CLUSTAL format seed alignment for MF_00741

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PUR5_RHOBA        -----------------------------MASTYKDAGVDLDVYAESMSRLPRLMHRTFS
PUR5_LEPIN        ---------------------------MEEKITYKNAGVDTEKGREFIQKIKRNVESTHG
PUR5_ACTSZ        -----------MS-KQS--------------LSYKDAGVDINAGNELVERIKPHVKRTTR
PUR5_MANSM        -----------MS-KQS--------------LSYKDAGVDINAGNALVDRIKPHVKRTTR
PUR5_HISS2        -----------MS-KQS--------------LSYKDAGVDINAGNTLVERIKSDVKRTTR
PUR5_PASMU        -----------MS-KQS--------------LSYKDAGVDINAGNALVEKIKADVKRTTR
PUR5_ACTP2        -----------MS-NTQ--------------LSYKDAGVDIHAGNELVERIKGDVKRTRR
PUR5_HAEIN        -----------MS-NTQ--------------LSYKDAGVDIHTGNELVERIKGDVKRTRR
PUR5_HAEPS        -----------MT-VTQ--------------LSYKDAGVDIHAGNDLVERIKGDVKRTRR
PUR5_ECOLI        -----------MTDKTS--------------LSYKDAGVDIDAGNALVGRIKGVVKKTRR
PUR5_SHIDS        -----------MTDKTS--------------LSYKDAGVDIDAGNALVGRIKGVVKKTRR
PUR5_ENT38        -----------MTNKTS--------------LSYKDAGVDIDAGNALVDRIKGVVKKTRR
PUR5_KLEP7        -----------MTDKTS--------------LSYKDAGVDIDAGNALVDRIKGVVKKTRR
PUR5_SALTY        -----------MTDKTS--------------LSYKDAGVDIDAGNALVDRIKGVVKKTRR
PUR5_CROS8        -----------MTDKTS--------------LSYKDAGVDIDAGNALVDRIKGVVKKTRR
PUR5_ERWT9        -----------MTDKTS--------------LSYKDAGVDIDAGNALVDRIKGVVKKTRR
PUR5_PECAS        -----------MTDKTS--------------LSYKDAGVDIDAGNALVDRIKGVVKQTRR
PUR5_YERPE        -----------MTNKTS--------------LSYKDAGVDIDAGNDLVDRIKGVVKQTRR
PUR5_PHOLL        -----------MTNKTS--------------LSYKDAGVDIDAGNALVNRIKGVVKQTRR
PUR5_SODGM        -----------MTDKTS--------------LSYKDAGVDIDAGNALVDRIKGVVKQTKR
PUR5_EDWI9        -----------MTDKTA--------------LSYKDAGVDIDAGNALVDRIKGVVKETRR
PUR5_PROMH        -----------MTNKSS--------------LSYKDAGVDIDAGNALVDRIKSVVKETRR
PUR5_HAMD5        -----------MTDHVS--------------LNYKDAGVDIHAGYLLVERIKKAVKQTHR
PUR5_VIBPA        ----------MSGNNSS--------------LSYKDAGVDIDAGNALVDRIKGAVKRTRR
PUR5_VIBVY        ----------MSGNNSS--------------LSYKDAGVDIDAGNALVERIKGSVKRTRR
PUR5_VIBA3        ----------MSGNTSS--------------LSYKDAGVDIDAGNALVDRIKGAVKRTRR
PUR5_ALIF1        ----------MSDNKTS--------------LSYKDAGVDIDAGNALVDRIKGVVKRTRR
PUR5_VIBCH        ----------MSGNNPS--------------LSYKDAGVDIDAGNALVERIKGAVKRTRR
PUR5_PHOPR        ----------MSGNNSS--------------LSYKDAGVDIDAGNALVDRIKGVVKRTHR
PUR5_SHEWM        ----------MSTPTQ---------------LSYKDAGVDIDAGNALVDNIKTAVKRTHR
PUR5_SHEPA        ----------MSTPTTP--------------LSYKDAGVDIDAGNALVNNIKSAVKRTRR
PUR5_SHEON        ----------MSTPTP---------------LSYKDAGVDIDAGNALVNNIKAAVKRTRR
PUR5_SHEAM        ----------MSTPTP---------------LSYKDAGVDIDAGNALVQNIKSAVKRTRR
PUR5_SHEDO        ----------MSTPTP---------------LSYKDAGVDIDAGNALVNNIKSAVKRTHR
PUR5_SHELP        ----------MSTPTQ---------------LSYKDAGVDIDAGNALVDNIKSAVKRTHR
PUR5_SHEFN        ----------MTTPTP---------------LSYKDAGVDIDAGNALVNNIKSAVKRTRR
PUR5_AERHH        ----------MTDKT-S--------------LSYKDAGVDIDAGNALVERIKGVSKRTRR
PUR5_TOLAT        ----------MTDKT-S--------------LSYKDAGVDIDAGNALVERIKGVAKRTRR
PUR5_IDILO        ----------MSDKKPS--------------LSYKDAGVDIDAGNALVERIKGVTKRTHR
PUR5_PSET1        ----------MSEQKQS--------------LSYKDAGVDIDAGNALVERIKGVVKKTRR
PUR5_COLP3        ----------MSEQKQS--------------LSYKDAGVDIDAGNALVENIKGAVKRTTR
PUR5_ALTMD        ----------MSENKTS--------------LSYKDAGVDIDAGNQLVERIKSVTKKTHR
PUR5_PSEA6        ----------MTDNKPS--------------LSYKDAGVDIDAGNELVERIKSVSKKTHR
PUR5_ALCBS        ----------MTEQKRP--------------LTYRDAGVDIDAGNELVKRIAPVAKRTRR
PUR5_SACD2        -----MTDSKSNSNSPS--------------LSYKDAGVDIDAGNALVERIKSVAKRTRR
PUR5_TERTT        -----MTD-QSSSNSPS--------------LSYKDAGVDIDAGNDLVERIKSVAKRTRR
PUR5_HAHCH        -----MTA---SNDKPS--------------LSYRDAGVDIDAGNALVQRIKGAAQATRR
PUR5_MARHV        -----MSE-----QKPS--------------LTYRDAGVDIDAGNDLVNRIKSTAARTRR
PUR5_PSEFS        -----------MSKQPS--------------LSYKDAGVDIDAGEALVERIKSVAKRTAR
PUR5_PSEF5        -----------MSKQPS--------------LSYKDAGVDIDAGEALVERIKSVAKRTAR
PUR5_PSESM        -----------MSKQPS--------------LSYKDAGVDIDAGEALVERIKSVAKRTKR
PUR5_PSEMY        -----------MSKQPS--------------ISYKDAGVDIDAGEALVERIKGVAKRTAR
PUR5_PSEPK        -----------MSKQPS--------------LSYKDAGVDIDAGEALVERIKGVAKRTAR
PUR5_PSEAE        ----------MSSKQPS--------------LSYKDAGVDIDAGEALVERIKGVAKRTAR
PUR5_AZOVD        -----------MSKQPS--------------LSYKDAGVDIDAGEALVERIKGVARRTAR
PUR5_CHRSD        ---MTRSSDTPSSSRAS--------------LSYKDAGVDIDAGNALVERIKGVAKRTSR
PUR5_ACIAD        ------MSNSTSTPNTG--------------LSYKDAGVDIEAGDALVDRIKSVAKRTTR
PUR5_PSYA2        ------MSNKPS-------------------LSYKDAGVDIDAGDALVQRIKSVAKATSR
PUR5_HYDCU        ----------MTKNNQS--------------ISYKDAGVDIDAGNALVEAIKPIAKATAR
PUR5_METCA        ---------MKTENPLS--------------FDYKSAGVDIAAGNALVERIKPAARKTVR
PUR5_NITOC        ----MSKKKLPPSSHSP--------------LSYRDAGVDIDAGNQLIQRIKPAANRTTR
PUR5_ALKEH        ---------MGPD-QEG--------------LTYKAAGVDIDAGNELVDRIRDDVKRTMR
PUR5_COXBU        -----MQSMPDSTRHPP--------------LSYCKAGVDIEKAADLVEAIKPIAKRTRR
PUR5_BURCJ        ---------MNPPKSAPD----------AQGLSYRDAGVDIDAGDALIDKIKPFAKKTLR
PUR5_BURVG        ---------MNPPKSAPD----------AQGLSYRDAGVDIDAGDALIDKIKPFAKKTLR
PUR5_BURPS        ---------MNPPKSAPD----------AQGLSYRDAGVDIDAGDALVDKIKPFAKKTLR
PUR5_PARPJ        ---------MNQPKSAPNSTD------SAQGLSYRDAGVDIDAGDALVDAIKPFAKKTMR
PUR5_PARXL        ---------MNQPKSAPNSTD------SAQGLSYRDAGVDIDAGDALVDAIKPFARKTMR
PUR5_PARP8        ---------MNQPKSAPNSPD------SAQGLSYRDAGVDIDAGDALVDAIKPFARKTLR
PUR5_CUPMC        ---------MSASPTAGQA-----------GLSYRDAGVDIEAGDALVDRIKPFAKRTMR
PUR5_CUPNH        ---------MSASPTAGQA-----------GLSYRDAGVDIDAGDALVDRIKPFAKRTMR
PUR5_RALSO        ---------MSASETPSASA--------SRGLSYRDAGVDIEAGDALVDRIKPFAKRTLR
PUR5_AZOSB        ---------MSVSNSASPS-----------SLSYRDAGVDIEAGDALVDRIKPFAKRTMR
PUR5_AROAE        -------------MSSPKP-----------SLSYRDAGVDIDAGDALVDRIKPLAKRTMR
PUR5_BORA1        ---------MTNEHSAP--------------LTYRDAGVDIDAGDALVDRIKPLAARTMR
PUR5_BORPE        ---------MTNQHSAP--------------LTYRDAGVDIDAGDALVDRIKPLAARTMR
PUR5_BORPD        ---------MTTQPSAP--------------LTYRDAGVDIDAGDALVDRIKPLAARTMR
PUR5_DECAR        -----------MTQNTS--------------LSYRDAGVDIDAGDALVERIKPLAKKTLR
PUR5_METFK        ---------MNSEKNS---------------ISYRDAGVDIEAGDALVERIKPFAKRTMR
PUR5_CHRVO        --------MNTTS------------------LSYRDAGVDIDAGDALVENIKPFAKRTMR
PUR5_LARHH        ---------MTQS------------------LSYRDAGVDIDAGDQLVENIKPFAKRTMR
PUR5_NEIMB        ---------MSTS------------------LSYRDAGVDIDAGDQLVENIKPFAKRTMR
PUR5_NEIG1        ---------MSTS------------------LSYRDAGVGIDAGDQLVEKIKPFAKRTMR
PUR5_NITMU        ---------MTTSKPHEENL---------SPLSYRAAGVDIDAGERLVENIRPYAKRTLR
PUR5_NITEU        ---------MTASNPANPDK---------NPISYRSSGVDIDAGNRLVERIKPFARRTMR
PUR5_POLSJ        ---------MTTSSSSP--------------LSYKDAGVDIDAGDALVERIKPLAKKTMR
PUR5_RHOFT        ------MTQKNASSASP--------------LSYKDAGVDIDAGDALIERIKPLAKKTMR
PUR5_XANOR        -------------------------------MTYRDAGVDIDAGNALVERIKPLVKRSFR
PUR5_XANCP        -------------------------------MTYRDAGVDIDAGNALVERIKPLVKRSFR
PUR5_STRMK        ---------MTNTPSSAPSP-----------LTYRDAGVDIDAGNALVERIKPLVKRSFR
PUR5_XYLFA        ---------MTTLTSPSTTP-----------LTYRDAGVDIDAGNTLVERIKPLVKRSFR
PUR5_OCHA4        ---------MTMENKP------ADKPVGQNGLTYAQAGVDIDAGNLMVEKIKPLVRSTRR
PUR5_BRUA2        ---------MTMENK----------PAGQNGLTYAQAGVDIDAGNLMVEKIKPLVRSTRR
PUR5_AGRRK        -----------MSQS------------GKNGLTYSDAGVDIDAGNLLVEKIKPAVRSTRR
PUR5_RHIEC        -----------MSQS------------GKNGLTYSDAGVDIDNGNLLVEKIKPAVRSTRR
PUR5_AGRFC        -----------MSQS------------GKNGLTYSDAGVDIDAGNLMVEKIKPAVRSTRR
PUR5_AGRVS        -----------MSKS------------GKNGLTYSDAGVDIDAGNLLVEKIKPAVRSTRR
PUR5_RHIME        -----------MSQS------------GKNGLTYSDAGVDIDAGNLMVEKIKPHVRSTRR
PUR5_SINFN        -----------MSQS------------GKNGLTYSDAGVDIDAGNLMVEKIKPHVRSTRR
PUR5_RHILO        ---------MSKRDTSQPKTGQPKTSKRRNGLTYAEAGVDIDAGNLMVEKIKPLVRATRR
PUR5_CHESB        ---------MPIARERKARLENAMS-RKKTGLSYADAGVDIDAGNALVEKIKPLVRATRR
PUR5_BARHE        -----------MNNQD------LINDKSKNGLTYAKAGVNIDMGNAMVEKIKPFIRATKR
PUR5_METNO        -----------MTG--------------ERGLTYAEAGVDIDAGNAMVEAIKPLVRSTRR
PUR5_METS4        -----------MAG--------------ENGLTYAAAGVDIDAGNAMVEAIKPLVRSTRR
PUR5_METSB        -----------MTD--------------ETKLTYADAGVDIDAGNAMVEAIKPLVRATRR
PUR5_BEII9        -----------MDK--------------KNGLTYAEAGVDIDAGNALVETIKPFVRATRR
PUR5_NITWN        -----------MTDR-------------NISLTYAGAGVDIDAGNRLVDLIKPMVRATAR
PUR5_NITHX        -----------MTDR-------------KNGLTYADAGVDIDAGNRLVDLIKPMVRATAR
PUR5_RHOPA        -----------MTER-------------KHGLTYADSGVDIDAGNRLVDLIKPMVRATAR
PUR5_RHOPB        -----------MTDR-------------KNGLTYADAGVDIDAGNRLVDLIKPMVRATAR
PUR5_PARL1        -----------MAPTP--------PKDRPNRYTYAQAGVDIDAGNELVRMIGPLAASTKR
PUR5_RUEST        -----------MTSGKNG-------------LTYADAGVDIDAGNELVDRIKPAAKRTNR
PUR5_RUEPO        -----------MTSGKNG-------------ITYAEAGVDIDAGNALVDRIKPAAKRTNR
PUR5_ROSDO        -----------MNLPKNG-------------MTYADAGVDIDAGNALVDRIKPAAKRTNR
PUR5_RHOS4        -----------MAEQQKG-------------LTYADAGVDIDAGNALVERIKPAAKRTAR
PUR5_DINSH        -----------MTTDTPPPK---------PGLTYAEAGVDIDAGNTLVDRIKPAAKATSR
PUR5_JANSC        -----------MTDSKPD------------ALTYADAGVDIDAGNALVDRIKPAAAATNR
PUR5_RHORT        MKNEVAISTSHLDAGATGT-----------GLTYKDAGVDIDSGNALVQAIKPLAASTKR
