CLUSTAL format seed alignment for MF_00740

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DEOB_BACAN      -----MNKYKRIFLVVMDSVGIGEAPDAEQFGDLG-----------SDTIGHIAEHMN--
DEOB_BACCR      -----MNKYKRIFLVVMDSVGIGEAPDAEQFGDLG-----------SDTIGHIAEHMN--
DEOB_GEOSE      ----MKPTCKRVFLIVMDSVGIGEAPDAEKYNDKG-----------ADTLGHIAEHRG--
DEOB_BACSU      ---MPAYKYNRVFLIVMDSVGIGEAPDAADFNDEG-----------AHTLGHIAEHMN--
DEOB_ALKHC      ---MDVKRFKRVFLIVMDSVGIGEAPDAKAFGDQG-----------AHTLGHIAERMN--
DEOB_OCEIH      -----MNNFKRVFLIVMDSVGIGEAPDARDFNDVG-----------ANTLGHIAENMN--
DEOB_LISIN      ----MPDKFKRVHVIVMDSVGIGEAPDAAKFGDFD-----------VDTFGHIAKHVG--
DEOB_LISMO      ----MPDKFKRVHVVVMDSVGIGEAPDAAKFGDFD-----------VDTFGHIAKHVG--
DEOB_LACLA      ----MPKKFGRIHLVVMDSVGIGAAPDADKFFNHDVETHEAINDVNSDTIGHISEIR---
DEOB_LACLM      ----MPKKFGRIHLVVMDSVGIGAAPDADKFFNHDVETHEAINDVKSDTIGHISEIR---
DEOB_STRA3      -----MSQFDRIHLVVLDSVGIGAAPDANDFVNAGVP------DGASDTLGHISKTV---
DEOB_STRA5      -----MSQFDRIHLVVLDSVGIGAAPDANDFVNAGVP------DGASDTLGHISKTV---
DEOB_STRPN      -----MSKFNRIHLVVLDSVGIGAAPDANNFVNAGVP------DGASDTLGHISKTV---
DEOB_STRR6      -----MSKFNRIHLVVLDSVGIGAAPDANNFVNAGVP------DGASDTLGHISKTV---
DEOB_STRMU      -----MSTFNRIHLVVLDSVGIGAAPDANNFSNAGVP------DGASDTLGHISKTV---
DEOB_STRTR      -----MSKFNRMHLIVLDSVGIGAAPDANNFVNAGVP------DGASDTLGHISKTV---
DEOB_STRP8      -----MSKFNRIHLVVLDSVGIGAAPDADKFFNAGVA------DTDSDTLGHISETA---
DEOB_STRP1      -----MSKFNRIHLVVLDSVGIGAAPDADKFFNAGVA------DTDSDTLGHISEAA---
DEOB_ENTFA      -------MFKRVHLIVLDSVGIGEAPDAEKFGDVG-----------SDTLGHIAKEA---
DEOB_STAAM      ----MTRPFNRVHLIVMDSVGIGEAPDAADFKDEG-----------SHTLRHTLEGF---
DEOB_STAES      ----MTTPFKRIHLIVMDSVGIGEGPDAAAFNDEG-----------SHTLKHTLEGF---
DEOB_CLOPE      -----MSKYKRIFTIVIDSLGIGAMNDSEKYGDVN-----------VDTLGHIAESVD--
DEOB_CLOTE      -----MKKYNRIFTIVVDSLGIGETEDSKEYGDIG-----------VDTLRHISESVE--
DEOB_CLOAB      -------MVERVILIVLDSVGAGEMPDADKYGDKG-----------SDTIGNISKAVG--
DEOB_THEMA      ---------MRVVLIVLDSVGIGEMPDAHLYGDEG-----------SNTIVNTAKAVS--
DEOB_CALS4      -------MLQRVILIVLDSVGVGELPDAYKFGDKG-----------TNTLGHVVEKT---
DEOB_DEIRA      ---------MQLTIIVLDSVGAGALPDAAAFGDAG-----------AHTLNHTLKQA---
DEOB_MYCPU      ----MVKKFKNVFMIVADSMGIGKDQKQESFGDNG-----------ANTFLHVWQNY---
DEOB_AGRFC      --------MARAFLLVLDSFGVGGAPDAERYGDLG-----------ANTLGHIAEFCAAG
DEOB_RHIME      --------MARAFLFVLDSFGIGNAPDAEAFGDLG-----------ADTLGHIAEFCAAG
DEOB_RHILO      --------MARAFLFVLDSFGIGGAADAERYGDAG-----------ANTLAHIAEACAEG
DEOB_BUCAI      --------MKRVFLIVLDSFGIGSSPDADKFNDVG-----------SNTFGHIVEKCFLG
DEOB_BUCAP      --------MKRVFLMILDSLGIGSSVDACKFNDSG-----------ADTLGHIAEKCFFN
DEOB_BUCBP      --------MKRAFLIVLDSFGIGATKDAHRFGDVG-----------ANTFGNIAKFCFLN
DEOB_ECOLI      --------MKRAFIMVLDSFGIGATEDAERFGDVG-----------ADTLGHIAEACAKG
DEOB_SALTY      --------MKRAFIMVLDSFGIGATEDADRFGDVG-----------SDTLGHIAEACAKG
DEOB_YERPE      --------MKRTFIMVLDSFGIGASADAKKFGDEG-----------ADTLGHIAEACARG
DEOB_VIBPA      --------MKRAFILVLDSFGIGATADAKEFGDVG-----------SDTLGHIADQCEKG
DEOB_VIBVU      --------MKRAFILVLDSFGIGATADAKEFGDVG-----------SDTLGHIADQCEQG
DEOB_VIBCH      --------MKRAFILVLDSFGIGATADAQAFGDVG-----------SDTLGHIADQCAQG
DEOB_SHEON      --------MKRTVIMMLDSFGVGAAGDAAKFGDVG-----------SDTFGHIAKACAEG
DEOB_HELPJ      -------MQKRVVILLLDSFGIGASEDAKDFGDLG-----------ANTLGNIAKACFNN
DEOB_HELPY      -------MQKRVVILLLDSFGIGASEDAKDFGDLG-----------ANTLGNIAKACFNN
                          .   .: **.* *   .   : : .            .*: :  .     

