPH       RTILTAEDVMEGVPEMITDIQVECTFPDGTKLVSIHDPIV--------------------
URE3_ALIF1       RTILTADDVMEGVPEMIPDVQVECTFPDGTKLVSIHEPIV--------------------
URE3_ALKHC       KHVLSTEDVMEGVPEMLEEIQVEATFPDGVKLVTIHEPIQ--------------------
URE3_BACSU       RHVLTEKDVMEGVPEMLDSIQVEATFPDGVKLVTVHQPISAEVKS---------------
URE3_SPOPA       KHVLTRDDVMEGVPEMIDDIQAEATFPDGTKLVTVHNPIS--------------------
URE3_HAEI8       ATLLTVDDVMEGVAEMVHEVQIEATFPDGTKLVTVHNPIR--------------------
URE3_HAEIN       ATLLTVDDVMEGVAEMVHEVQIEATFPDGTKLVTVHNPIR--------------------
URE3_ACTPL       ATLLTVDDVMGGIAEMVHEVQIEATFPDGTKLVTVHNPIR--------------------
URE3_HALMA       SKLLGREDVMDGVPEMIDMIQVEPVFPDGTKLVTVHDPIRSDSVGSADDETTESEAATDG
URE3_NATPD       TALLTREDVMDGVPELVDMVQVEPMFPDGTKLVTIHDPIRADTREQLEE-----------
URE3_AGRFC       AHVISRDQVMDGIADMIHDVQVEATFPDGTKLVTVHEPIR--------------------
URE3_RHILV       AHVIGRSQVMEGVAEMIHDVQVEATFPDGTKLVTVHEPIR--------------------
URE31_BRUA2      AHVITREQVMDGVAEMIRDIQVEATFPDGTKLVTVHEPIR--------------------
URE31_BRUAB      AHVITREQVMDGVAEMIRDIQVEATFPDGTKLVTVHEPIR--------------------
URE31_BRUME      AHVITREQVMDGVAEMIRDIQVEATFPDGTKLVTVHEPIR--------------------
URE31_BRUSU      AYVITREQVMDGVAEMIRDIQVEATFPDGTKLVTVHEPIR--------------------
URE3_RHILO       AHVVTRAQVMQGIAEMIHDVQVEATFPDGTKLVTVHAPIR--------------------
URE3_RHIME       AHVLTRDQVMEGIAEMIHDIQVEATFPDGTKLVTVHEPIR--------------------
URE3_RHOCA       AQVITRDQCMEGIAEMIHSIQVEATFPDGTKLVTVHHPIR--------------------
URE3_RHOPA       AQVITRDQCMDGIAEMIHDIQVEATFPDGTKLVTVHQPIR--------------------
URE3_BRADU       AQVLTRDQVMPGIPEMIHDIQVEATFPDGTKLVTVHEPIR--------------------
URE3_CERS4       AHVVRAENCMEGVPEMLHSVQVEATFPDGTKLVTVHHPIR--------------------
URE3_RUEPO       AEVIRAEDCMEGIAQMILEVQVEATFPDGTKLVTVHNPIR--------------------
URE3_UREPA       REVLRVDQVMEGVDTMVSIIQVEVTFPDGTKLVSVHDPIYK-------------------
URE3_UREUR       REVLRVDQVMEGVDTMVGIIQVEVTFPDGTKLVSVHSPIYK-------------------
URE3_MYCBO       REVLGRDDVMEGVPEMLAEVQVEATFPDGTKLVTVHQPIA--------------------
URE3_MYCTU       REVLGRDDVMEGVPEMLAEVQVEATFPDGTKLVTVHQPIA--------------------
URE3_NOCFA       RTVLTRDDVMTGVPEMIHDVQVEATFPDGTKLVTVHQPIA--------------------
URE3_STRAW       RKLLTRDDVMEGIPEMIHDVQVEATFPDGTKLVTVHDPIV--------------------
URE3_STRCO       RKLIQRDEVMEGIPEMIHDVQVEATFPDGTKLVTVHEPII--------------------
URE3_CLOPF       RTILKREDVMEGVPEMIEMVQVEATFLDGTKLVTVHNPIQ--------------------
URE3_STRT1       RNLLTREDVMEGIAEMIPMIQVEATFTDSTKLVTVHDPIQ--------------------
URE3_STRT2       RNLLTREDVMEGIAEMIPMIQVEATFTDSTKLVTVHDPIQ--------------------
URE3_STRTR       RNLLTREDVMEGIAEMIPMIQVEATFTDSTKLVTVHDPIQ--------------------
URE3_STRE5       RNLLTREDVMEGIAEMIPMIQVEATFTDSTKLVTVHDPIQ--------------------
URE3_LIMFE       ATWLTKDDVMEGIPEMIPMIQVEATFPDGTKLITVTDPIR--------------------
URE32_BRUAB      RSVLKADDVMDGVPDLLPLIQVEAVFSDGSRLVSLHNPIT--------------------
URE32_BRUSU      RSVLKADDVMDGVPDLLPLIQVEAVFSDGSRLVSLHNPIT--------------------
URE32_BRUA2      RSVLKADDVMDGVPDLLPLIQVEAVFSDGSRLVSLHNPIT--------------------
URE32_BRUME      RSVLKADDVMDGVPDLLPLIQVEAVFSDGSRLVSLHNPIT--------------------
URE3_YERBE       SKVLTKDDVMDGVADLIPNVQVEAIFTDGSRLVTVHDPIK--------------------
URE3_YERFR       SKVLTKDDVMDGVADLIPNVQVEAIFTDGSRLVTVHDPIK--------------------
URE3_YERIN       SKVLTKDDVMDGVADLIPNVQVEAIFTDGSRLVTVHDPIK--------------------
URE3_YERKR       SKVLTKDDVMDGVADLIPNVQVEAIFTDGSRLVTVHDPIK--------------------