PUR5_ERYLH        -----------MSADSSG----------KTGYTYADAGVDIDAGNALVKAIGPLVKATMR
PUR5_NOVAD        -----------MSDEQNK----------PESYSYAKAGVNIAAGNALVKAIGPLAKSTAR
PUR5_SPHAL        -----------MDSKHNS----------PASYTYAQAGVSIETGNALVRAIAPLARATRR
PUR5_MAGMM        ---------MAHNQDASSP----------SGMTYRDAGVDIDAGNRLVSMIKRSVASTHR
PUR5_ANADE        -----------------------------MSLTYRDAGVDIDEGDRLVDLIKPHARPTLR
PUR5_ANADF        -----------------------------MSLTYRDAGVDIDEGDRLVELIKPHARPTLR
PUR5_MYXXD        -----------------------------MGTTYKQSGVDIEAGDAFVERIKPHAARTMR
PUR5_SORC5        -----------------------------MSVTYREAGVDIDAGDALVERIKRLAKPTRI
PUR5_SYMTH        --------------------------MTEKGLTYADAGVNRERHYELVRRIAAHTARTLR
PUR5_RIPO1        -------------------------------MDYREAGVDIQAGRSFVEKIRQGVESTYR
PUR5_CROS5        -------------------------------MDYQDAGVNIEAGRSFVDKIRRSVESTYN
PUR5_MICAN        -------------------------------MDYKEAGVDVEAGRAFVEKIRQNVESTFR
PUR5_GLOC7        -------------------------------MDYKEAGVDVEAGRNFVEKIKKKVESTHR
PUR5_SYNY3        -------------------------------MDYRQAGVDVEAGREFVSRIRQQVESTFR
PUR5_SYNP2        -------------------------------MDYQQAGVDIEAGRSFVKTIKDNVESTYR
PUR5_SYNE7        -------------------------------MNYREAGVDIEAGRAFVGDIRSLVESTRR
PUR5_CYAP4        -------------------------------MDYRDAGVDIQAGRDFVNRIKALVQQTTR
PUR5_THEEB        -------------------------------MDYRSAGVDVAAGRAFVEQIRPLVQRTQR
PUR5_SYNJB        -------------------------------MDYRSAGVDIDLGQAFVRGIRERVERIQV
PUR5_GLOVI        -------------------------------MDYKSAGVDVEAGYEFVARIRGAVERTRR
PUR5_PROMA        -------------------------------MDYKSAGVNVEAGRAFVNRIKASVESTSR
PUR5_PROMT        -------------------------------MDYKTAGVDVTAGRAFVERIKSCVEKTHK
PUR5_SYNPW        -------------------------------MDYRSAGVDVEAGRAFVDRIRTSVEATHR
PUR5_SYNPX        -------------------------------MDYKSAGVDVEAGRAFVQRIKSSVEATHR
PUR5_PROMM        -------------------------------MDYKTAGVDVQAGRAFIERIRSSVEATHR
PUR5_SYNR3        -------------------------------MDYKSAGVDVEAGRHFVERIRTSVEATHR
PUR5_PROMP        -------------------------------MDYKTSGVDIKAGREFVSEIKQSVESTYS
PUR5_BACAN        -----------------------------MANAYKQAGVDIEAGYEAVSRMKKHVQTTMR
PUR5_BACCR        -----------------------------MANAYKQAGVDIEAGYEAVSRMKKHVQTTMR
PUR5_GEOSW        -----------------------------MAEAYKQAGVDIEAGYKAVSLMKQHVQKTMR
PUR5_GEOKA        -----------------------------MAKAYKQAGVDIEAGYQAVALMKEHVQKTMR
PUR5_BACSU        -----------------------------MSEAYKNAGVDIEAGYEAVKRMKKHVERTKR
PUR5_BACLD        -----------------------------MSESYKNAGVDIEAGYEAVKRMKKHVERTKR
PUR5_BACP2        -----------------------------MSEAYKNAGVDIEAGYEAVKRMKTHVERTKR
PUR5_LYSSC        -----------------------------MSKAYEQAGVNIEAGYEAVKRMKSHVERTNR
PUR5_BACHD        -----------------------------MSDAYKQAGVDIEAGYEAVARMKKHVLRTAR
PUR5_BACSK        -----------------------------MSNAYKEAGVDIEAGYEAVNRMKRHVERTAR
PUR5_BREBN        -----------------------------MSEAYKQAGVDIDAGNEAVERMKKHVKRTFR
PUR5_HUNT2        ------------------------------MTTYKDAGVDVEAGYEAVRLMRNDVKRTFR
PUR5_RUMCH        ------------------------------MTTYREAGVDVEAGYEAVKLMKNHVKRTFR
PUR5_EUBE2        -------------------------------MDYKKSGVDIEAGYKSVELMKEAVKSTMR
PUR5_AGARV        -------------------------------MDYKNSGVDIEAGYKSVELMKKHVKETMR
PUR5_LACP7        -------------------------------MDYKKAGVDIEAGYKAVELMKKHIQGTMR
PUR5_BIFAA        -----------------------------MPKAYEEAGVSVEAGYEVVKRIKSHVARTNR
PUR5_BIFLO        -----------------------------MPKAYENAGVSVEAGYEVVKRIKSHVARTNR
PUR5_BIFA0        -----------------------------MPQAYENAGVSVEAGYEVVKRIKSHVARTNR
PUR5_STRGC        ---------------------------MTNKNAYAQSGVDVEAGYEVVERIKKHVARTER
PUR5_STRR6        ---------------------------MTNKNAYAQSGVDVEAGYEVVERIKKHVARTER
PUR5_STRT2        ----------------------------MSKNAYAQSGVDVEAGYEVVERIKKHVARTER
PUR5_STRA5        ---------------------------MSEKNAYAQSGVDVEAGYEVVERIKKHVARTER
PUR5_STRP1        ---------------------------MSEKNAYAKSGVDVEAGYEVVERIKKHVARTER
PUR5_STRMU        ---------------------------MTEKNAYAQSGVDIEAGYEVVARIKKHVARTER
PUR5_STRU0        ---------------------------MTEKNAYAQSGVDVEAGYEVVERIKKHVARTER
PUR5_LACLA        ----------------------------MSENAYAKSGVDVEAGYEVVSRIKKHVAKTER
PUR5_ENTFA        -----------------------------MENAYSKAGVNVEAGYEVVERIQKHSQKTQR
PUR5_LISMO        ----------------------------MAENAYSKAGVDVEAGYQVVERIKKHVARTER
PUR5_LACSS        -----------------------------MTDAYQKAGVDVTAGYEVVARIQKKVGADNH
PUR5_LACF3        ------------------------------MNRYQEAGVDVNAGYELVKRIKENVKSTNR
PUR5_LACRD        ------------------------------MSRYQDAGVDVNAGYELVHRIKDAVKSTDR
PUR5_LACS1        ------------------------------MSRYQEAGVDIHAGYELVNKIKKDVKSTRR
PUR5_LACDA        ----------------------------MIVNRYKDAGVDVNAGYELVRRIKGAVASTKR
PUR5_LACAC        ------------------------------MNRYKEAGVDVTAGYDLVNRIKPLVAATKR
PUR5_STACT        -----------------------------MAESYKNAGVDIHAGYEAVERMKSHVQRTMR
PUR5_STAS1        -----------------------------MSKAYQQAGVDINAGYEAVERMTSHVQRTMR
PUR5_STAEQ        -----------------------------MSKAYEESGVNIQAGYEAVERITSHVERTLR
PUR5_STAA8        -----------------------------MSKAYEQSGVNIHAGYEAVERMSSHVKRTMR
PUR5_MACCJ        -----------------------------MAESYKQSGVDIHAGYEAVERMKKHVNKTMR
PUR5_EXIS2        -----------------------------MSKQYEAAGVSLTAGYESVSRMKKHVARSMR
PUR5_EXISA        -----------------------------MSVRYEQAGVNLEAGYEAVSRMKRHVARTMR
PUR5_OCEIH        -----------------------------MSEVYKQAGVDVEKGYEAVERLKKHVARTHR
PUR5_ALKOO        -----------------------------MKITYKSAGVDVDEGQRAVQLMKNHVKSTFN
PUR5_ALKMQ        --------------------------MAMPKLTYEEAGVNVQEGQRAVNLMKESVKSTFT
PUR5_CLONN        ------------------------------MATYKDAGVNIEEGYKAVSLMKNYAAKTFT
PUR5_CLOAB        ------------------------------MVTYKDSGVNIEEGYKSVKLMKDYASKTFI
PUR5_CLOK5        ------------------------------MVTYKDSGVNIEEGYKSVKLMKEYSAQTFI
PUR5_CLOTE        ------------------------------MATYKDAGVNIEEGYKSVNLMKEHVQKTFN
PUR5_CLOPE        ------------------------------MLTYKEAGVNIEEGYRSVKLIKEYAKKTMS
PUR5_FUSNN        -----------------------------MINSYKDSGVDKEEGYKAVELMKKNVLKTHN
PUR5_CALS8        ------------------------------MTTYKDAGVNIEEGYKAVNLIKNIAKETFD
PUR5_FINM2        -----------------------------MGLTYKDSGVDKEKGYEEVQIIKEIVKKTHG
PUR5_GEODF        -------------------------MS-KARITYKDAGVDIDAGNTFVKLIKPLVKATSR
PUR5_GEOUR        -------------------------MS-ESRITYKDAGVDIDAGNTFVKMIKPLVKATSR
PUR5_GEOBB        -------------------------MK-ETKITYKDAGVDIDAGNTFVQMIKPLVKATSR
PUR5_GEOMG        -------------------------MG-AKGITYKDAGVDIDAGNTFVKMIKPFVRATSR
PUR5_GEOSL        -------------------------MT-KRGFTYKDAGVDIDAGNTFVGLIKPFVKATSR
PUR5_GEOLS        -------------------------MS-KPRATYKEAGVDIEAGNSFVQKIKPLVKSTFR
PUR5_PELCD        -------------------------MSDQKKMTYKDAGVDIDAGNRFVQLIKPLVKATSR
PUR5_SYNAS        -------------------------MR--EQSSYKDAGVDIDKANLFISRIIPLIKMTSR
PUR5_DESAL        ---------------------------MAKSLSYADAGVDIDKANRLVDRIKTIVKSTPR
PUR5_DESPS        ----------------------MSTTSEAVQSKYSEAGVDIDKGNAFVEGIKDIVASTHK
PUR5_DESAG        -------------------------MPEDRAKAYTEAGVDINAGNALVSRIKSMVASTHT
PUR5_DESVM        -------------------------MSEDRSKAYTDAGVDINAGNALVSRIKSIVARTHT
PUR5_LAWIP        -------------------------MSLIRSQAYTNAGVNINAGNALISNIKSFVSETNI
PUR5_PSELT        -----------------------------MGFTYKDSGVDIDAADLSVQMIKRYARQTHI
PUR5_CALS4        -------------------------------MKYKDAGVNIDEGNKFVKMIKPFAEKTIK
PUR5_THEYD        -----------------------------MSITYKKAGVDIDEADKFVSMISPIVKTTFR
PUR5_CARHZ        ----------------------------MEELTYKAAGVDIDAGMDVVRRIKSEVEKTLN
PUR5_MOOTA        -------------------------MVAGEGFTYAAAGVDIAAGNRAVELMKEHVRRTFR
PUR5_DESHY        -----------------------------MGYSYRQAGVDIDAGNQAVELMKPAVKRTVR
PUR5_SYNWW        --------------------------MDKPGLSYKEAGVDIDAANRSVEMIKKWVGQTIR
PUR5_METS3        ------------------------------MVTYSESGVDIDLEAVTVSKLASKLKSTLE
PUR5_METTH        ------------------------------MVTYSESGVDIDLEELTVSSLTSRLSDTLK
PUR5_METJA        ------------------------------MVTYKDAGVDISHEDKVIKALVSQI--TFK
PUR5_METMP        ------------------------------MVTYKDAGVDIYKEDKVIRALASQI--KFE
PUR5_METKA        ----------------------------MSEMTYKDAGVDIDKEAFAVRAIRDVLEKYKV
PUR5_METAC        --------------------------MSEKHLTYADSGVDITKEEKTVKTLIDKL--SYV
PUR5_METMA        --------------------------MSEKHLTYADSGVDIKEEEKTVKTLIDKL--SYV
PUR5_METBF        --------------------------MSEKHLTYADSGVDITKEEKTVKTLIEKL--SYV
PUR5_METBU        --------------------------MNEKHLTYADSGVDIEKEESTIKALTNGM--TYK
PUR5_ARCFU        ----------------------------MPKFDYAKAGVDIREEERAIKSLASVI--KHV
Q5V4T0_HALMA      ---------------MTDSESEADDADSEEGLTYAETGVDIDASEAATKALIGAA--GEF
B0R4C5_HALS3      ---------------MTAGENADGDPD---GLTYADAGVDIADSEAATAALVDAA--STG
G0LLI6_HALWC      ----MSNPPDDTAERNTDIKTNASEEDSD-ELTYAAAGVDIEASEAATAALIDAV--GES
PUR5_PYRFU        ------------------------------MLTYAQAGVDEEKTSKALRFIIEAARKTFE
PUR5_THEKO        ------------------------------MLTYAQAGVDDEKTSRALKSIISLAKGTFE
PUR5_SULTO        -----------------------------MVSEYKKAGVDLNKLKEYHTLALNTFQNS--
Q4J8F5_SULAC      ------------------------------MSEYSKSGVNLDKLKQYHNFIANYLGSSR-
PUR5_SACS2        ----------------------------MVSEEYKKAGVDLEKLRNYHNMISQIISSTYK
PUR5_THEAC        ------------------------------MSEVEGGIINRKLQGEFVNTFIRQLKFHRE
                                                        :.                    