DEOB_BACAN      ----------GLHMPNMVKLGLGNIR----EMKGISKVE----KPLGYYTKMQEKSTGKD
DEOB_BACCR      ----------GLQMPNMVKLGLGNIR----EMKGISKVE----KPLGYYTKMQEKSTGKD
DEOB_GEOSE      ----------GLNMPNMAKLGLSNIR----EIEGIPKAE----KPLAYYTKMQEASAGKD
DEOB_BACSU      ----------GLHMPNMAKLGLGLIE----DIKGVEKTE----HPLAYYGKMQEASNGKD
DEOB_ALKHC      ----------GLHMPNMAALGLSHIR----PIQGIEKVD----KPKAHYGIMQEISSGKD
DEOB_OCEIH      ----------GLNMPTMASLGLSNIR----KIEGIEASA----QPRAHYTKMQEASNGKD
DEOB_LISIN      ----------GLKMPEMGKLGLSNIR----EIEGIEKAE----KPLAYYTKMQEASNGKD
DEOB_LISMO      ----------GLKMPEMGKLGLSNIR----EIEGIKKAE----KPLAYYTKMQEASNGKD
DEOB_LACLA      ----------GLDVPNLQKLGWGNIPRE-SPLKTVPKAD----KPAAYVTKLEEISKGKD
DEOB_LACLM      ----------GLDVPNLQKLGWGNIPRE-SPLKTIPAAQ----KPAAYVTKLEEISKGKD
DEOB_STRA3      ----------GLAVPNMAKIGLGNIPRP-QALKTVPAEE----NPSGYATKLQEVSLGKD
DEOB_STRA5      ----------GLAVPNMAKIGLGNIPRP-QALKTVPAEE----NPSGYATKLQEVSLGKD
DEOB_STRPN      ----------GLNVPNMAKIGLGNIPRE-TPLKTVAAES----NPTGYATKLEEVSLGKD
DEOB_STRR6      ----------GLNVPNMAKIGLGNIPRE-TPLKTVAAES----NPTGYATKLEEVSLGKD
DEOB_STRMU      ----------GLNVPNMAKIGLGNIPRD-TPLKTVPAEN----HPTGYVTKLEEVSLGKD
DEOB_STRTR      ----------GLNVPNMAKLGLGNIPRE-QPLKTVPAES----NPTGYATKLEEVSLGKD
DEOB_STRP8      ----------GLSVPNMVKIGLGNISRP-IPLKTVPTED----NPTGYVTKLEEVSLGKD
DEOB_STRP1      ----------GLSVPNMAKIGLGNISRP-IPLKTVPTED----NPTGYVTKLEEVSLGKD
DEOB_ENTFA      ----------GLTIPHLEKLGLGTIA----PLTGVKAVA----DHDGYATKLEEISVGKD
DEOB_STAAM      ----------DQTLPNLEKLGLGNID----KLPVVNAVE----QPEAYYTKLSEASVGKD
DEOB_STAES      ----------KQKLPHLEQLGLGNIA----PLPVVSKVT----HPGAFYTKLSEASVGKD
DEOB_CLOPE      ----------TFNIPNLQKMGIANLH----PIKHVAPVE----NPIGYQAKMAEASVGKD
DEOB_CLOTE      ----------SFNIPNLQKLGLANLH----SINHVEPVE----KPLAYFMKMKEASVGKD
DEOB_CLOAB      ----------GLKLPDMVKMGLGNISGI----KGVDKVQ----YPIGAFGKLKEMSKGKD
DEOB_THEMA      ----------GLHLPNMAKLGLGNLDDI----PGVEPVK----PAEGIYGKMMEKSPGKD
DEOB_CALS4      ----------GIKLPTMEKLGLGNIIPL----KTVAPNP----NAIGAYGKMAEKSAGKD
DEOB_DEIRA      ----------PVPLPHLARLGLGKLPTIDTSPETVPADA----EVTGAYGRMREVSPGKD
DEOB_MYCPU      ----------DLQIPNLKKLGIEALV----SLKDKNEDL----KPQAYVGKIFAKSNAKD
DEOB_AGRFC      AADRAGLRAGPLKLPNMCSLGLLEIARQASGDIPAGMEP--PERIFGLHGSASEISKGKD
DEOB_RHIME      AADRAGLREGPLHLPNMSALGLMHAARLATGRLPAGMAL--PERVYGIYGAASEVSRGKD
DEOB_RHILO      RADRERLRQGPLFVPHMASLGLGKAAETATGLGFAHFGT--DLIANAFHGAAQEVSSGKD
DEOB_BUCAI      EAN-VG-RKGVLCIPNLVKLGIINAAKESTGQYPLGFNY--SSNVIASYGFASEISSGKD
DEOB_BUCAP      EAN-VQ-RRGSLYIPNLIKLGIVKSYQSSTGKYLLGFNQKEDANIIASYGYASELSSGKD
DEOB_BUCBP      KAN-NYGRKGLLYIPHLLSLGLAKVAIASSGQDLLGIQD--TNNVIGSYAYSNEISSGKD
DEOB_ECOLI      EAD-NG-RKGPLNLPNLTRLGLAKAHEGSTGFIPAGMDG--NAEVIGAYAWAHEMSSGKD
DEOB_SALTY      EAD-NG-RKGPLNLPNLTRLGLVKAHEGSTGKIAAGMDG--NADVIGAYAWAHELSSGKD
DEOB_YERPE      EAN-VG-RSGPLTLPNLSRLGLGKAAEESTGTFPVGLDK--NADIIGAYGYASELSSGKD
DEOB_VIBPA      LAD-NDKRQGALRLPNLSKLGLAMAHKESTGRFAPGLDA--DAEIIGAYGHAAELSSGKD
DEOB_VIBVU      LAN-NDQRQGALRLPNLSKLGLAMAHKESTGRFAPGLDA--DAEIIGAYGHAAELSSGKD
DEOB_VIBCH      LAD-NAERKGALQLPNLSKLGLAMAHKESTGRFAPGLDE--RADIIGAYAHAAELSSGKD
DEOB_SHEON      KAD-TG-RKGPLALPNLARLGLAHAAMESTGAFAPGFAD--NVDLIGAYGHAQELSSGKD
DEOB_HELPJ      LAD-SNDRNGVLKLPNLEGLGLGLSALKAANELPLGFQL--KPNLIGAYAYAKELSSAKD
DEOB_HELPY      LAD-SNDRSGALKLPYLESLGLGLSALKAANELPLGFQS--QPNLIGAYAYAQELSSAKD
                             :* :  :*                         .        * .**