URE3_YERMO       SKVLTKDDVMDGVADLIPNVQVEAIFTDGSRLVTVHDPIK--------------------
URE3_YERPE       SKVLTKDDVMDGVADLIPNVQVEAIFTDGSRLVTVHDPIK--------------------
URE3_YERPS       SKVLTKDDVMDGVADLIPNVQVEAIFTDGSRLVTVHDPIK--------------------
URE3_YEREN       SKVLTKDDVMDGVADLIPNVQVEAIFTDGSRLVTVHDPIK--------------------
URE3_YERAL       SQVLTKDDVMDGVADLIPNVQVEAIFTDGSRLVTVHDPIK--------------------
URE3_YERRO       SKVLTKDDVMEGVADLIPNVQVEAIFTDGSRLVTVHDPIK--------------------
URE3_PHOLL       RHVLTKEDVMDGVADLIPHVQVEAIFTDGSRLVTVHDPIQ--------------------
                    :   :   *:  ::  :: *  * *. :*:::  *:                     

URE3_BACSB       --------
URE3_GEOKA       --------
URE3_COREF       --------
URE3_CORGL       --------
URE3_ACTNA       --------
URE3_STAAB       --------
URE3_STAAC       --------
URE3_STAAM       --------
URE3_STAAN       --------
URE3_STAAR       --------
URE3_STAAS       --------
URE3_STAAW       --------
URE3_STAEQ       --------
URE3_STAES       --------
URE3_STAS1       --------
URE3_STAXY       --------
URE3_BACC1       --------
URE3_ACIAD       --------
URE3_NITOC       --------
URE3_PSE14       --------
URE3_PSEU2       --------
URE3_PSESM       --------
URE3_PSEPF       --------
URE3_PSEF5       --------
URE3_PSEAE       --------
URE3_NOSS1       --------
URE3_TRIV2       --------
URE3_THEVB       --------
URE3_SYNY3       --------
URE3_SYNPV       --------
URE3_PARMW       --------
URE3_PROMM       --------
URE3_PROMT       --------
URE3_PROMP       --------
URE3_PROS9       --------
URE3_BLOFL       --------
URE3_BLOPB       --------
URE3_BORBR       --------
URE3_BORPA       --------
URE3_BORPE       --------
URE3_BURMA       --------
URE3_BURP1       --------
URE3_BURPS       --------
URE3_BURTA       --------
URE3_BURL3       --------
URE3_CUPPJ       --------
URE3_CUPNH       --------
URE3_RALSO       --------
URE3_DECAR       --------
URE3_PSET1       --------
URE3_NITMU       --------
URE3_KLEAE       --------
URE3_KLEPN       --------
URE3_ECO57       --------
URE3_PSEPK       --------
URE3_PROMH       --------
URE3_PROHU       --------
URE3_ECOLX       --------
URE3_VIBPH       --------
URE3_ALIF1       --------
URE3_ALKHC       --------
URE3_BACSU       --------
URE3_SPOPA       --------
URE3_HAEI8       --------
URE3_HAEIN       --------
URE3_ACTPL       --------
URE3_HALMA       GDSAGTDE
URE3_NATPD       --------
URE3_AGRFC       --------
URE3_RHILV       --------
URE31_BRUA2      --------
URE31_BRUAB      --------
URE31_BRUME      --------
URE31_BRUSU      --------
URE3_RHILO       --------
URE3_RHIME       --------
URE3_RHOCA       --------
URE3_RHOPA       --------
URE3_BRADU       --------
URE3_CERS4       --------
URE3_RUEPO       --------
URE3_UREPA       --------
URE3_UREUR       --------
URE3_MYCBO       --------
URE3_MYCTU       --------
URE3_NOCFA       --------
URE3_STRAW       --------
URE3_STRCO       --------
URE3_CLOPF       --------
URE3_STRT1       --------
URE3_STRT2       --------
URE3_STRTR       --------
URE3_STRE5       --------
URE3_LIMFE       --------
URE32_BRUAB      --------
URE32_BRUSU      --------
URE32_BRUA2      --------
URE32_BRUME      --------
URE3_YERBE       --------
URE3_YERFR       --------
URE3_YERIN       --------
URE3_YERKR       --------
URE3_YERMO       --------
URE3_YERPE       --------
URE3_YERPS       --------
URE3_YEREN       --------
URE3_YERAL       --------
URE3_YERRO       --------
URE3_PHOLL       --------