PUR5_RHOBA        P------RVMPSDGGFAGLFRLDFPGKLFARNYEEPVLVSGTDGVGTKLKIAQTMNQHET
PUR5_LEPIN        P------RVIGGLGGFAGAYDVSV-----LKKYKHPILLSGTDGVGTKIELARLLKIYNT
PUR5_ACTSZ        ------SEVIGGLGGFGALCALP-------AKYKEPVLVSGTDGVGTKLRLAIDLKKHDT
PUR5_MANSM        ------PEVIGGLGGFGALCALP-------TKYKEPVLVSGTDGVGTKLRLAIDLNKHDT
PUR5_HISS2        ------PEVIGGLGGFGALCALP-------SKYKDPILVSGTDGVGTKLRLAIDLKKHDT
PUR5_PASMU        ------PEVIGGLGGFGALCAIP-------TKYKEPILVSGTDGVGTKLRLAIDLNRHDS
PUR5_ACTP2        ------PEVMGGLGGFGALCALP-------TKYKEPILVSGTDGVGTKLRLAIDLNKHDT
PUR5_HAEIN        ------SEVMGGLGGFGALCALP-------TKYKEPILVSGTDGVGTKLRLAIDLKKHDT
PUR5_HAEPS        ------PEVIGGLGGFGALCALP-------TKYKEPILVSGTDGVGTKLRLAIDLNKHDT
PUR5_ECOLI        ------PEVMGGLGGFGALCALP-------QKYREPVLVSGTDGVGTKLRLAMDLKRHDT
PUR5_SHIDS        ------PEVMGGLGGFGALCALP-------QKYREPVLVSGTDGVGTKLRLAMDLKRHDT
PUR5_ENT38        ------PEVMGGLGGFGALCALP-------QKYREPVLVSGTDGVGTKLRLAMDLKRHDT
PUR5_KLEP7        ------PEVMGGLGGFGALCALP-------QKYREPVLVSGTDGVGTKLRLAMDLKRHDT
PUR5_SALTY        ------PEVMGGLGGFGALCALP-------QKYREPVLVSGTDGVGTKLRLAMDLKRHDA
PUR5_CROS8        ------PEVMGGLGGFGALCALP-------QKYREPVLVSGTDGVGTKLRLAMDLKRHDT
PUR5_ERWT9        ------PEVMGGLGGFGALCALP-------QKYREPILVSGTDGVGTKLRLAMDLKRHDA
PUR5_PECAS        ------PEVMGGLGGFGALCALP-------QKYREPILVSGTDGVGTKLRLAMDLKRHDT
PUR5_YERPE        ------PEVMGGLGGFGALCALP-------QKYREPILVSGTDGVGTKLRLAMDLKRHDT
PUR5_PHOLL        ------PEVMGGLGGFGALCALP-------QKYREPILVSGTDGVGTKLRLAMDLKRHDT
PUR5_SODGM        ------PEVMGGLGGFGALCALP-------QKYREPILVSGTDGVGTKLRLAMDLKRHDT
PUR5_EDWI9        ------PEVMGGLGGFGALCALP-------QKYREPVLVSGTDGVGTKLRLAMDLQRHDS
PUR5_PROMH        ------PEVMGGLGGFGALCAIP-------TKYREPILVSGTDGVGTKLRLAMDLNRHDD
PUR5_HAMD5        ------PEVIGGLGGFGALCALP-------QKYREPILVSGTDGVGTKLRLAIDLKRHET
PUR5_VIBPA        ------PEVMGGIGGFGALCELP-------TKYKQPVLVSGTDGVGTKLRLALDMNKHDT
PUR5_VIBVY        ------PEVMGGIGGFGALCELP-------TKYKQPVLVSGTDGVGTKLRLALDMNKHDT
PUR5_VIBA3        ------PEVMGGIGGFGALCELP-------TKYKEPVLVSGTDGVGTKLRLALDLKKHDT
PUR5_ALIF1        ------PEVMGGIGGFGALCELP-------TKYKQPLLVSGTDGVGTKLRLALDLNKHDT
PUR5_VIBCH        ------PEVMGGLGGFGALCELP-------TKYKHPVLVSGTDGVGTKLRLALDMKKHDT
PUR5_PHOPR        ------PEVMGGIGGFGALCSLP-------TKYKEPILVSGTDGVGTKLRLAMDLNKHDT
PUR5_SHEWM        ------PEVMGNLGGFGALCELP-------TKYKHPVLVSGTDGVGTKLRLAIDYKKHDT
PUR5_SHEPA        ------PEVMGNLGGFGALCELP-------TKYKHPVLVSGTDGVGTKLRLAIDYKKHDN
PUR5_SHEON        ------PEVMGNLGGFGALCELP-------TKYKQPVLVSGTDGVGTKLRLAIDYKKHDT
PUR5_SHEAM        ------PEVMGNLGGFGALCELP-------TKYKHPVLVSGTDGVGTKLRLAIDFKSHDT
PUR5_SHEDO        ------PEVMGNLGGFGALCELP-------TKYKHPVLVSGTDGVGTKLRLAIDYKKHDT
PUR5_SHELP        ------PEVMGNLGGFGALCELP-------TKYKHPVLVSGTDGVGTKLRLAIDYQKHDS
PUR5_SHEFN        ------PEVMGNLGGFGALCELP-------TKYKHPVLVSGTDGVGTKLRLAIDYKKHDT
PUR5_AERHH        ------PEVLGGLGGFGALCQIP-------AGYKEPVLVSGTDGVGTKLRLAIDLKKHDT
PUR5_TOLAT        ------PEVMGGLGGFGALCRIP-------AGYREPILVSGTDGVGTKLRLAIDLKKHDT
PUR5_IDILO        ------PEVMGNIGGFGALCEIP-------AGYKQPVLVSGTDGVGTKLRLAIDLKRHRG
PUR5_PSET1        ------PEVMGGIGGFGALCEIP-------AGYKQPVLVAGTDGVGTKLRLAIDLKKHDT
PUR5_COLP3        ------PEVMGGLGGFGSVCQLP-------TGYKEPVLVAGTDGVGTKLRLAIDLAKHDT
PUR5_ALTMD        ------PEVKGNLGGFGALCELP-------TKYKKPLLVSGTDGVGTKLRVAMDANRHDG
PUR5_PSEA6        ------PEVRGGLGGFGALCSLP-------TKYKEPLLVSGTDGVGTKLRLAMDLEQHDG
PUR5_ALCBS        ------PEVLGGLGGFGALCELP-------TKYKNPVLVAGTDGVGTKLRLAIDHNRHEK
PUR5_SACD2        ------PEVMAGLGGFGALFELP-------KGYQEPVLVAGTDGVGTKLKLAMQLNKHDT
PUR5_TERTT        ------PEVMAGLGGFGALFELP-------SGYNQPVLVSGTDGVGTKLKLAMQLNKHDT
PUR5_HAHCH        ------PEVMAGLGGFGALFELP-------KGYQEPVLVSGTDGVGTKLRLAMQMNKHDT
PUR5_MARHV        ------PEVLGGLGGFGAMVSIP-------AGYKEPVLVSGTDGVGTKLRLAMQLQKHDS
PUR5_PSEFS        ------PEVMGGLGGFGALCEIP-------AGYKQPVLVSGTDGVGTKLRLALNLNKHDT
PUR5_PSEF5        ------PEVMGGLGGFGALCEIP-------AGYKQPVLVSGTDGVGTKLRLALNLNKHDS
PUR5_PSESM        ------PEVMGGLGGFGALCEIP-------AGYKQPVLVSGTDGVGTKLRLALNLNKHDT
PUR5_PSEMY        ------PEVMGGLGGFGALCEIP-------AGYKQPVLVSGTDGVGTKLRLALNLNKHDS
PUR5_PSEPK        ------PEVMGGLGGFGALCEIP-------AGYKQPVLVSGTDGVGTKLRLALNLNKHDS
PUR5_PSEAE        ------PEVMGGLGGFGALCEIP-------AGYKQPVLVSGTDGVGTKLRLALNLNKHDS
PUR5_AZOVD        ------PEVMGGLGGFGALCEIP-------AGYRQPVLVSGTDGVGTKLRLAMNLGKHDS
PUR5_CHRSD        ------PEVMGGLGGFGALCQLP-------TGYREPVLVSGTDGVGTKLRLAMDLARHDT
PUR5_ACIAD        ------PEVMGGLGGFGALCKIP-------KGYEEPVLVSGTDGVGTKLRLALNLNRHDT
PUR5_PSYA2        ------PEVVGGLGGFGALCRIP-------TGYTSPLLVSGTDGVGTKLKLALQLNRHDT
PUR5_HYDCU        ------PEVSTSLGGFGALFELPM------DKYKNPLLVSGTDGVGTKLRLAIESGKHDQ
PUR5_METCA        ------PGVLAGLGGFGSLFELPV------DRYRKPVLVAGTDGVGTKLRLAIESGRHGG
PUR5_NITOC        ------PGVLTSLGGFGSLFELPI------HRYQHPVLVAGTDGVGTKLKLAIQLNRHDS
PUR5_ALKEH        ------PGVLGGLGGFGGLFEVPV------DRYRRPVLVSGTDGVGTKLKLAIETGRHDG
PUR5_COXBU        ------PGVLSGIGGFGGLFELP-------RGYKQPVLVSGTDGVGTKLKLAVELNRHDT
PUR5_BURCJ        ------DGVLGGIGGFGALFEVP-------KKYKEPVLVSGTDGVGTKLKLAFHLNKHDT
PUR5_BURVG        ------DGVLGGIGGFGALFEVP-------KKYREPVLVSGTDGVGTKLKLAFHLNKHDT
PUR5_BURPS        ------DGVLGGIGGFGALFEVP-------KKYREPVLVSGTDGVGTKLKLAFHLNKHDT
PUR5_PARPJ        ------DGVLGGIGGFGALFEVP-------KKYKEPVLVSGTDGVGTKLRLAFQLNKHDT
PUR5_PARXL        ------DGVLGGIGGFGALFEVP-------KKYKEPVLVSGTDGVGTKLRLAFQLNKHDT
PUR5_PARP8        ------DGVLGGIGGFGALFEVP-------KKYKEPVLVSGTDGVGTKLKLAFTLNRHDT
PUR5_CUPMC        ------EGVMAGIGGFGALFELS-------KKYQEPVLVSGTDGVGTKLKLAFQLNRHDT
PUR5_CUPNH        ------EGVMAGIGGFGALFELS-------KKFQEPVLVSGTDGVGTKLKLAFQLNRHDT
PUR5_RALSO        ------EGVLGGIGGFGALFEIS-------KKYQEPVLVSGTDGVGTKLKLAFALNRHDT
PUR5_AZOSB        ------PEVLGGIGGFGALFELS-------KKFKEPVLVSGTDGVGTKLKLAFQLNKHDT
PUR5_AROAE        ------PEVLGGIGGFGALFELS-------KKYREPVLVSGTDGVGTKLKLAFQLNRHDT
PUR5_BORA1        ------PGVLAGIGGFGALFEVP-------KKYREPVLVSGTDGVGTKLRLAFDWNRHDT
PUR5_BORPE        ------PGVLAGIGGFGALFEVP-------KKFREPVLVSGTDGVGTKLRLAFDWNRHDT
PUR5_BORPD        ------PGVLAGIGGFGALFQVP-------GKYREPVLVSGTDGVGTKLRLAFEWNRHDT
PUR5_DECAR        ------EGVLGGIGGFGALFEVP-------KRYKEPVLVSGTDGVGTKLRLAFDLNRHDT
PUR5_METFK        ------PEVLGGIGGFGSLFEVP-------KKFKNPVLVSGTDGVGTKLKLAFQLNKHDT
PUR5_CHRVO        ------PEVLGGIGGFGALVEIS-------KKYKEPVLVSGTDGVGTKLKLAFDWNRHDT
PUR5_LARHH        ------PEVLGGLGGFGALVEIS-------KKYREPVLVSGTDGVGTKLKLAFDWNRHDT
PUR5_NEIMB        ------PEVLGDLGGFGALVEIG-------KKYQNPVLVSGTDGVGTKLKLAFDWDKHDT
PUR5_NEIG1        ------PEVLGDLGGFGALVEIG-------KKYQNPVLVSGTDGVGTKLKLAFDWDKHDT
PUR5_NITMU        ------PEVLAGIGGFGALFEIS-------RKFNNPVLVAGTDGVGTKLKLAFESGRHDT
PUR5_NITEU        ------PEALGGIGGFGALFEVP-------GKYRQPVLVSGTDGVGTKLKLAFQYARHAT
PUR5_POLSJ        ------EGVLAGIGGFGALFEVP-------KRYKEPVLVSGTDGVGTKLRLAFEWNMHDT
PUR5_RHOFT        ------EGVLAGIGGFGALFEVP-------KRYKEPVLVSGTDGVGTKLKLAFEWNMHDT