DEOB_BACAN      TMTGHWEIMGLYIDTPFQVFPE---GFPKELLDELEEKT-GRKIIG--NKPASGTEILDE
DEOB_BACCR      TMTGHWEIMGLYIDTPFQVFPE---GFPKELLDELEEKT-GRKIIG--NKPASGTEILDE
DEOB_GEOSE      TMTGHWELMGLRIDTPFQVFPD---GFPKELIDELEKQT-GRKVIG--NKPASGTAIIDE
DEOB_BACSU      TMTGHWEIMGLYIDKPFKVFPE---GFPDELLQELEKRS-GRKIIG--NKPASGTAILDE
DEOB_ALKHC      TMTGHWEIMGLHIREPFRVFPN---GFPEELLNEIRELT-GREILG--NKVASGTEIIKE
DEOB_OCEIH      TMTGHWEIMGLHIEKPFRTFPD---GFPDELIEELEQKT-GRKVIG--NKPASGTEILDE
DEOB_LISIN      TMTGHWEIMGLYIDTPFRVFPD---GFPDDLINQIEAKT-GRKVIG--NKPASGTEIMAE
DEOB_LISMO      TMTGHWEIMGLYIDTPFRVFPD---GFPDDLINQIEEKT-GRKVIG--NKPASGTEIMAE
DEOB_LACLA      TMTGHWEIMGLNIQTPFPTYPE---GYPEDLLEKIEEFS-GRKIIREANKPYSGTAVIED
DEOB_LACLM      TMTGHWEIMGLNIQTPFPTYPE---GYPEDLLEKIEEFS-GRKIIREANKPYSGTAVIED
DEOB_STRA3      TMTGHWEIMGLNITEPFDTFWN---GFPEDIITKIEDFS-GRKVIREANKPYSGTAVIDD
DEOB_STRA5      TMTGHWEIMGLNITEPFDTFWN---GFPEDIITKIEDFS-GRKVIREANKPYSGTAVIDD
DEOB_STRPN      TMTGHWEIMGLNITEPFDTFWN---GFPEEILTKIEEFS-GRKVIREANKPYSGTAVIYD
DEOB_STRR6      TMTGHWEIMGLNITEPFDTFWN---GFPEEILTKIEEFS-GRKVIRETNKPYSGTAVIYD
DEOB_STRMU      TMTGHWEIMGLNITEPFDTFWN---GFPEEIISKIEKFS-GRKVIREANKPYSGTAVIDD
DEOB_STRTR      TMTGHWEIMGLNITEPFDTFWN---GFPEEILTQIEEFS-GRKVIRESNRPYSGTAVIDD
DEOB_STRP8      TMTGHWEIMGLNITEPFDTFWN---GFPEEILTKIEEFS-GRKIIREANKPYSGTAVIDD
DEOB_STRP1      TMTGHWEIMGLNITEPFDTFWN---GFPEEILTKIEEFS-GRKIIREANKPYSGTAVIDD
DEOB_ENTFA      TMTGHWEIMGLNIKKPFRVFPN---GFPEELLKQIEDFS-GRKVV--CNKPYSGTAVIDD
DEOB_STAAM      TMTGHWEIMGLNIMQPFKVYPN---GFPEELIQQIEEMT-GRKVV--ANKPASGTQIIDE
DEOB_STAES      TMTGHWEIMGLNIMQPFKVYPN---GFPAELVKEIESMT-GRKVV--ANRPASGTQIIDE
DEOB_CLOPE      TMTGHWEMMGLHITKPFKTFTDT--GFPQELLDELTERT-GHKIVG--NKSASGTEILDE
DEOB_CLOTE      TMTGHWEMMGLKIEKPFQTFTDT--GFPQELLDELSKRT-GRSIVG--NKSASGTEILDE
DEOB_CLOAB      TVTGHWEMSGVILEEPLNTYPN---GFPKDIIDEFEKKI-GRKVIG--NKVASGTEIIKE
DEOB_THEMA      TTTGHWEIAGVILKKPFDLFPE---GFPKELIEEFERRT-GRKVIG--NKPASGTEIIKE
DEOB_CALS4      TTTGHWEIAGLIVEKPFPTYPE---GFPKEIIEEFEKRI-GRKVLG--NKPASGTEIIKE
DEOB_DEIRA      TSTGHWEFMGVQLEHPFQVFPD---GFPPEVMDRFDAAT-GRGHLC--NKPYSGTDVIRD
DEOB_MYCPU      TLAGHWEMMGIQTKVANPNFIEK--GFPDELIKELEKAFDGRKIIG--NENASGTEILKR
DEOB_AGRFC      TPSGHWEIAGTPVTFDWGYFPTEGDAFSPELVEAICRQADIPGILG--NCHASGTEIIAA
DEOB_RHIME      TPSGHWEIAGTPVTFDWGYFPAEGDAFPPELVEAICREGDVPGILG--NCHASGTDIIAR
DEOB_RHILO      TPSGHWEIAGLPVRFDWGYFPDTVPAFPADLTAAMIREGEVPGILG--NCHAPGTEIIER
DEOB_BUCAI      TTSGHWEIAGVPVLDDWYYFKEKQNSFPESLLEKIIIRSELTGFIG--NCHASGTDIISR
DEOB_BUCAP      TTSGHWEIAGAPFLKDWYYFKEKDNSFPSSLINKIITKLKLPGILG--NCHASGTEIIKI
DEOB_BUCBP      TSSGHWEIAGAPVLFDWDYFSSSLNSVPKYLIQDIVDQCNLSGFLG--NCHASGTDILDR
DEOB_ECOLI      TPSGHWEIAGVPVLFEWGYFSDHENSFPQELLDKLVERANLPGYLG--NCHSSGTVILDQ
DEOB_SALTY      TPSGHWEIAGVPVLFDWGYFSDHENSFPQELLDKLVKRANLPGYLG--NCHSSGTVILDQ
DEOB_YERPE      TPSGHWEIAGVPVLFDWGYFSDVENSFPQELLDKLVKRANLPGYLG--NCHSSGTVILDQ
DEOB_VIBPA      TPSGHWEIAGVPVLFDWGYFTDKANSFPKELTDRILERAGLDGFLG--NCHASGTQVLDD
DEOB_VIBVU      TPSGHWEIAGVPVLFEWGYFTDKANSFPKELTDRILARAGIDGFLG--NCHASGTQVLDD
DEOB_VIBCH      TPSGHWEIAGVPVLFEWGYFSDKQNSFPKELTDRILARAGLDGFLG--NCHASGTQVLDD
DEOB_SHEON      TPSGHWEMAGVPVLFEWGYFSEHQNSFPKELTDKILARAGLDGFLG--NCHASGTTILEE
DEOB_HELPJ      TISGHWEMMGAPVLFEWGYFKDKNDSFPKEILDEIMHKTKIKGYLG--NCHASGTEIIKD
DEOB_HELPY      TISGHWEMMGAPVLFEWGYFKDKTHSFPKEILDEIVRKTKIKGYLG--NCHASGTEIIKD
                * :****: *         :     . .  :   :         :   *   .** ::  