PUR5_XANOR        ------PEVMGGLGGFGALFDLS-------GKYKEPVLVSGTDGVGTKLKLAQQLGRHDT
PUR5_XANCP        ------PEVMGGLGGFGALFDLS-------GKYKEPVLVSGTDGVGTKLKLAQQLGRHDT
PUR5_STRMK        ------PEVMGGLGGFGALFDLS-------NKYREPVLVSGTDGVGTKLKLAHQLNRHDT
PUR5_XYLFA        ------PEVMSGLGGFGALFNLA-------GKYKEPVLVSGTDGVGTKLKLAQQLNRHNT
PUR5_OCHA4        ------PGADGEIGGFGGLFDLKA------AGFKDPVLVAANDGVGTKLKIAIDADKHDT
PUR5_BRUA2        ------PGADGEIGGFGGLFDLKA------AGFKDPVLVAANDGVGTKLKIAIDADIHDT
PUR5_AGRRK        ------PGADGEIGGFGGLFDLKA------AGFTDPVLVAANDGVGTKLKIAIDADYHDT
PUR5_RHIEC        ------PGADGEIGGFGGLFDLKA------AGFTDPVLVAANDGVGTKLKIAIDADYHDT
PUR5_AGRFC        ------PGADGEIGGFGGLFDLKA------AGFTDPVLVAANDGVGTKLKIAIDADYHDT
PUR5_AGRVS        ------PGADGEIGGFGGLFDLKA------AGFTDPILVAANDGVGTKLKIAIDAGLHDT
PUR5_RHIME        ------PGADGEIGGFGGLFDLKA------AGFSDPVLVAANDGVGTKLKIAIDADKHDT
PUR5_SINFN        ------PGADGEIGGFGGLFDLKA------AGFTDPVLVAANDGVGTKLKIAIDANKHDT
PUR5_RHILO        ------PGADGEIGGFGGLFDLKA------AGFTDPVLVAANDGVGTKLKIAIDAGKHDT
PUR5_CHESB        ------PGADGEIGGFGGLFDLKA------AGFTDPILIAANDGVGTKLKVAIEAGKHDT
PUR5_BARHE        ------AGTDAEIGGFGGLFDLKA------AGFTDPILVAANDGVGTKLKIAIEVGIHDT
PUR5_METNO        ------PGADAEIGGFGGLFDLKA------AGFKDPILVAANDGVGTKVKIAIETGRHDT
PUR5_METS4        ------PGADAEIGGFGGLFDLKA------AGFSDPILVAANDGVGTKVKIAIETGRHDT
PUR5_METSB        ------RGADAEIGGFGGLFDLKA------AGFTDPILVAANDGVGTKVRIAIETGAHDT
PUR5_BEII9        ------AGADAELGGFGGLFDLKA------AGFQDPILVAANDGVGSKVKLAIETGQHDT
PUR5_NITWN        ------AGAEAEIGGFGGLFDLKA------AGFADPVLVAANDGVGTKVKIAIETGIHDT
PUR5_NITHX        ------AGADAEIGGFGGLFDLKA------AGFTDPVLVAANDGVGTKVKIAIETGIHDT
PUR5_RHOPA        ------AGADSEIGGFGGLFDLKA------AGFKDPVLVAATDGVGTKIKVAIDAGLHTG
PUR5_RHOPB        ------PGADAEIGGFGGLFDLKA------AGFKDPVLVAATDGVGTKVKIAIEAGLHAG
PUR5_PARL1        ------PGSDAALGGFGGLFDLAA------CGFKDPVLVAANDGVGTKLKVAIEADRHDT
PUR5_RUEST        ------PGVMSGLGGFGALFDLKA------AGYEDPILVGATDGVGTKLRIAIDTGLVDG
PUR5_RUEPO        ------PGVASGLGGFGALFDLKA------AGYQDPVLVAATDGVGTKLRIAIDTGLVDG
PUR5_ROSDO        ------SGVMAGLGGFGALFDLKD------AGYTDPILVAATDGVGTKLRIAIDTGHVDG
PUR5_RHOS4        ------PGTVSGLGGFGALFDLKA------AGYQDPVLVAATDGVGTKLRIAIDTGEVDT
PUR5_DINSH        ------PGVMSGLGGFGALFDLRA------AGYADPVLVAATDGVGTKLRIAIDTGHVDT
PUR5_JANSC        ------AGVMAGLGGFGALFDLKA------AGYDDPVLVAATDGVGTKLKIAIDTGNFDT
PUR5_RHORT        ------PGADASLGGFGAIFDLAA------AGYSDPLLITATDGVGTKLKIALDSGIHDS
PUR5_ERYLH        ------PGADGEIGGFGGFFDPGA------AGYKDPLLVAGNDGVGTKLKLAIDTQRHDT
PUR5_NOVAD        ------PGADAELGGFGGFFDLKA------AGYNDPLLVAGNDGVGTKVKLAIDHDRHDQ
PUR5_SPHAL        ------PGADADLGGFGGFFDLRA------AGFADPLLVAANDGVGTKLKLAIESGRHDG
PUR5_MAGMM        ------PEVRSDLGGFGALFDLDT------RKYQDPVLVSATDGVGTKLKLAFLTGKHDT
PUR5_ANADE        ------PEVLGGIGGFGGLFALDV------KKYREPVLVSGTDGVGTKLKVAFAADRHDT
PUR5_ANADF        ------PEVLAGIGGFGGLFALDV------KKYREPVLVSGTDGVGTKLKVAFAANRHDT
PUR5_MYXXD        ------PEVMGGVGGFGGLFALPP------GKYQQPVLVAGTDGVGTKLKVAFAAGRHGT
PUR5_SORC5        ------PEVLADVGGFAGLCALP-------GGLSEPVLVSGTDGVGTKLKVAFATGVHDT
PUR5_SYMTH        R-----PGTLGNIGAFGGLFQLDP------ARYPEPVLVSGTDGVGTKLRLAFLSGRHDT
PUR5_RIPO1        R------EVLGGLGGFGGYFELP-------QGYQHPVLVSGTDGVGTKLKIAQALNQHHT
PUR5_CROS5        A------QVLGGLGGFGGYFELP-------TGYENPVLVSGTDGVGTKLKIAQALNRHQT
PUR5_MICAN        P------EVIGGLGGFGGYFQLP-------SGYRQPVLVSGTDGVGTKLKIAHSLNCHDT
PUR5_GLOC7        P------EVLGGLGGFGGFFQIP-------SGYQEPVLVSGTDGVGTKLKLAQGLNCHHT
PUR5_SYNY3        P------EVMGGIGGFAGLFEIP-------AGYKAPVLVSGTDGVGTKLKIAQAMDQHHT
PUR5_SYNP2        P------GVLGGLGGFGGCFEIP-------AGYRQPVLISGTDGVGTKLKIAHQTDQHHT
PUR5_SYNE7        P------GVLGGLGGFGGFFELP-------SGYRQPVLVSGTDGVGTKLKIAHQVGRHDS
PUR5_CYAP4        S------EVLGGLGGFGGCFQLP-------EGYRQPVLVSGADGVGTKLKIAQALNQHHT
PUR5_THEEB        P------EVVGGLGGFAGLCQIP-------KGYRQPLLVSGTDGVGTKLKLAQALDRHNT
PUR5_SYNJB        PSSGS-SETLGGIGGFAGLFELP-------TGYQAPVLVAGTDGVGTKLDIAQQWGQHQG
PUR5_GLOVI        P------EQLGGLGGFGGLFALP-------AGYREPVLVAGTDGVGTKLKLAFALDRHDT
PUR5_PROMA        P------EVIGGIGGFGGFMRLP-------RGLEKPVLVSGTDGVGTKLELAQDYGSHYG
PUR5_PROMT        S------EVIGGLGGFGGCIRIP-------KGFESPVLVSGTDGVGTKLELAQQYGCHFG
PUR5_SYNPW        P------EVVGGLGGFGGLMRLP-------EGLRKPLLVSGTDGVGTKLELAQDHKSHHN
PUR5_SYNPX        Q------EVVGGLGGFGGMMRLP-------AGLRQPLLVSGTDGVGTKLELAQDHQAHHN
PUR5_PROMM        P------EVIGGLGGFGGLMRLP-------AGLNKPLLVAGTDGVGTKLELAQQHQAHYG
PUR5_SYNR3        P------EVLGGLGGFGGLCRLP-------AGLEKPLLVAGTDGVGTKLELAQECGRHHG
PUR5_PROMP        S------NVLEGIGGFGGLFKIPL------EGLKKPVLVSGTDGVGTKLELAQIKNFHFE
PUR5_BACAN        K------EVLGGLGGFGGMFDLSKF-----A-LEEPVLVSGTDGVGTKLMLAFMADKHDT
PUR5_BACCR        K------EVLGGLGGFGGMFDLSKF-----A-LEEPVLVSGTDGVGTKLMLAFMADKHDT
PUR5_GEOSW        P------EVLSGLGGFGGMFDLSSL-----G-YREPVLISGTDGVGTKLKIAFMMDCHDT
PUR5_GEOKA        P------EVLGGIGGFGGLFDLSAL-----G-YRQPVLISGTDGVGTKLKLAFLLDRHDT
PUR5_BACSU        L------GVMGSLGGFGGMFDLSEL-----S-YQKPVLISGTDGVGTKLKLAFSMDKHDT
PUR5_BACLD        I------GAMGGLGGFGGMFDLSEL-----P-YKQPVLISGTDGVGTKLKLAFAMDKHDT
PUR5_BACP2        A------GVMGALGGFGGMFDLSEL-----P-YKKPVLVSGTDGVGTKLKLAFLMDKHDT
PUR5_LYSSC        L------GVMGTFGGFGGMFDLSEL-----N-LKEPVLISGTDGVGTKLKLAFMVDKHDT
PUR5_BACHD        P------EVIGGLGSFGGMFDLSAL-----N-MKEPVLVSGTDGVGTKLMLAFQMNKHDT
PUR5_BACSK        K------GVLGGLGGFGGNFDLSTL-----G-LKEPVLVSGTDGVGTKLMIAFMANKHDT
PUR5_BREBN        P------EVMTDLGGFGALFRLDTK-----K-YEKPILVSGTDGVGTKLKLAFAMDKHDT
PUR5_HUNT2        P------EVLTDIGGFGGLFGLNKD-----K-YSEPVLVSGTDGVGTKLKIAFLLDKHDT
PUR5_RUMCH        P------EVMTELGGFGGLFSLDKE-----K-YEQPILVSGTDGVGTKLKIAFLTDKHDT
PUR5_EUBE2        E------EVLGGIGGFSGAFSLAKI-----KEMEEPVLLSGTDGCGTKVKLAFIMDKHDT
PUR5_AGARV        P------EVLGGLGGFSGAFSLASI-----KDMEDPVLLSGTDGCGTKVKLAFIMDKHDT
PUR5_LACP7        S------EVLTGIGGFSGAFSLTSF-----KDMEEPTLVSGTDGVGTKLKLAFILDKHDT
PUR5_BIFAA        P------GVVGGIGGFGGLFDLASL-----G-YKEPVLISGTDGVGTKLVVAKMAGKHST
PUR5_BIFLO        P------GVVGGIGGFGGLFDLASL-----G-YKEPVLISGTDGVGTKLMVAKLANKHDT
PUR5_BIFA0        P------GVVSGIGGFGGLFDLASL-----G-YNEPVLISGTDGVGTKLVIAKLMDKHDT
PUR5_STRGC        A------GVMGALGGFGGMFDLSKT-----G-VKEPVLISGTDGVGTKLMLAIKYDKHDT
PUR5_STRR6        A------GVMGALGGFGGMFDLSKT-----G-VKEPVLISGTDGVGTKLMLAIKYDKHDT
PUR5_STRT2        A------GVMGGLGGFGGMFDLSKT-----G-VKEPVLISGTDGVGTKLMLAIKYDKHDT
PUR5_STRA5        A------GVMGALGGFGGMFDLSQT-----G-VKEPVLISGTDGVGTKLMLAIKYDKHDT
PUR5_STRP1        A------GVMGALGGFGGMFDLSKT-----G-VKEPVLVSGTDGVGTKLMLAIKYDKHDT
PUR5_STRMU        L------GVMGALGGFGGMFDLSQL-----D-VKEPVLISGTDGVGTKLMLAIKYDKHNT
PUR5_STRU0        A------GVMGALGGFGGMFDLSKT-----G-VKEPVLISGTDGVGTKLMLAIKYDKHDT
PUR5_LACLA        L------GVLGALGGFGGSFDLSVL-----D-VKEPVLISGTDGVGTKLMLAIQADKHDT
PUR5_ENTFA        T------GTLGMLGGFGGCFDLSSY-----K-LKEPVLVSGTDGVGTKLLLAIEEQKHET