DEOB_BACAN      LGQEQMETGSLIVYTSADSVLQIAAHEE--VVPLDELYKICKIARELTLDEK-YMVGRVI
DEOB_BACCR      LGQEQMETGSLIVYTSADSVLQIAAHEE--VVPLDELYKICKIARELTLDEK-YMVGRVI
DEOB_GEOSE      LGPEHMETGALIVYTSADSVLQIAAHEE--VIPLEELYRICKIARELTLDEK-YMVGRVI
DEOB_BACSU      LGQEHMETGALIVYTSADSVLQIAAHEE--VVPLEELYRICETARELTLDPK-YMVGRII
DEOB_ALKHC      LGDEHVKTGALIVYTSADSVLQIAAHEE--VVPLEELYDICKKVRALTLDPK-YMVGRII
DEOB_OCEIH      LGQQHMDTGSLIVYTSADSVLQIAAHEE--IIPIDEQYRICEIARELTLDEK-YMVGRVI
DEOB_LISIN      LGEEHVKTGALIVYTSADSVLQIAAHED--VVPLEELYEICEFCREITLDDP-YMLGRII
DEOB_LISMO      LGEEHVKTGALIVYTSADSVLQIAAHED--VVPLEELYEICEFCRKITLDDP-YMLGRII
DEOB_LACLA      FGPRQLETGELIIYTSADPVLQIAAHED--VISREELYKICEYVRSITLEGSGIMIGRII
DEOB_LACLM      FGPRQLETGELIIYTSADPVLQIAAHED--VISREELYKICEYVRSITLEGSGIMIGRII
DEOB_STRA3      FGPRQMETGELIIYTSADPVLQIAAHED--IIPLEELYRICEYARSITMERP-ALLGRII
DEOB_STRA5      FGPRQMETGELIIYTSADPVLQIAAHED--IIPLEELYRICEYARSITMERP-ALLGRII
DEOB_STRPN      FGPRQMETGELIIYTSADPVLQIAAHED--IIPLDELYRICEYARSITLERP-ALLGRII
DEOB_STRR6      FGPRQMETGELIIYTSADPVLQIAAHED--IIPLDELYRICEYARSITLERP-ALLGRII
DEOB_STRMU      FGPRQMETGELIIYTSADPVLQIAAHED--VIPLDELYRICEYARSITLERP-ALLGRII
DEOB_STRTR      FGPRQMETGELIIYTSADPVLQIAAHED--IIPVEELYRICEFARSITLERP-ALLGRII
DEOB_STRP8      FGPRQMETGELIVYTSADPVLQIAAHED--IIPVEELYKICEYARSITLERP-ALLGRII
DEOB_STRP1      FGPRQMETGELIVYTSADPVLQIAAHED--IIPVEELYKICEYARSITLERP-ALLGRII
DEOB_ENTFA      YGEHQMKTGDLIVYTSADPVLQIAAHED--IIPLEELYKICQYVRDITKDEP-YMIGRII
DEOB_STAAM      WGEHQMKTGDLIVYTSADPVLQIAAHED--IIPLEELYDICEKVRELTKDPK-YLIGRII
DEOB_STAES      WGEHQMKTGDLIVYTSADPVLQIAAHED--VIPLEELYEICEKVRELTKDPK-YLIGRII
DEOB_CLOPE      LGEHQIATGDMIVYTSADSVLQICGQEE--TFGLEELYRCCEIARELTLKDE-WKVGRII
DEOB_CLOTE      LGEHQIKTGDMIVYTSADSVLQICGHEENEIFGLDELYRCCEIARDLTLKDE-WKVGRVI
DEOB_CLOAB      LGDEHIKTGCPIVYTSADSVFQVAAHEE--IIPLDELYKICKVAREMLVD-D-RTVGRVI
DEOB_THEMA      LGPIHEKTGALIVYTSADSVFQIAAKKE--IVPLEELYRYCEIARELLNEMG-YKVARVI
DEOB_CALS4      LGEEHIKTGYPIVYTSADSVFQIAAHEE--VIPLEELYRMCEIAREILKG-D-HAVGRVI
DEOB_DEIRA      YGEEHRRTGFPIVYTSADSVFQIAAHED--VVPLETLYEWCRAAREILQG-E-YAVARVI
DEOB_MYCPU      LAHREIENNEIIVYTSPDSTLQICGHEE--HMGLENLYRYAKAARQICSSKSIWNVARVI
DEOB_AGRFC      LGEEHIRSGKPICYTSSDSVFQIAAHET--HFGLDRLIALCETVRKLLDP---LNIGRVI
DEOB_RHIME      HGEEHMRSGKPICYTSSDSVFQIAAHEQ--TFGLERLLNLCEVVRRLVDD---YNIGRVI
DEOB_RHILO      FGEEHIRTGKPICYTSVDSVLQIAAHEV--HFGLDRLYEFCQVVRRLVDP---LRIGRVI
DEOB_BUCAI      LGEEHIQTKKPIVYTSSDSVFQIACHEE--FFGLSNLYKLCKTVRFILDRYN-YKVARVI
DEOB_BUCAP      LGEEHIKTGKPIFYTSCDSVFQIACHEI--KFGLSNLYKICENIREILDQNK-YQVARVI
DEOB_BUCBP      FGEIHISTKKPILYTSIDSVCQIACHES--IFGLKRLYNLCRSIRKIFDKRK-INIARII
DEOB_ECOLI      LGEEHMKTGKPIFYTSADSVFQIACHEE--TFGLDKLYELCEIAREELTNGG-YNIGRVI
DEOB_SALTY      LGEEHMKTGKPIFYTSADSVFQIACHEE--TFGLDKLYELCEIAREELTEGG-YNIGRVI
DEOB_YERPE      LGEEHMKTGKPIFYTSADSVFQIACHEE--TFGLDRLYELCEIAREELTDGG-YNIGRVI
DEOB_VIBPA      LGEEHMKTGQPIFYTSADSVFQIACHEE--TFGLDRLLELCQIAREELED---YNIGRVI
DEOB_VIBVU      LGEEHMKTGQPIFYTSADSVFQIACHEE--TFGLDRLLELCQIAREELAD---YNIGRVI
DEOB_VIBCH      LGEEHMRTGKPIFYTSADSVFQIACHEE--TFGLDRLLELCQIAREELAD---YNIGRVI
DEOB_SHEON      LGEEHMRSGKPIFYTSADSVFQIACHEG--TFGLENLYRLCEIAREELEP---YNIGRVI
DEOB_HELPJ      LGEKHLETLYPIFYTSADSVFQIAAHEE--RFGLDHLYALCEEAFQILEP---LKIARVI
DEOB_HELPY      LGEKHLETLYPIFYTSADSVFQIAAHEE--RFGLDNLYALCEEAFQILEP---LKIARVI
                 .  .  .   * *** *.. *:. ::    .  .     ..             :.*:*

DEOB_BACAN      ARPFVGEP-GNFTRTPNRHDYALKPFGRTVMNELKDS-DYDVIAIGKISDIYDGEGVTES
DEOB_BACCR      ARPFVGEP-GNFTRTPNRHDYALKPFGRTVMNELKDS-DYDVIAIGKISDIYDGEGVTES
DEOB_GEOSE      ARPFIGTP-GNFQRTANRHDYALKPFGRTVMNELQDA-GYDVIAIGKIADIYDNEGVTKT
DEOB_BACSU      ARPFVGEP-GQFKRTPNRHDYALKPFDRTVMNELKDC-GLDVISIGKISDIYDGEGITSS
DEOB_ALKHC      ARPFIGAD-GNWERTSNRHDYALKPFGRTVMNELKDA-GFDSIAIGKISDIYDGEGVTES
DEOB_OCEIH      ARPFIGEP-GAFERTSNRHDYALKPFGRTVMNELKDN-NYDVLALGKISDIYDGEGVTES
DEOB_LISIN      ARPFVGEP-GAFVRTPNRHDYALKPFKPTVMDALKDG-GKDVIAIGKISDIFDGEGVTES
DEOB_LISMO      ARPFVGEP-GAFVRTPNRHDYALKPFKPTVMDALKDG-GKDVIAIGKISDIFDGEGVTES
DEOB_LACLA      ARPYVGEA-GNFERTDGRRDYALSPFAETVLEKLYKA-GIDTYSVGKISDIFNTVGVKYD
DEOB_LACLM      ARPYVGEA-GNFERTDGRRDYALSPFAETVLEKLYKA-GIDTYSVGKISDIFNTVGVKYD
DEOB_STRA3      ARPYVGEP-GNFTRTANRHDYAVSPFEDTVLNKLDQA-GIDTYAVGKINDIFNGSGINHD
DEOB_STRA5      ARPYVGEP-GNFTRTANRHDYAVSPFEDTVLNKLDQA-GIDTYAVGKINDIFNGSGINHD
DEOB_STRPN      ARPYVGEP-GNFTRTANRRDLAVSPFFPTVLDKLNEA-GIDTYAVGKINDIFNGAGINHD
DEOB_STRR6      ARPYVGEP-GNFTRTANRRDLAVSPFSPTVLDKLNEA-GIDTYAVGKINDIFNGAGINHD
DEOB_STRMU      ARPYVGKP-RNFTRTANRHDYALSPFAPTVLNKLADA-GVSTYAVGKINDIFNGSGITND
DEOB_STRTR      ARPYVGEP-GNFTRTSNRRDLAISPFAPTVLDKLNEA-GIDTYSVGKISDIFNGEGINHD
DEOB_STRP8      ARPYVGEP-GNFTRTANRHDYAVSPFQDTVLNKLADA-GVPTYAVGKINDIFNGSGITND
DEOB_STRP1      ARPYVGDP-GNFTRTANRHDYAVSPFQDTVLNKLADA-GVPTYAVGKINDIFNGSGITND
DEOB_ENTFA      ARPYVGEP-GNFTRTSNRHDYALDPFGHTVLDSLKEN-GNDVIAVGKINDIFNGQGITEA
DEOB_STAAM      ARPYVGEP-GNFTRTSNRHDYALKPFGKTVLDHLKDG-GYDVIAIGKINDIYDGEGVTEA
DEOB_STAES      ARPYVGEP-GNFTRTSNRHDYALKPFGRTVMNSLKDS-GYDVIAIGKINDIYDGEGVTEA
DEOB_CLOPE      ARPYLGTKKGEFKRTSNRHDYALKPYGRTVLNELKDN-NFDVISVGKIKDIFDGEGITEG
DEOB_CLOTE      ARPYVGMKKGEFKRTSNRHDYALKPYGTTVLNTLKDN-GLDVISVGKIKDIFDGEGITES
DEOB_CLOAB      ARPFVGKN-SNYTRTSNRRDFALDPFNKTMLEYIKEN-KSNVMCVGKIEDIFNKKGVTEA
DEOB_THEMA      ARPFTGEW-PNYVRTPERKDFSLEPEGKTLLDVLTEN-GIPVYGVGKIADIFAGRGVTEN
DEOB_CALS4      ARPFIGSP-GNFVRTANRRDFSLKPFGPTVLDMLKEA-GYQVYAVGKIEDIFAGQGITDS
DEOB_DEIRA      ARPFRGEP-PFERANEHRRDFSLTP-PRTVLDALKEA-GKDVVGIGKIPDIYAGQGFTES
DEOB_MYCPU      ARPYVGQN-GSYTRTFNRHDYANKP-SETLLNSLQKA-KIQTIAVGKINDIFVGQAIDKV
DEOB_AGRFC      ARPFIGETVATFERTGNRRDFSVPPPEPTLLDRLVEA-GRKVHAIGKIGDIYAHQGVTRV
DEOB_RHIME      ARPFVGSDPGSFTRTGNRRDYSVLPPEPTVLDRLQEA-GRTVHAIGKIGDIFAHQGVTRL
DEOB_RHILO      ARPFVGETAATFQRTYNRHDYAVPPPEPTLLDRLTAR-GSRVIAVGKIGDIFAHRGISEV
DEOB_BUCAI      ARPFIGNDKLQFQRTGNRRDFSIKPFATTVIKKLIDEKQGQVIAIGKVSDIYGGIGISKN
DEOB_BUCAP      ARPFIGTNKSNFNRTGNRRDISMKPLSITFMEKLIQEKQGKVIAIGKISDIYAGVGISKN
DEOB_BUCBP      ARPFTGFKKEHFRRTGNRRDFSMEPHKITVMEKLIGEKKGRVIAIGKISDIYAGKGISCS
DEOB_ECOLI      ARPFIGDKAGNFQRTGNRHDLAVEPPAPTVLQKLVDEKHGQVVSVGKIADIYANCGITKK
DEOB_SALTY      ARPFIGDKAGNFQRTGNRHDLAVEPPAPTVLQKLVDEKQGHVVSVGKIADIYANCGITKK
DEOB_YERPE      ARPFIGDKPGHFQRTGNRHDLAVEPPAPTMLKKLVDEKGGEVVSIGKIADIYAQVGITQK
DEOB_VIBPA      ARPFIGPGKGQFERTGNRRDLSVEPPSATVLQKLVEEKQGNVVSIGKIADIYANCGITKK
DEOB_VIBVU      ARPFIGPGKGQFERTGNRRDLSVEPPSATVLQKLAEEKQGQVVSIGKIADIYANCGITKK
DEOB_VIBCH      ARPFVGPGKGQFARTGNRRDLSVEPPSATVLQKLVEEKQGRVVSIGKIADIYAYCGITDK