PUR5_LISMO        I------GAMGALGSFGGMFDLSSL-----N-LKEPVLVSGTDGVGTKLLLAIEADKHDT
PUR5_LACSS        -----------NIGSFGGQYALEMA-----Q-YQKPVLVSSTDGVGTKLMVAFAADQHAT
PUR5_LACF3        P------GALGGIGAFGGLFDLGEL-----K-VKHPVLVSGTDGVGTKLLIAKAMDQHDT
PUR5_LACRD        P------GVIGGIGSFGGMFDLEKL-----Q-VQHPILVSGTDGVGTKLLIAQQMNKHDT
PUR5_LACS1        V------GTTGNIGSFGGTFDLSVL-----N-IKEPVLVSGTDGVGTKLLIAQKMDKHDT
PUR5_LACDA        P------GYVGNIGGFGGLFDLDSL-----G-YDHPVLVSGTDGVGTKLIIAQKMDKNDT
PUR5_LACAC        K------GVMGSIGSFGGMFDLEEL-----G-YKHPVLVSGTDGVGTKLMIAQKMHKNDT
PUR5_STACT        K------EVLGGLGGFGAAFDLSQL-----N-MQKPVLVSGTDGVGTKLKLAIDHDKHDT
PUR5_STAS1        K------EVLGGLGGFGATFDLSQL-----N-MKAPLLVSGTDGVGTKLKLAIDNDKHDT
PUR5_STAEQ        K------EVLGGLGGFGATFDLSQL-----K-MKAPVLVSGTDGVGTKLKLAIDYGKHDT
PUR5_STAA8        K------EVIGGLGGFGATFDLSQL-----N-MTAPVLVSGTDGVGTKLKLAIDYGKHDS
PUR5_MACCJ        K------EVLGGLGSFGAAFDLSQL-----N-MKAPVLVSGTDGVGTKLRLAIDSDRHDT
PUR5_EXIS2        K------EVMTGLGSFGAMFDLSQL-----N-LKEPVLVSGTDGVGTKLKLAFALDQHDT
PUR5_EXISA        P------EVMTGLGSFGAMIDLGSM-----N-MKHPILVSGTDGVGTKLKLAFALDQHDT
PUR5_OCEIH        P------EVLGGIGAFAGAFDLSSL-----Q-YKEPVLLSGTDGVGTKLKLAIDLDKHDT
PUR5_ALKOO        S------NVLADIGGFGGLFSLNIK-----D-YKEPVLVAGTDGVGTKLKIAFMMDKHDT
PUR5_ALKMQ        K------GVLGDIGGFGGLFALDPR-----E-MEKPILVAGTDGVGTKLKLAFMMNRHDT
PUR5_CLONN        K------GVINDLGSFAGMFEL--S-----G-YKTPVLVSGTDGVGTKLKIAFDMKKYDT
PUR5_CLOAB        P------GVINNLGSFAGMFEIG-S-----G-YKNPVLVSGTDGVGTKLAVAFATKKYDT
PUR5_CLOK5        P------GVLNGLGSFAGMFEL--G-----K-YKNPVLVSGTDGVGTKLKIAFEMKIYDT
PUR5_CLOTE        K------GVLNGIGSFAAMYEL--G-----K-YKNPVLVSGTDGVGTKLKIAFELEKYNT
PUR5_CLOPE        E------YVLNGLGSFAGMIELP-E-----G-YKKPVLVSGTDGVGTKLDIACKKRKFDT
PUR5_FUSNN        K------SVLTNLGSFGAMYEL--G-----Q-YKNPVLISGTDGVGTKLEIAMKQKKYDT
PUR5_CALS8        S------NVITDIGSFGSMYLLN-I-----E-NSDYILVSGTDGVGTKLKIAFYMDKHDT
PUR5_FINM2        K------EVLTGIGGFAGLFKPELT-----D-MKEPVLVSGTDGVGTKIKLAMELDKHDT
PUR5_GEODF        P------EVLADIGGFGGLFSLSSG-----K-YKNPVLVSGTDGVGTKLKIAFLADRHDT
PUR5_GEOUR        P------EVIADIGGFGGLFSLNSS-----K-YKNPVLVSGTDGVGTKLKIAFLANRHDT
PUR5_GEOBB        P------EVLADIGGFGGLFSLNMG-----K-YKHPVLVSGTDGVGTKLKLAFLADRHDT
PUR5_GEOMG        P------EVISDIGGFGGLFSLNTN-----K-YKNPVLVSGTDGVGTKLKIAMMADRHDT
PUR5_GEOSL        P------EVISDIGGFGGLFSLNTN-----K-YRNPVLVSGTDGVGTKLKIAMMADRHDT
PUR5_GEOLS        P------EVMTEIGGFGGLFSLNAA-----K-YKNPVLVSGTDGVGTKLKLAFLADRHDT
PUR5_PELCD        P------EVLTDIGGFGGLFSLHAD-----K-YKKPTLVASTDGVGTKLKLAFMMDKHDT
PUR5_SYNAS        K------EVMKGIGGFGGLFHLDLK-----K-IKDPVLVAATDGVGTKIKIAQMMNKHDT
PUR5_DESAL        Q------GVIGGIGGFGGLFSLNTE-----Q-YERPVLVSSTDGVGTKLRVAIMMDKHDT
PUR5_DESPS        N------GVIDNIGGFSAHIAIDVT-----K-YPKPVIVNSTDGVGTKLAIAHMCNKHDT
PUR5_DESAG        K------GVISDIGGFGGLFKPDLG-----G-MEDPVLVSSTDGVGTKLKLAFMFDKHDT
PUR5_DESVM        N------GVISDIGGFGGLFKPDLA-----G-MDEPVLVSSTDGVGTKLKCAFQFGKHDT
PUR5_LAWIP        Q------GVLSDLGGFGGLFKLNLT-----Q-VDNPVLVSSTDGVGTKLKFAFDFNKHDT
PUR5_PSELT        D------GVLGDIGNFGAFFQLDG------S-LRQPVLVSGADGVGTKLKVAFMMDKHDT
PUR5_CALS4        E------GVLEGIGGFAALYEIK-------N-YKNPVLVSSTDGVGTKLKIAFMMDKHDT
PUR5_THEYD        K------EVLTEIGLFAGLFKFDVK-----K-YKEPVLVSGTDGVGTKLKIAFEADKHDT
PUR5_CARHZ        P------NVLAGIGGFSALYCLDVT-----G-YNEPVLVSSTDGVGTKLKIAQALGKYDT
PUR5_MOOTA        P------GVLGDLGGFGGLFALEAG-----R-YRQPVLVAGTDGVGTKLKIAFSLDRHDT
PUR5_DESHY        P------EVMGGLGGFGGLFALDLK-----K-YPEPVLVSGTDGVGTKLKLAFQMNRHDT
PUR5_SYNWW        P------EVLSGIGSFGGFFALDLQ-----K-YQEPVLVSGTDGVGTKLRIAQMMGVHDS
PUR5_METS3        YRDI--ITDS---GHYAALVRLGDK-----------AIAMSTDGVGSKILIAEMMNKYDT
PUR5_METTH        YCDV--ITGA---GHFAALVRMGDV-----------AIAMSTDGVGSKILVAEMMNRYDT
PUR5_METJA        RSD---IKPAELGLHYAGAVEFGDY-----------YLVLSTDGVGSKMIVAEMANKFDT
PUR5_METMP        RTDA--IKPADLKGHYAGAIEFGDY-----------YLVLCTDGVGSKMVVAEMANKFDT
PUR5_METKA        EPEG--CREVEGIGHYAAVLEVHGE-----------LLTLNVDGVGSKVLVAQLVGRYDT
PUR5_METAC        RKGI--GAPLTGIGHYAGLLDFGEY-----------ALAMTTDGVGSKVLIANEMKRWNT
PUR5_METMA        RKGI--GAPLTGIGHYAGLLDFGEY-----------ALAMTTDGVGSKVLIANEMQRWNT
PUR5_METBF        RKGM--GAPLTGIGHYAGLLDFGEY-----------ALALTTDGVGSKVLIANEMQRWNT
PUR5_METBU        REGI--GAPLTSIGHYAGLIDFGEY-----------ALAMATDGVGSKVLIANEMKRWNT
PUR5_ARCFU        RSGF--GRPILT-SHYAGVIDCGDF-----------GITITTDGVGSKILVAEKMRKFDT
Q5V4T0_HALMA      KGD------------YAGLVDIGDQ-----------YLALATDGVGTKLLVAEAVDDYST
B0R4C5_HALS3      TDDT--A--------YAGLVDLGDQ-----------YLALATDGVGTKLLVAEAVGDYST
G0LLI6_HALWC      AGD------------YAGLIDIGDR-----------YLALATDGVGTKLLVAAAMSEYST
PUR5_PYRFU        FRKGKLGEPG-DIGHYSALLDFGNY-----------YLAITTDGVGTKVLVAEAVGKFDT
PUR5_THEKO        FRRGKLGEPAEDLGHYAALMDFGDF-----------YLAITTDGVGTKVLVAEAVGKFDT
PUR5_SULTO        --------GVLKIGHYANAIKLDDK-----------YLAMHVDGVGTKTILALKTGIIEP
Q4J8F5_SULAC      --------LEVGIGHYAGVIKFDDK-----------YLAMHVDGVGTKTLLALKTGIIEP
PUR5_SACS2        N-------TIIGAGHYSGVIKIGSL-----------NIAMHTDGVGTKTFLALQTRIIKP
PUR5_THEAC        DFKN-----IGYIGGFTSIIDMGNF-----------GITFNNDGVGTKAMIAEAVNKYDT
                                 :                     :    ** *:*   *        

PUR5_RHOBA        VGIDLVAMCVNDLICTGAEPLFFLDYVAMGRDDPARLERIVQGISDGCVDGDLALLGGET
PUR5_LEPIN        IGIDLVAMCVNDILVCGGEPLFFLDYIACGKLDPEKMDQIVSGIVQGCKMSNASLLGGET
PUR5_ACTSZ        IGIDLVAMCVNDLVVQGAEPLFFLDYYATGKLDVDVAADVVKGIAEGCVQSSCALVGGET
PUR5_MANSM        IGIDLVAMCVNDLVVQGAEPLFFLDYYATGKLDVDVATDVVAGIAEGCVQSGCALIGGET
PUR5_HISS2        IGVDLVAMCVNDLVVQGAEPLFFLDYYATGKLDVDVAADVIKGIADGCVQAGCALVGGET
PUR5_PASMU        IGIDLVAMCVNDLVVQGAEPLFFLDYYATGKLDVDVAASVIKGIANGCEQSGCALVGGET
PUR5_ACTP2        IGQDLVAMCVNDLVVQGAEPLFFLDYYATGKLEVDVAADVIKGIADGCEISGCALVGGET
PUR5_HAEIN        IGQDLVAMCVNDLIVQGAEPLFFLDYYATGKLDVDVAASVIKGIADGCEMSGCALVGGET
PUR5_HAEPS        IGIDLVAMCVNDLVVQGAEPLFFLDYYATGKLDVDVASSVIKGIANGCEQSCCALVGGET
PUR5_ECOLI        IGIDLVAMCVNDLVVQGAEPLFFLDYYATGKLDVDTASAVISGIAEGCLQSGCSLVGGET
PUR5_SHIDS        IGIDLVAMCVNDLVVQGAEPLFFLDYYATGKLDVDTASAVISGIAEGCLQSGCSLVGGET
PUR5_ENT38        IGIDLVAMCVNDLVVQGAEPLFFLDYYATGKLDVDTAASVITGIAEGCLQSGCSLVGGET
PUR5_KLEP7        IGIDLVAMCVNDLVVQGAEPLFFLDYYATGKLDVDTAASVINGIAEGCLQSGCALVGGET
PUR5_SALTY        IGIDLVAMCVNDLVVQGAEPLFFLDYYATGKLDVDTAASVINGIAEGCLQSGCALVGGET
PUR5_CROS8        IGIDLVAMCVNDLVVQGAEPLFFLDYYATGKLDVDTAASVINGIAEGCLQSGCALVGGET
PUR5_ERWT9        IGIDLVAMCVNDLVVSGAEPLFFLDYYATGKLDVDTAASVITGIAEGCSQSGCALVGGET
PUR5_PECAS        IGIDLVAMCVNDLVVQGAEPLFFLDYYATGKLDVDTAASVITGIAEGCKQSGCALVGGET
PUR5_YERPE        IGIDLVAMCVNDLVVQGAEPLFFLDYFATGKLDVDTAASVITGIAEGCKQSGCALVGGET
PUR5_PHOLL        IGIDLVAMCVNDLVVQGAEPLFFLDYYATGKLDVDTAASVISGIAEGCQLSGCALVGGET
PUR5_SODGM        IGIDLVAMCVNDLVVQGAEPLFFLDYYATGKLDVDTAAAVITGIAEGCKQSGCALVGGET
PUR5_EDWI9        IGIDLVAMCVNDLVVQGAEPLFFLDYYATGKLDVDTAASVISGIAAGCKQAGCALVGGET
PUR5_PROMH        IGIDLVAMCVNDLIVQGAEPLFFLDYYATGKLDVDTAARVVTGIAEGCKQSGCALVGGET