DEOB_SHEON      ARPFDGTGPSDFARTGNRKDYSLEPPAKTVLDKLKAA-GGEVVSVGKIADIYAYCGITKK
DEOB_HELPJ      ARPFIGTNRENFKRTANRKDYAIKPHKKLLFETFIEEKQGEVISIGKIADIYAHVGITQK
DEOB_HELPY      ARPFIGTNRESFKRTANRKDYAIKPHKKLLFETFIEEKRGEVISIGKIADIYAHVGITQK
                ***: *        .  *:* :  *    .:. :          :**: **:   ..   

DEOB_BACAN      LRT-KSNMDGMDKVVDTLNMD--FTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLP
DEOB_BACCR      LRT-KSNMDGMDKLVDTLNMD--FTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLP
DEOB_GEOSE      LRT-KSNMDGMDKLVNTLQMN--FTGLSFLNLVDFDALYGHRRDPKGYGDALEEFDARLP
DEOB_BACSU      RRT-VSNMDGMDKVIDTLGED--FTGLSFANLVDFDALFGHRRDPEGYGRALEEFDARLP
DEOB_ALKHC      IRT-ISNDDGMEKLVRSMDQS--FTGLSFINLVDFDAKYGHRRDPIGYGQALEQFDQQLA
DEOB_OCEIH      IRT-KDNNDGMVQLRKSMDKS--FTGLNFLNLVDFDAKYGHRRDPVGYGKALEEFDEQLP
DEOB_LISIN      IRT-KSNMDGMDQFIDVLDKD--FNGMSFLNLVDFDALFGHRRDPQGYADALVDFDGRLV
DEOB_LISMO      IRT-KSNMDGMDQFIAVLDKD--FNGMSFLNLVDFDALFGHRRDPQGYADALVDFDGRLV
DEOB_LACLA      MGHNHNDMDGVDRLLKAMTKAEFTEGFSFTNLVDFDAKYGHRRDVEGYGKAIEDFDGRLP
DEOB_LACLM      MGHNHNDMDGVDRLLKAMTKTEFTEGFSFTNLVDFDAKYGHRRDVEGYGKAIEDFDGRLP
DEOB_STRA3      MGHNKSNSHGIDTLIKTMGLSEFEKGFSFTNLVDFDALYGHRRDPHGYRDCLHEFDERLP
DEOB_STRA5      MGHNKSNSHGIDTLIKTMGLSEFEKGFSFTNLVDFDALYGHRRDPHGYRDCLHEFDERLP
DEOB_STRPN      MGHNKSNSHGIDTLLKTMGLAEFEKGFSFTNLVDFDALYGHRRNAHGYRDCLHEFDERLP
DEOB_STRR6      MGHNKSNSHGIDTLLKTMGLAEFEKGFSFTNLVDFDALYGHRRNAHGYRDCLHEFDERLP
DEOB_STRMU      MGHNKSNSHGVDTLIKTMGLSAFTKGFSFTNLVDFDALYGHRRNAHGYRDCLHEFDERLP
DEOB_STRTR      MGHNKSNNHGVDNLIKAMTSEDFKHGFSFTNLVDFDALYGHRRNPQGYRDCLHEFDERLP
DEOB_STRP8      MGHNKSNSHGIDTLIKTLQLPEFTKGFSFTNLVDFDANFGHRRDPEGYRDCLHEFDNRLP
DEOB_STRP1      MGHNKSNSHGIDTLIKTLQLPEFTKGFSFTNLVDFDANFGHRRDPEGYRDCLHEFDNRLP
DEOB_ENTFA      IRT-KSNMDGVDQLLTVMNKE--FTGLSFTNLVDFDALYGHRRDVKGYAKAIEDFDGRLP
DEOB_STAAM      VRT-KSNMDGMDQLMKIVKKD--FTGISFLNLVDFDALYGHRRDKPGYAQAIKDFDDRLP
DEOB_STAES      IRT-KNNMDGMDQLIEVVKKD--FEGISFLNLVDFDALYGHRRDKEGYAQAIKDFDLRLP
DEOB_CLOPE      NKS-KSSVHGMEQTLEIMDRD--FTGFCFVNLVDFDALWGHRRNPQGYAEELEKFDVNLG
DEOB_CLOTE      NAS-KSSVHGMEQTLEIMDKD--FKGVCFVNLVDFDALWGHRRNPIGYAEELEKFDVNLE
DEOB_CLOAB      VHI-KNNMDGVDKTLEYMKTD--KKGLIFTNLVDFDMLYGHRNDPKGYAKALEEFDGRIN
DEOB_THEMA      YKT-KDNNDGIDKTISLMKEKN-HDCLIFTNLVDFDTKYGHRNDPVSYAKALEEFDARLP
DEOB_CALS4      VHT-GNNDEGITATIEAMDAV--KKGIIFTNLVDFDMVYGHRNDVNGYAKALKHFDERLP
DEOB_DEIRA      IHT-DDNADGIRKTLERMKAG--VDGLIFTNLVDTDAKFGHRRDPAGYSNALAEFDRALP
DEOB_MYCPU      YPP-ASDVENMDVAIEIAKTKK-ENQFVFVNLVEFDSHYGHRRDVIGYGKNIDSFDKKLG
DEOB_AGRFC      IKA-NGNAALMDATLHAIDEAE-NGDLVFTNFVDFDMLYGHRRDVAGYAAALEAFDARIP
DEOB_RHIME      TKA-NGNMALFDASLEAIEEAE-DGALVFTNFVDFDMLYGHRRDVSGYAAALEAFDARLP
DEOB_RHILO      RKA-AGNMAMFDKALGAMDDAG-DGDLVFANFVDFDTEFGHRRDVAGYAAALEAFDRRLP
DEOB_BUCAI      IKS-TGLYELCSTTIHEMKKAL-NNTIVFTNLVDFDSNWGHRRDVSGYAKGLELFDSRLS
DEOB_BUCAP      IKS-TGLYELCHTTIHQMKSAK-NNTVIFTNFVDFDSVWGHRRDVSGYAKGLEFFDSKLS
DEOB_BUCBP      MYA-TGLVNLFNTTIQEIKNAK-NNTIVFVNFVDFDSLWGHRRDVSGYAKDLEWFDYNLP
DEOB_ECOLI      VKA-TGLDALFDATIKEMKEAG-DNTIVFTNFVDFDSSWGHRRDVAGYAAGLELFDRRLP
DEOB_SALTY      VKA-TGLDALFDATLKEMKEAG-DKTIVFTNFVDFDSSWGHRRDIAGYAAGLELFDRRLP
DEOB_YERPE      VKA-TGLDALFDATIEEMKKAG-DNTIVFTNFVDFDSSYGHRRDVAGYAAALELFDRRLP
DEOB_VIBPA      VKA-TGIPALFEATLEQIKEAG-DNTIVFTNFVDFDSAYGHRRDVAGYAAALEYFDGRIN
DEOB_VIBVU      VKA-TGIPALFEATLEQIKQAG-DNTIVFTNFVDFDSAYGHRRDVAGYAAALEYFDGRIH
DEOB_VIBCH      VKA-TGIPDLFEATLEQIKQAG-DNTIVFTNFVDFDSAYGHRRDVAGYAAALEYFDKRLP
DEOB_SHEON      VKA-NGLEALFDATLAEVKSAG-ENTIVFTNFVDFDSHYGHRRDVAGYAKGLEYFDARLP
DEOB_HELPJ      FKA-GSLMELCDVTLDQVKNAP-NNSLIFTNFVHFDSDYGHRRDVSGYANALEYFDARLK
DEOB_HELPY      FKA-GSLMELCDVTLEQVKNAK-NNSLIFTNFVHFDSDYGHRRDISGYANALEYFDARLK
                     .                    . * *:*. *  :***.:  .*   :  :*  : 

DEOB_BACAN      EVFEKLKEDDLLLITADHGNDPVHHGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIG
DEOB_BACCR      EVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIG
DEOB_GEOSE      EVFERLKEDDLLIITADHGNDPVHHGTDHTREYVPLLVYSPSMN-GGKQLPLRETFADVG
DEOB_BACSU      EVFEKMREDDLLIITADHGNDPIHHGTDHTREYVPILAYSKKHK-KAQMLPLADTFADIG
DEOB_ALKHC      DVVEKIGEEDVLIITADHGNDPVHHGTDHTREFVPLLVYTRGIK-EGKDLGLRKTFADVG
DEOB_OCEIH      EIIEQLHDDDLLIITADHGNDPIHHGTDHTREYVPLVVYHNQIK-QAKELPIRKTFADIG
DEOB_LISIN      EVMEKLTDDDLLIITADHGNDPTYTGTDHTREFVPLLVYSPRFKNGGSELELRQTFADLG
DEOB_LISMO      EVMEKLTDDDLLIITADHGNDPTYTGTDHTREFVPLLVYSPRFKNGGSELELRKTFADLG
DEOB_LACLA      EIIDVMKEDDLLMITADHGNDPSYVGTDHTREYIPLVIFSKSLKD--PKVLPVGHFADIS
DEOB_LACLM      EIIDAMKEDDLLMITADHGNDPSYVGTDHTREYIPLVIFSKSFKE--PKVLPVGHFADIS
DEOB_STRA3      EIISAMRDKDLLLITADHGNDPTYAGTDHTREYIPLLAYSPSFTG--NGLIPVGHFADIS
DEOB_STRA5      EIISAMRDKDLLLITADHGNDPTYAGTDHTREYIPLLAYSPSFTG--NGLIPVGHFADIS
DEOB_STRPN      EIIAAMRENDLLLITADHGNDPTYAGTDHTREYIPLLAYSPAFKG--NGLIPVGHFADIS
DEOB_STRR6      EIIAAMRENDLLLITADHGNDPTYAGTDHTREYIPLLAYSPAFKG--NGLIPVGHFADIS
DEOB_STRMU      EIIAAMKVDDLLLITADHGNDPTYAGTDHTREYVPLLAYSPSFTG--NGVLPVGHYADIS
DEOB_STRTR      EIIAAMKEDDLLMITADHGNDPTYAGTDHTREYIPFLAYSPSFKS--SGLIPVGHFADIS
DEOB_STRP8      EIIANMKEDDLLLITADHGNDPTYAGTDHTREYIPLLAYSASFTG--NGLIPQGHFADIS
DEOB_STRP1      EIIANMKEDDLLLITADHGNDPTYAGTDHTREYIPLLAYSVSFTG--NGLIPQGHFADIS
DEOB_ENTFA      EIMAAMAEDDLLLITADHGNDPTFPGTDHTREYVPLLAYSKKMTK--QGSLPQGFYSDIS
DEOB_STAAM      ELFSNLKEDDLVIITADHGNDPTAPGTDHTREYIPVIMYSPKFKGG-HALESDTTFSSIG
DEOB_STAES      ELMNHLREDDLVIITADHGNDPIAKGTDHTREYIPLLMFSPKIKDY-HELSQDTTFSSIG
DEOB_CLOPE      KVLEKLHEDDLLIITADHGNDPTYTGTDHTREYVPFLAYSPSMKGH-GQLETPKTFATIG
DEOB_CLOTE      KLLNKLKEDDLLIITADHGNDPTYKGTDHTREYVPFLAYSPSMTGN-GLMETSNSFATIG
DEOB_CLOAB      EIKTNMKDYDVLMITADHGCDPTTESTDHSREYIPFIAYGKDIK-GGADIKIRDSFSDIG
DEOB_THEMA      EIMHNLNEDDVLFITADHGCDPTTPSTDHSREMVPLLGYGGRLK-KDVYVGIRETFADLG
DEOB_CALS4      EIMLRLKEEDLLIITADHGCDPTTPGTDHTREYVPLLVYSPSMK-EGRNLGLRKTYADVA
DEOB_DEIRA      DLIAALPEDGLLIILSDHGNDPTWHGTDHTREYGLLLAYGHGL--SARDLGERETFADVG
DEOB_MYCPU      ELLEVLSDDDLLIITADHGNDPTFPGSSHTREALPLIVYSKAFKNP-SYLKTLLGLGTSG
DEOB_AGRFC      EIHRKMAPGDIALLTADHGCDPTWRGTDHTRERVPIMAFGPGIRS--RDVGIRSSYADIG
DEOB_RHIME      DLDRRLKPGDMVILTADHGCDPTWRGTDHTRERVPVLMFGPTLRS--RSFGIADSFAHIG
DEOB_RHILO      EAFARLRQGDLLILTADHGNDPTWRGTDHTRERIPVIGMGPGLAG--GDIGLRTTFADIG