PUR5_HAMD5        IGIDLVAMCVNDLIVQGAEPLFFLDYFATGQLDVETAACVIAGIAEGCQQAGCALVGGET
PUR5_VIBPA        IGIDLVAMCVNDLIVQGAEPLFFLDYYATGKLDVDTAADVVSGIADGCVQAGCALIGGET
PUR5_VIBVY        IGIDLVAMCVNDLIVQGAEPLFFLDYYATGKLDVDVAADVISGIAEGCIQAGCALIGGET
PUR5_VIBA3        IGIDLVAMCVNDLIVQGGEPLFFLDYYATGKLDVDTAADVVSGIAEGCVQAGCALIGGET
PUR5_ALIF1        IGIDLVAMCVNDLIVQGAEPLFFLDYYATGKLDVDVAAEVVTGIGEGCIQAGCALIGGET
PUR5_VIBCH        IGIDLVAMCVNDLIVQGAEPLFFLDYYATGKLDVDTAAEVISGIADGCLQAGCALIGGET
PUR5_PHOPR        IGIDLVAMCVNDLIVQGGEPLFFLDYYATGKLDVDTAASVVAGIGEGCIQAGCALIGGET
PUR5_SHEWM        VGIDLVAMCSNDLIVSGAEPLFFLDYYATGKLDVDAATAVVKGIAEGCVQSGCALIGGET
PUR5_SHEPA        VGVDLVAMCSNDLIVSGAEPLFFLDYYATGKLDVEVATAVVKGIAEGCVQSGCALIGGET
PUR5_SHEON        VGIDLVAMCVNDLIVQGAEPLFFLDYYATGKLDVETATAVVNGIGEGCFQSGCALIGGET
PUR5_SHEAM        VGIDLVAMCVNDLIVQGAEPLFFLDYYATGKLDVETATSVVNGIGEGCFQSGCALIGGET
PUR5_SHEDO        VGIDLVAMCVNDLIVQGAEPLFFLDYYATGKLDVDTATSVVNGIGEGCFQSGCALIGGET
PUR5_SHELP        VGVDLVAMCVNDLIVAGAEPLFFLDYYATGKLDVATATSVVNGIAEGCAQSGCALIGGET
PUR5_SHEFN        VGVDLVAMCVNDLIVSGAEPLFFLDYYATGKLDVETATSVVSGIAEGCFQSGCALIGGET
PUR5_AERHH        VGIDLVAMCVNDLIVQGAEPLFFLDYYATGKLDVDTAAAVVTGIGAGCEQSGCALVGGET
PUR5_TOLAT        VGIDLVAMCVNDLIVQGAEPLFFLDYYATGKLDVDTAAAVVTGIGAGCEQSNCALVGGET
PUR5_IDILO        VGIDLVAMCVNDLIVQGAEPLFFLDYYATGKLDVDVAADVVAGIGDGCEQSGCALIGGET
PUR5_PSET1        VGIDLVAMCVNDLIVQGAEPLFFLDYYATGKLDVDTAADVVTGIGKGCEISGCALIGGET
PUR5_COLP3        VGIDLVAMCVNDLIVQGAEPLFFLDYYATAKLDVAVASSVVEGIAEGCIQSGCALVGGET
PUR5_ALTMD        VGIDLVAMCVNDLIVQGAEPLFFLDYYATGKLDVDVAASVVTGIGAGCEQAGCALIGGET
PUR5_PSEA6        IGIDLVAMCVNDLIVQGAEPLFFLDYYATGKLDVDTAAKVVTGIGKGCELSGCALIGGET
PUR5_ALCBS        VGVDLVAMCVNDLIVGGAEPLFFLDYYATGKLDVEIATSVVTGIGEGCELAGCALIGGET
PUR5_SACD2        IGIDLVAMCVNDLIVGGAEPLFFLDYYATGKLSVDVAASVVEGIGAGCELSGCSLVGGET
PUR5_TERTT        IGIDLVAMCVNDLIVGGAEPLFFLDYYATGKLSVDIAAQVVEGIGNGCELAGCSLVGGET
PUR5_HAHCH        IGIDLVAMCVNDLIVQGAEPLFFLDYYATGKLSVDVAATVVTGIGEGCSQAGCSLVGGET
PUR5_MARHV        IGIDLVAMCVNDLVVGGAEPLFFLDYYATGKLNVDVAAQVVEGIGQGCEQAGCALVGGET
PUR5_PSEFS        IGIDLVAMCVNDLVVCGAEPLFFLDYYATGKLNVDTAAQVVTGIGAGCELSGCSLVGGET
PUR5_PSEF5        IGIDLVAMCVNDLVVCGAEPLFFLDYYATGKLNVDTAAQVVTGIGAGCELSGCSLVGGET
PUR5_PSESM        IGIDLVAMCVNDLVVCGAEPLFFLDYYATGKLNVDTAAQVVTGIGAGCELAGCSLVGGET
PUR5_PSEMY        IGQDLVAMCVNDLVVCGAEPLFFLDYYATGKLNVDVAATVVTGIGAGCELAGCSLVGGET
PUR5_PSEPK        IGQDLVAMCVNDLVVCGAEPLFFLDYYATGKLNVDVAATVVTGIGAGCELAGCSLVGGET
PUR5_PSEAE        IGQDLVAMCVNDLVVCGAEPLFFLDYYATGKLNVDVAATVVTGIGAGCELAGCSLVGGET
PUR5_AZOVD        IGIDLVAMCVNDLVVCGAEPLFFLDYYATGKLNVDVAARVVAGIGEGCEMAGCALVGGET
PUR5_CHRSD        IGIDLVAMCVNDLVVAGAEPLFFLDYYATGKLDVDIAADVVTGIGEGCAQAGCALIGGET
PUR5_ACIAD        IGQDLVAMCVNDLLVCGAEPLFFLDYYATGHLNVDVAANVVTGIGKGCELAGCALVGGET
PUR5_PSYA2        IGIDLVAMCVNDLLVCGAEPLFFLDYYATGKLDVDVAATVVTGIGEGCKLSNCALIGGET
PUR5_HYDCU        VGIDLVAMCVNDLIVQGAEPLFFLDYYATGKLDIYTARDVVAGIGEGCQQSGCALIGGET
PUR5_METCA        VGIDLVAMCANDIVVQGAEPLFFLDYYATGKLDVDVAASVIAGIAQGCERAGCALVGGET
PUR5_NITOC        IGIDLVAMCANDIIVQGAEPLFFLDYYATGRLEVDIAAEIIEGIAHGCELAGVALVGGET
PUR5_ALKEH        IGIDLVAMCANDVLVTGAEPLYFLDYYATGRLDVEVAAAVIRGIAEGCHQAGAALIGGET
PUR5_COXBU        IGIDLVAMCVNDVITTGAEPLFFLDYYATGHLNNEQAKQILTGIGAGCELAEVALIGGET
PUR5_BURCJ        VGQDLVAMSVNDILVQGAEPLFFLDYFACGKLDVDTAATVVKGIAQGCELSGCALIGGET
PUR5_BURVG        VGQDLVAMSVNDILVQGAEPLFFLDYFACGKLDVDTAATVVKGIAHGCELSGCALIGGET
PUR5_BURPS        VGQDLVAMSVNDILVQGAEPLFFLDYFACGKLDVETAATVVKGIATGCELAGCALIGGET
PUR5_PARPJ        VGQDLVAMSVNDILVQGAEPLFFLDYFACGKLDVGTAATVVKGIAHGCELSGCALIGGET
PUR5_PARXL        VGQDLVAMSVNDILVQGAEPLFFLDYFACGKLDVGTAATVVKGIAYGCELSGCALIGGET
PUR5_PARP8        VGQDLVAMSVNDILVQGAEPLFFLDYFACGKLDVGTAATVVKGIAQGCELAGCALIGGET
PUR5_CUPMC        VGQDLVAMSVNDILVQGAEPLFFLDYFACGKLDVETAATVIKGIAHGCELAGCALIGGET
PUR5_CUPNH        VGQDLVAMSVNDILVQGAEPLFFLDYFACGKLDVDTAATVIQGIARGCELAGCALIGGET
PUR5_RALSO        VGQDLVAMSVNDILVQGAEPLFFLDYFACGKLDVDTAATVIKGIAQGCELAGCALIGGET
PUR5_AZOSB        VGQDLVAMSVNDILVQGAEPLFFLDYFACGKLDVDTAADVVKGIAHGCELAGCALIGGET
PUR5_AROAE        VGQDLVAMSVNDILVQGAEPLFFLDYFACGKLDVDTAAAVVSGIARGCELSGCALIGGET
PUR5_BORA1        VGIDLVAMSVNDILVQGAEPLFFLDYFACGKLSVDTAAAVVGGIARGCELAGCALIGGET
PUR5_BORPE        VGIDLVAMSVNDILVQGAEPLYFLDYFACGKLSVDTAAAVVGGIARGCELAGCALIGGET
PUR5_BORPD        VGVDLVAMSVNDILVQGAEPLFFLDYFACGKLSVDTAAAVVGGIARGCELAGCALIGGET
PUR5_DECAR        VGQDLVAMSVNDILVLGAESLFFLDYFACGKLDVDTAAAVVGGIAKGCELAGCALIGGET
PUR5_METFK        VGIDLVAMSVNDILVQGAEPLFFLDYFACGKLDVDTAAQVVQGIAAGCEQSGCALVGGET
PUR5_CHRVO        VGIDLVAMSVNDILVQGAEPLFFLDYFACGKLDVAQATEVIKGIAAGCEQAGCALTGGET
PUR5_LARHH        VGIDLVAMSVNDILVQGAEPLFFLDYFACGKLDVAQATDVIKGIAEGCEQAGCALIGGET
PUR5_NEIMB        VGIDLVAMSVNDILVQGAEPLFFLDYFACGKLDVPRATDVIKGIAQGCEESGCALIGGET
PUR5_NEIG1        VGIDLVAMSVNDILVQGAEPLFFLDYFACGKLDVPRATDVIKGIAQGCEESGCALIGGET
PUR5_NITMU        VGIDLVAMSVNDILVQGAEPLFFLDYFACGKLDVDTATLVVKGIAAGCEQAGCALIGGET
PUR5_NITEU        IGIDLVAMSVNDILVQGAEPLFFLDYFACGKLDVEIATQVVQGIAHGCEDAGCALIGGET
PUR5_POLSJ        VGIDLVAMSVNDVLVQGAEPLFFLDYFACGKLDVDTAAAVVGGIAKGCELSGCALIGGET
PUR5_RHOFT        VGIDLVAMSVNDVLVQGAEPLFFLDYFACGKLDVDTAAAVVGGVAKGCELSGCALIGGET
PUR5_XANOR        IGIDLVGMCVNDVLVQGAEPLFFLDYFATGKLDVDTAAAVVGGIARGCALSGCALIGGET
PUR5_XANCP        IGIDLVGMCVNDVLVQGAEPLFFLDYFATGKLDIDTAAAVVGGIARGCELSGCALIGGET
PUR5_STRMK        IGIDLVAMCVNDVLVQGAEPLFFLDYFATGKLDIDTAAAVVGGIANGCTEAGCALIGGET
PUR5_XYLFA        IGIDLVAMCVNDVLVQGAEPLFFLDYFATGKLDIDTATAVISGIALGCEQSGCALIGGET
PUR5_OCHA4        VGIDLVAMCVNDLVVQGAEPLFFLDYFATGKLSPDQGVDIVAGIAEGCRQAGSALIGGET
PUR5_BRUA2        VGIDLVAMCVNDLVVQGAEPLFFLDYYATGKLSPDQGVAIVSGIAEGCRQAGCALIGGET
PUR5_AGRRK        VGIDLVAMCVNDLVVQGAEPLFFLDYFATGKLDPDQGAAIVGGIAAGCREAGCALIGGET
PUR5_RHIEC        VGIDLVAMCVNDLVVQGAEPLFFLDYFATGKLVPDQGAAIVGGIAAGCREAGCALIGGET
PUR5_AGRFC        VGIDLVAMCVNDLVVQGAEPLFFLDYFATGKLDPDQGAAIVSGIAAGCRESGCALIGGET
PUR5_AGRVS        VGIDLVAMCVNDLVVQGAEPLLFLDYYATGKLDPNQGAAIVGGIAAGCREAGCALIGGET
PUR5_RHIME        VGIDLVAMCVNDLVVQGAEPLFFLDYFATGKLDPDQGAAIVAGIAAGCREAGCALIGGET
PUR5_SINFN        VGIDLVAMCVNDLVVQGAEPLFFLDYFATGKLDPDQGAAIVAGIAAGCREAGCALIGGET
PUR5_RHILO        IGIDLVAMCVNDIVVQGAEPLFFLDYFATGKLDPDQGAAIVGGIAEGCRQAGCALIGGET
PUR5_CHESB        VGIDLVAMCVNDLVVQGAEPLFFLDYFATGKLDPDQGAAIVAGIAEGCRQAGCALIGGET
PUR5_BARHE        IGIDLVAMCVNDLLVQGAEPLFFLDYFATGKLDPEQGAAIVSGIAKGCQQAGAALIGGET
PUR5_METNO        IGIDLVAMCVNDIVVQGAEPLFFLDYYATGKLVPGVGADIVRGIAEGCRQAGCALIGGET
PUR5_METS4        IGIDLVAMCVNDIVVQGAEPLFFLDYYATGKLVPGVGAAIVTGIAEGCRQAGCALIGGET
PUR5_METSB        IGIDLVAMCVNDLIVQGAEPLFFLDYYASGKLDGAAAAAVVKGIANGCIEAGAALIGGET
PUR5_BEII9        IGVDLVAMCVNDLIVQGAEPLFFLDYYATGKLEPATAASVVKGIADGCREAGCALIGGET
PUR5_NITWN        IGIDLVAMSVNDLVVQGAEPLFFLDYFACGKLDPETAAAIVAGIAEGCREAGCALIGGET
PUR5_NITHX        IGIDLVAMSVNDLVVQGAEPLFFLDYFACGKLDPEVASAIVAGIAVGCREAGCALIGGET
PUR5_RHOPA        IGIDLVAMSVNDLVVQGAEPLFFLDYFACGKLDPEAAAEIVAGVAEACRESGCALIGGET