DEOB_BUCAI      EIISLVQKNDLLILTADHGCDPTWIGTDHTRENVPVLIYSPGIKK--NFLGHRKTFADIG
DEOB_BUCAP      EMIDLVKEGDLFILTADHGCDPTWKGTDHTRENVPILIYSPGEEI--KFLGHRDTFSDIG
DEOB_BUCBP      KLLKLVHNEDLLIITADHGCDPTWIGTDHTRENVPILIYQRSMES--KNFGYRETFSDIG
DEOB_ECOLI      ELMSLLRDDDILILTADHGCDPTWTGTDHTREHIPVLVYGPKVKP--GSLGHRETFADIG
DEOB_SALTY      ELMELVGEDDILILTADHGCDPSWTGTDHTREHIPVLIYGPKVKP--GSLGHRETFADIG
DEOB_YERPE      ELMALIKEDDILILTADHGCDPTWPGTDHTREHIPVLVYGPKVKP--GSLGHRETFADIG
DEOB_VIBPA      EVLELMGEDDVLILTADHGCDPTWPGTDHTREHIPVLVYGQKVPA--GSLGRRETFADIG
DEOB_VIBVU      EVMELMQEDDILILTADHGCDPTWPGTDHTREHIPVLVYGQKVPA--GSLGRRETFADIG
DEOB_VIBCH      EVLELMQEDDILILTADHGCDPTWPGTDHTREHIPVLVYGKKVAP--GSLGRRDTFADIG
DEOB_SHEON      EMLALLDEDDLLILTADHGCDPTWQGTDHTREYVPVLAYGAGLKA--GSLGRRNSFADIG
DEOB_HELPJ      EVLDNLRENDLLILCADHGCDPSFKGTDHTREYIPVLFYHKDLQP--AFLGKSETFADIG
DEOB_HELPY      EVLENLRENDLLILCADHGCDPSFKGTDHTREYIPVLFYHKDLQP--AFLGKSESFADIG
                .    :   .: :: :*** **   .:.*:**   .:                   .  .

DEOB_BACAN      ATVAENFGVKMPE--YGTSFLNELKK----
DEOB_BACCR      ATVAENFGVKMPE--YGTSFLNELKK----
DEOB_GEOSE      ATIAENFGVKMPK--YGTSFLQELK-----
DEOB_BACSU      ATIADNFQTNKPK--YGKSFLSLLQ-----
DEOB_ALKHC      ATIADNFQVEAPS--IGTSFLHEL------
DEOB_OCEIH      ATIADNFGIKLPE--HGESFLNDIK-----
DEOB_LISIN      ATVADNFDVKMPE--YGKSFLKDLK-----
DEOB_LISMO      ATVADNFDVKMPE--YGTSFLRDLK-----
DEOB_LACLA      ATVAENFSVKKAQ--TGESFLDALV-----
DEOB_LACLM      ATIAENFSVKKAQ--TGESFLDALV-----
DEOB_STRA3      ATVADNFGVDTAM--IGESFLQDLV-----
DEOB_STRA5      ATVADNFGVDTAM--IGESFLQDLV-----
DEOB_STRPN      ATVADNFGVETAM--IGESFLDKLV-----
DEOB_STRR6      ATVADNFGVETAM--IGESFLDKLV-----
DEOB_STRMU      ATIADNFGVDTAM--IGESFLDKLI-----
DEOB_STRTR      ATIADNFGVEKAM--IGESFLDKLV-----
DEOB_STRP8      ATVAENFGVDAAM--IGESFLGHLK-----
DEOB_STRP1      ATVAENFGVDTAM--IGESFLSHLK-----
DEOB_ENTFA      ATIAENFEVPATE--NGQSFLNQLQ-----
DEOB_STAAM      ATIADNFNVTLPE--FGKSYLKELK-----
DEOB_STAES      VTIADNFNVELPK--YGKSYLKEMGVEHQ-
DEOB_CLOPE      ATIADNFGLKMPEGTIGESVLNKLV-----
DEOB_CLOTE      ATIAENFEIDMPKNTIGQSVLEKLL-----
DEOB_CLOAB      KTILDLLQVENNL--VGKSF-KDIIMK---
DEOB_THEMA      QTIADIFGVPPLE--NGTSF-KNLIWE---
DEOB_CALS4      ATIAEIFNVGPIH--TGTSFLRELPLKVGV
DEOB_DEIRA      ATVAEALGAQWDG--PGTSFWNELR-----
DEOB_MYCPU      NIVARNFGLKTIE--TGEDIWDKLK-----
DEOB_AGRFC      ESIAHHLGIEAGS--HGRSFI---------
DEOB_RHIME      ETVARHLGIGVGP--HGRSLI---------
DEOB_RHILO      ETVAEHLGLAPGR--HGTSFHAMIGGHA--
DEOB_BUCAI      QTIAKYFLLTDMS--YGQNML---------
DEOB_BUCAP      QTIAKYFSLSDMK--YGKSMF---------
DEOB_BUCBP      QTLAKYFNLSTMS--YGTSIF---------
DEOB_ECOLI      QTLAKYFGTSDME--YGKAMF---------
DEOB_SALTY      QTLATYFGTSPMD--YGKNML---------
DEOB_YERPE      QTVAAYFGLSPMD--YGKNML---------
DEOB_VIBPA      QTLASYFGTSPMD--YGKNFL---------
DEOB_VIBVU      QTLASYFGTSPMD--YGKNFL---------
DEOB_VIBCH      QTLASYFGTSPMD--YGKNFL---------
DEOB_SHEON      QSIASYFKLEPME--YGESFI---------
DEOB_HELPJ      QSIAYFLGLSPLD--YGKNLLNFKGQP---
DEOB_HELPY      QSIAHFLGLSPLD--YGKNLLNFKGQP---
                  :   :         *