PUR5_RHOPB        IGIDLVAMSVNDLVVQGAEPLFFLDYFACGKLDPVATAAIVAGIAEGCRDSGCALIGGET
PUR5_PARL1        VGIDLVAMSVNDLVVQGAEPLFFLDYYATGKLHVDVARDVVAGIAEGCRQAGCALIGGET
PUR5_RUEST        VGIDLVAMCVNDLVCQGAEPLFFLDYFATGKLETDVAARIIEGIAEGCVRSGCALIGGET
PUR5_RUEPO        VGIDLVAMCVNDLVCQGAEPLFFLDYFATGKLETDTAARIIEGIAEGCVQSGCALIGGET
PUR5_ROSDO        VGIDLVAMCVNDLVCQGAEPLFFLDYFATGALETDKAARIIEGIALGCERAGCALIGGET
PUR5_RHOS4        IGIDLVAMCVNDLVCQGAEPLFFLDYFATGKLEVAQAARIIEGIAEGCAASGCALIGGET
PUR5_DINSH        IGIDLVAMCVNDLVCQGAEPLLFLDYFATGKLDVAEAATIVEGIARGCATSGCALIGGET
PUR5_JANSC        IGVDLVAMCVNDLVCQGAEPLFFLDYFATGKLDVDDAARIVEGIAAGCKASGCALIGGET
PUR5_RHORT        VGIDLVAMCVNDLVVQGGEPLLFLDYFATSRLQVPVASAVVKGIAEGCLQAGCALVGGET
PUR5_ERYLH        VGIDLVAMCVNDLIVQGAEPLFFLDYFATGKLQNGVAERVIAGIAEGCKLAGCALIGGET
PUR5_NOVAD        IGIDLVAMCVNDLIVQGAEPLFFLDYFATGRLDNGVAERVVAGIADGCKLAGCALIGGET
PUR5_SPHAL        VGIDLVAMCANDLIVQGAEPLFFLDYYATGKLDNDVATAVVASIAEGCKQAGCALIGGET
PUR5_MAGMM        VGIDLVAMSVNDLVVQGAEPLFFLDYFACGKLSPETAATVVEGIATGCRAAGCALIGGET
PUR5_ANADE        VGIDLVAMCVNDIAVVGAEPLFFLDYYATGKLSAEQGAEVVKGIAEGCRQAGCALIGGET
PUR5_ANADF        IGIDLVAMCVNDVAVVGAEPLFFLDYFGTGKLSAEQGAEVVKGIAEGCRQAGCALIGGET
PUR5_MYXXD        VGIDLVAMSVNDILTCGAEPLFFLDYFATGRLEVDDAAEVVKGIALGCEQAGCALLGGET
PUR5_SORC5        VGIDLVAMCVNDVLTVGARPLFFLDYFATGKLDVDVGEAVVRGIAEGCKQAGCALIGGET
PUR5_SYMTH        VGIDLVAMSVNDILCQGAEPLFFLDYIGIGQKDLAVLEQVVKGIADGCLQAGCALIGGET
PUR5_RIPO1        IGIDLVAMCVNDVLTCGAEPLFFLDYLATGKLNPQQLSDVVQGIVEGCRLSGCALLGGET
PUR5_CROS5        IGIDLVAMCVNDILTSGAKPLFFLDYLATGKLNPQQLSDVVTGIVEGCHLSDCALLGGET
PUR5_MICAN        VGIDLVAMCVNDVLTSGAEPLFFLDYLATGKLEASQLAAVVSGIARACRDSGCTLLGGET
PUR5_GLOC7        VGIDLVAMCVNDVLTSGAQPLFFLDYLATGQLNPQQLAEVVEGIVEGCHLSHCALLGGET
PUR5_SYNY3        IGIDLVAMCVNDILTTGAEPLYFLDYLATGKLEPAQLADVVTGIVEGCKQSGCALLGGET
PUR5_SYNP2        VGIDLVAMCVNDILTSGAEPLFFLDYLATGKLEPEQLAQVVAGIVEGCKQSGCALLGGET
PUR5_SYNE7        IGIDLVAMCVNDILTAGAEPLYFLDYLATGRLDREQLTAVVQGIAAGCRESGCALLGGET
PUR5_CYAP4        IGIDLVAMCVNDVLTCGAEPLFFLDYLATGHLEPEALTDVIAGIAQGCQQAGCALLGGET
PUR5_THEEB        VGIDLVAMCVNDVLTCGAEPLFFLDYIACGRLAPEMMNAVVAGIAQGCEAAGCALLGGET
PUR5_SYNJB        VGVDLVAMCANDVLTVGARPLFFLDYVATGKLEPEALWQVIDGILAGCQEAGCQLLGGET
PUR5_GLOVI        IGIDCVAMCVNDVLAQGAEPLFFLDYLATGKLSPAQLAGVVEGIAAGCLEAGCTLLGGET
PUR5_PROMA        VGIDLVAMCVNDVITSGAEPLFFLDYIATGKLTPEALTEVIEGIAEGCNQSKCSLLGGET
PUR5_PROMT        VGIDLVAMCVNDVITNGARPLFFLDYIASGTLTPDALAEVIEGIAAGCCQSDCSLLGGET
PUR5_SYNPW        VGIDLVAMCVNDVITSGAEPLFFLDYMATGALSPDAMAEVVEGIADGCRQSGCALLGGET
PUR5_SYNPX        VGIDLVAMCVNDVITSGAQPLFFLDYMATGALSPDAMAEVVEGIADGCQQSGCSLLGGET
PUR5_PROMM        VGLDLVGMCVNDVITSGAEPLFFLDYIATGALSPEAMAQVVEGIAEGCRRSGCALLGGET
PUR5_SYNR3        VGIDLVAMCANDVITCGAEPLFFLDYIATGKLSPAAMAEVVEGIASGCSQSGCSLLGGET
PUR5_PROMP        VGIDLVAMCMNDIITTGAKPLFFLDYIATGKLEKNQLLEVINGIAHSCRENKCSILGGET
PUR5_BACAN        IGIDAVAMCVNDIVVQGAEPLFFLDYIACGKAEPSKIENIVKGISEGCRQAGCALIGGET
PUR5_BACCR        IGIDAVAMCVNDIVVQGAEPLFFLDYIACGKAEPSKIENIVKGISEGCRQAGCALIGGET
PUR5_GEOSW        IGIDCVAMCVNDIVVQGAEPLFFLDYIACGKAIPEKIAQIVKGIADGCVEAGCALIGGET
PUR5_GEOKA        IGIDCVAMCVNDIIVQGAEPLFFLDYIACGKAVPEKIAAIVKGVADGCVEAGCALIGGET
PUR5_BACSU        IGVDAVAMCVNDVLAQGAEPLFFLDYLAVGKADPVKIEQIVQGVAEGCEQSGSALVGGET
PUR5_BACLD        IGIDAVAMCVNDVLAQGAEPLFFLDYLAVGKADPVKIEEIVKGVAEGCVQSGSALVGGET
PUR5_BACP2        IGVDAVAMCVNDVLAQGAEPLFFLDYLAVGKADPVKIESIVKGVADGCEQSGSALVGGET
PUR5_LYSSC        IGVDCVAMCVNDIVAQGAEPLYFLDYVALGKAEPAKIEQIVKGVADGCVQSGAALIGGET
PUR5_BACHD        IGVDAVAMCVNDIVVQGAEPLYFLDYIACGKSEPARIEAIVKGIADGCEQAGCALIGGET
PUR5_BACSK        IGQDAVAMCVNDIVVQGAEPLYFLDYLACGKAVPEKIEAIVKGVADGCEIAGCALIGGET
PUR5_BREBN        IGIDAVAMCVNDVVVQGAEPLFFLDYLAVDKVIPEKIEAIVKGIAEGCSQSGCSLIGGET
PUR5_HUNT2        VGIDCVAMCVNDIVCSGAEPLFFLDYIALGKNRPEKVAQIVKGIADGCVEAGCALIGGET
PUR5_RUMCH        VGIDCVAMCVNDIICSGAEPLFFLDYIAVGKNYPEKVAAIVKGVAEGCVMSGCSLIGGET
PUR5_EUBE2        IGIDAVAMCVNDVVCAGGEPLFFLDYIACGKNYPEKIATIVGGVAEGCRQSECALIGGET
PUR5_AGARV        IGIDAVAMCVNDVACAGGEPLFFLDYIACGKNYPEKIATIVSGVAEGCKQSGCALVGGET
PUR5_LACP7        IGIDCVAMCVNDIACAGGEPLFFLDYIACGKNEPEKIATIVSGVAEGCKQSNAALIGGET
PUR5_BIFAA        IGIDCVAMCVNDIAAQGAEPLFFLDYIACGKNDPALLEQVVSGVADGCVQADCGLIGGET
PUR5_BIFLO        IGIDCVAMCVNDIAAQGAEPLFFLDYIACGKNDPALLEQVVAGVADGCVQAGSALVGGET
PUR5_BIFA0        IGIDCVAMCVNDVVAQGAQPLFFLDYIACGKNDPAVLEQVVSGVADGCVQAGAALIGGET
PUR5_STRGC        IGQDCVAMCVNDIIAAGAEPLYFLDYVATGKNEPAKLEQVVAGVAEGCVQAGAALIGGET
PUR5_STRR6        IGQDCVAMCVNDIIAAGAEPLYFLDYVATGKNEPAKLEQVVAGVAEGCVQAGAALIGGET
PUR5_STRT2        IGQDCVAMCVNDIIAAGAEPLYFLDYVATGKNEPAKLEQVIAGVAEGCVQSGVALIGGET
PUR5_STRA5        IGQDCVAMCVNDIIAAGAEPLYFLDYVATGKNEPAKLEQVVAGVAEGCVQASAALIGGET
PUR5_STRP1        IGQDCVAMCVNDIIAAGAEPLYFLDYIATGKNNPVKLEEVVSGVAEGCVQAGAALIGGET
PUR5_STRMU        IGQDCVAMCVNDIIAAGAEPLYFLDYIATGKNEPAKLEQVVAGVAEGCVQAGAGLIGGET
PUR5_STRU0        IGQDCVAMCVNDIIAAGAEPLYFLDYIATGKNEPAKLEQVVAGVAEGCVQAGAALIGGET
PUR5_LACLA        IGIDCVAMCVNDIIAAGAEPLYFLDYIATGKNIPEKLEQVVAGVAEGCLQAGAALIGGET
PUR5_ENTFA        IGIDCVAMCVNDVVAQGAEPLYFLDYLALGTVNPAKVEAIVAGVAAGCCEANAALIGGET
PUR5_LISMO        IGIDCVAMCVNDILAQGAEPLFFLDYIATGKTDPVKMEQIVKGVADGCEQAGAALIGGET
PUR5_LACSS        IGIDCVAMCVNDIVAQGAQPLYFLDYLATGKTDPDKIEDIVAGVLEGCKQANMALIGGET
PUR5_LACF3        IGIDVVAMCVNDVLAQGAEPLYFLDYIATGHNDPAKMADIVAGVAEGCRQAGAALIGGET
PUR5_LACRD        IGIDVVAMCVNDVLAQGAEPITFLDYIATGHNDPAKMAAIVSGVATGCREAGAALIGGET
PUR5_LACS1        IGIDCVAMCVNDILAQGAEPLYFLDYIATGKNDPDKIAQIVAGVAEGCRQAGTALIGGET
PUR5_LACDA        VGIDVVAMCVNDVLAQGAEPLFFLDYIACGHNDPALLASVVQGVAEGCKQAGASLIGGET
PUR5_LACAC        VGIDCVAMCVNDVLAQGAEPLFFLDYIACGHNDPERLADVVKGVAEGCKQSGSALIGGET
PUR5_STACT        IGIDAVAMCVNDILTTGAEPLYFLDYIATNKVVPEVIEQIVKGVSDGCEETNTALIGGET
PUR5_STAS1        IGIDAVAMCVNDILTTGAEPLYFLDYIATNKVVPEVIEQIVKGVSDGCEETNTALIGGET
PUR5_STAEQ        IGIDAVAMCVNDILTTGAEPLYFLDYIATNKVVPSTIEQIVKGISDGCEQTNTALIGGET
PUR5_STAA8        IGIDAVAMCVNDILTTGAEPLYFLDYIATNKVVPEVIEQIVKGISDACVETNTALIGGET
PUR5_MACCJ        IGIDAVAMCVNDILTTGAMPLYFLDYLALNKVDPVIVEQIVKGVADGCAESECALIGGET
PUR5_EXIS2        IGIDCVAMCVNDIIVQGAEPLYFLDYIALGKAIPAKIERIVAGVAEGCVQSGCTLIGGET
PUR5_EXISA        IGIDCVAMCVNDCLVHGAEPLYFLDYIATGKAEPAKLERIVAGVAEGCVQAGCALVGGET
PUR5_OCEIH        VGIDLVAMCVNDIIAQGGDPLFFLDYIACGENDPSRIEAIVSGIAEGCEQAGAALIGGET
PUR5_ALKOO        IGQDCVAMCVNDILCQGGKPLFFLDYVATGKLVGEKIAQIVGGIAEGCRKAGSALIGGET
PUR5_ALKMQ        IGEDCVAMCVNDILCQGAKPLFFLDYIATGKLKAEVVAEIVQGIANGCKKAGCALIGGET
PUR5_CLONN        VGIDCVAMCVNDILCHGAKPLFFLDYIACGKLEAENAADLVRGVSDGCIDAGCSLIGGET
PUR5_CLOAB        VGIDCTAMCVNDILCHGAKPVFFLDYIACGKLEAEVASDLVKGVSEGCSQAGCALIGGET
PUR5_CLOK5        VGIDCVAMCVNDILCHGAKPLFFLDYLACSNLEAEVAAELVKGISKGCMDAGCALIGGET
PUR5_CLOTE        IGIDCVAMCVNDILCHGAKPLFFLDYMACGKLKGEVAADIVKGVSDGCLRAGCALIGGET
PUR5_CLOPE        VGIDCVAMCVNDILCHGAKPLFFLDYIACGKLEAEVSSDLVKGVAEGCIKSQCSLIGGET
PUR5_FUSNN        VGIDCVAMCVNDVLCHGAKPLFFLDYLACGKLDAEVAAQLVSGVTEGCLQSYAALVGGET
PUR5_CALS8        VGIDCVAMCVNDILCHGAKPLFFLDYIACGKLKSEKVATIVKGVAEGCKIAGCSLVGGET
PUR5_FINM2        VGIDLVAMCVNDVLCQGAKPLFFLDYIATGSLKPAKMADLVRGVAEGCSQSECALIGGET
PUR5_GEODF        IGIDLVAMCVNDIIVQGAEPLFFLDYLATAKLYPGKGAAIIKGVAEGCLQAGCALIGGET
PUR5_GEOUR        IGIDLVAMCVNDIIVQGAEPLFFLDYLATAKLDPEKGASIIKGVSEGCIQAGCALIGGET
PUR5_GEOBB        IGIDLVAMCVNDIIVQGAEPLFFLDYLATAKLDPAKAASIIKGVSEGCVQAGCALIGGET
PUR5_GEOMG        VGIDLVAMCVNDIVVQGAEPLFFLDYFATGSLSPERGAAVVKGISEGCIQAGCALIGGET
PUR5_GEOSL        VGIDLVAMCVNDIIVQGAEPLFFLDYFATGKLDPQRGAAVVKGISEGCVQAGCALIGGET
PUR5_GEOLS        VGIDLVAMCVNDIVVQGAEPLFFLDYLATGKLDPDKAAQIVAGIAEGCRQAGCALIGGET
PUR5_PELCD        VGIDLVAMCVNDIVVQGAEPLFFLDYMATGKLTPEKAQDVVKGISEGCIQAGCALIGGET
PUR5_SYNAS        VGIDLVAMSVNDIIVQGAEPIFFLDYIAIGQMDVERNVKLIEGIVKGCQEAGCALIGGET
PUR5_DESAL        IGIDLVAMSVNDILVQGAKPLFFLDYLSMGKLNENTAADIIEGVAEGCRQANCALIGGET
PUR5_DESPS        IGIDLVAMCVNDLIVGGATPLSFLDYFAVGKLDIEVATEVVKGIAEGCKQAGCSLVGGET
PUR5_DESAG        VGIDLVAMSVNDVLVQGAKPLFFLDYFATGKLDVEAAAQVVSGVAEGCRQAQCALLGGET
PUR5_DESVM        VGIDLVAMSVNDILVQGARPLFFLDYFATGKLDVDVAASVISGVAEGCRRASCALLGGET
PUR5_LAWIP        VGIDLVAMCVNDILVQGARPLFFLDYFATSKLDVDKATQVIYGISEGCKQARCALLGGET
PUR5_PSELT        VGIDCVAMCVNDILVHGARPLFFLDYIAVGKLIPEKISQIVKGIAEGCTQAGCALIGGET
PUR5_CALS4        VGIDLVAMCVNDVIVVGAKPLFFLDYFATGKLESEKAIQVIKGVAEGCEIAGCALIGGET
PUR5_THEYD        VGIDLVAMCVNDILTVGAEPLFFLDYFATGKLNAAKATEVIKGIVQGCKEAGCALIGGET
PUR5_CARHZ        IGIDLVAMVVNDLLTVGAKPLFFLDYVAVGKLNPEQVADLVKGMAEGCLEADCALVGGET
PUR5_MOOTA        IGIDAVAMCVNDILVQGAEPLFFLDYLAVGKMVPERVARIVAGVAEGCRRAGCALIGGET
PUR5_DESHY        IGQDAVAMCVNDILVQGAEPLFFLDYLAVGKLVPERVAQVVGGIAKGCELAGCALIGGET
PUR5_SYNWW        VGIDLVAMCVNDILAHGAEPLFFLDYIAIGKLDPVLVELLVKGVSQGCLQAGCSLIGGET
PUR5_METS3        VGIDCIAMVVNDILCVGAEPIALVDYLAVEQPDPERAEEIAEGLVTGAKESRISIIGGET
PUR5_METTH        VGIDCIAMVVNDILCVGARPAALVDYLAVERPDPEVAGEIGKGLAMGAEMARVAIIGGET
PUR5_METJA        VGIDMIAMNVNDAICIGAEPIALVDYLAVGHITEEIAEQIGKGLNEGAKEANINIVGGET
PUR5_METMP        VPIDMIAMNVNDAICIGAEPVALVDYMAVEDITEDIASQIGKGLNDGIKESNINLIGGET
PUR5_METKA        VGIDAIAMNANDAVCLGARPLAFLDYLAMEDPDPDVCAEIAEGLGKGAREAGAPIVGGEL
PUR5_METAC        VGIDCIAMNVNDLLAIGAEPVAFVDYLALEKHEEGFAAQIGEGLLKGAEISRMSIVGGET
PUR5_METMA        VGIDCIAMNVNDLLAIGAEPVAFVDYLALEKHEEGFAEQIGEGLLKGAEISRMSIVGGET
PUR5_METBF        VGIDCIAMNVNDLLAIGAEPVAFVDYLALEKHEEGFAAQIGEGLVKGAEISRMSIVGGET
PUR5_METBU        VGIDCIAMNVNDLLAIGAEPISFVDYLALEKHSDDFASQIGEGLVKGAEISRMSIVGGET
PUR5_ARCFU        IGIDCVAMNVNDLLAIGSEPLAMVDYIAIEKPDEWIMAEIAKGLEEGCRIANITLLGGET
Q5V4T0_HALMA      IGIDCIAMNANDLIATGVEPVAFVDYLAVETPDEKTSEDIGAGLRTGAERADVALVGGET
B0R4C5_HALS3      VGIDCIAMNVNDLLAAGVEPAAFVDYLAVDEPNERRAAELGDGLAAGADAAGVALVGGET
G0LLI6_HALWC      IGIDCIAMNVNDLVAAGVRPVAFVDYLAIDDPDENLTEQIGVGLDTGADIADITLIGGET
PUR5_PYRFU        IGIDMIAMNVNDLICVGAEPIALVDYFAIKEPNERVFEEVAKGLYKGAKEAGIAIVGGET
PUR5_THEKO        IGIDMIAMNVNDLLCVGAEPVALVDYLAVKEPDERVFEGIAQGLYEGARQAGIAIVGGET
PUR5_SULTO        TGIDCIAMNVNDLVCIGARPLAGVDYLALEKPMDDVVEKVMKGLKQGADEANIEIIGGET
Q4J8F5_SULAC      TGVDCIAMNVNDIVCVGARPIAIVDYLALEGEMDDVIQKVMKGLKAGAEEAEVNIIGGET
PUR5_SACS2        VGIDCVAMNVNDLICVGAKPVALVDYIALERPMDNVVNEIIDGIVQGAKEADVEVIGGET
PUR5_THEAC        LGIDCVAMNVNDAITVGSEPIAMVDYLAVNKMDEEMAKQLGTGFNVGAQMANISIVGGET
                     *  .*  **    *  .   :** .           :  ..  .       : *** 

PUR5_RHOBA        AIMPDMYGTDD----YDLAGFAVGVVERKRLVDGHL-IAPGDVVLGLQASGLHSNGFSLV
PUR5_LEPIN        AEHPGTMKEDE----FDLAGFVVGAVEKDSMIDGST-IRSGDKILGLESSGPHSNGFSLI
PUR5_ACTSZ        AEMPGMYREGD----YDLAGFCVGVVEKSKILDGSK-VQAGDALIALASSGPHSNGYSLV
PUR5_MANSM        AEMPGMYHAGD----YDLGGFCVGVVERAKIIDGSK-VKTGDALIALGSSGPHSNGYSLI
PUR5_HISS2        AEMPGMYHTGD----YDLAGFCVGVVEKSEIIDGSN-VKAGDALLALASSGPHSNGYSLI
PUR5_PASMU        AEMPGMYHAGD----YDLAGFCVGVVEKSDIIDGSK-VRVGDVLIALGSSGPHSNGYSLI
PUR5_ACTP2        AEMPGMYHEGD----YDLAGFCVGVVEKSEIIDGSA-VKAGDVLLALASSGPHSNGYSLI
PUR5_HAEIN        AEMPGMYHEGD----YDLAGFCVGVVEKSEIIDGTA-VKTGDTLIALGSSGAHSNGYSLI
PUR5_HAEPS        AEMPGMYHAGD----YDLAGFCVGVVEKSEIIDGSK-VQVGDTLIALGSSGPHSNGYSLI
PUR5_ECOLI        AEMPGMYHGED----YDVAGFCVGVVEKSEIIDGSK-VSDGDVLIALGSSGPHSNGYSLV
PUR5_SHIDS        AEMPGMYHGED----YDVAGFCVGVVEKSEIIDGSK-VSDGDVLIALGSSGPHSNGYSLV
PUR5_ENT38        AEMPGMYHGED----YDVAGFCVGVVEKSEIIDGSK-VTDGDVLIALGSSGPHSNGYSLV
PUR5_KLEP7        AEMPGMYHGED----YDVAGFCVGVVEKSEIIDGSK-VTDGDVLVALASSGPHSNGYSLV
PUR5_SALTY        AEMPGMYHGED----YDVAGFCVGVVEKSEIIDGSR-VAEGDVLIALGSSGPHSNGYSLV
PUR5_CROS8        AEMPGMYHGDD----YDVAGFCVGVVEKSEIIDGSK-VADGDVLVALASSGPHSNGYSLV
PUR5_ERWT9        AEMPGMYHGED----YDVAGFCVGVVEKSEIIDGSK-VAEGDVLIALGSSGPHSNGYSLV
PUR5_PECAS        AEMPGMYHGED----YDVAGFCVGVVEKSEIIDGSK-VQHGDVLVALAASGPHSNGYSLV
PUR5_YERPE        AEMPGMYHGDD----YDVAGFCVGVVEKSEIIDGSK-VTPGDVLVALGASGPHSNGYSLV
PUR5_PHOLL        AEMPGMYHGED----YDVAGFCVGVVEKSEIIDGSK-VQAGDALIALAASGPHSNGYSLI
PUR5_SODGM        AEMPGMYHGED----YDVAGFCVGVVEKADIIDGSK-VQAGDTLLALAASGPHSNGYSLV
PUR5_EDWI9        AEMPGMYHGED----YDVAGFCVGVVEKSQIIDGSQ-VRPGDALIALGASGPHSNGYSLI
PUR5_PROMH        AEMPGMYHGND----YDIAGFCVGVVEKSQIIDGSK-VKAGDALIALASSGPHSNGYSLI
PUR5_HAMD5        AEMPGMYQAKD----YDLAGFCLGVVEKSKLINGHQNVKSGDTLLALASSGLHSNGYSLV
PUR5_VIBPA        AEMPGMYEGED----YDVAGFCVGVVEKEDVIDGTK-VAAGDALIAVGSSGPHSNGYSLI
PUR5_VIBVY        AEMPGMYEGED----YDVAGFCVGVVEKEDIIDGTK-VAVGDALIAVGSSGPHSNGYSLV
PUR5_VIBA3        AEMPGMYEGDD----YDVAGFCVGVVEKADIIDGTK-VAAGDALIAVGSSGPHSNGYSLI
PUR5_ALIF1        AEMPGMYEGED----YDVAGFCVGVVEKEDVIDGTK-VAAGDALIAVGSSGPHSNGYSLI
PUR5_VIBCH        AEMPGMYEGED----YDVAGFCVGVVEKEEIIDGSK-VQVGDALIAVGSSGPHSNGYSLV
PUR5_PHOPR        AEMPGMYHGED----YDVAGFCVGVVEKADIIDGSK-VQAGDALIAVGSSGPHSNGYSLV
PUR5_SHEWM        AEMPGMYEGDD----YDLAGFCVGVVEKEEIIDGTK-VVAGDSLIALGASGPHSNGFSLI
PUR5_SHEPA        AEMPGMYEGDD----YDLAGFCVGVVEKEEIIDGTK-VQDGDALIALASSGPHSNGFSLI
PUR5_SHEON        AEMPGMYEGED----YDLAGFCVGVVEKADIIDGSK-VAAGDALIALASSGPHSNGYSLV
PUR5_SHEAM        AEMPGMYEGED----YDLAGFCVGVVEKADIIDGTK-VKAGDALIALASSGPHSNGYSLI
PUR5_SHEDO        AEMPGMYEGED----YDLAGFCVGVVEKADIIDGTK-VSAGDALIALASSGPHSNGYSLI
PUR5_SHELP        AEMPGMYEGED----YDLAGFCVGVVEKEDVLDGSK-VVAGDALIALGSSGPHSNGYSLI
PUR5_SHEFN        AEMPGMYEGED----YDLAGFCVGVVEKADIIDGTK-VKAGDSLIALASSGPHSNGYSLI
PUR5_AERHH        AEMPGMYEGED----YDIAGFCVGVVEKSEIIDGSK-VGEGDALIALAASGPHSNGFSLV
PUR5_TOLAT        AEMPGMYEGED----YDMAGFCVGVVEASEIIDGSK-VAAGDALIALASSGPHSNGFSLI
PUR5_IDILO        AEMPGMYEGGD----YDLAGFCTGVVEKSEIIDGTK-VADGDALIALASSGPHSNGYSLI
PUR5_PSET1        AEMPGMYDGED----YDMAGFCTGVVEKSKIIDGTK-VAAGDQLIALASSGPHSNGFSLI
PUR5_COLP3        AEMPGMYHKGD----YDIAGFCVGVAEKSRLIDGTN-VAAGDQLIALGASGPHSNGFSLI
PUR5_ALTMD        AEMPGMYHDGD----YDIAGFCVGVVEADNVIDGTN-VKPGQKLIALGSSGPHSNGYSLV
PUR5_PSEA6        AEMPGMYHGND----YDVAGFCVGVVEAADVIDGSR-VKAGNVLIALGSSGPHSNGYSLV
PUR5_ALCBS        AEMPGMYEGED----YDLAGFCVGVVEKDGVLDGSK-VEAGDKLIGLGASGPHSNGYSLI
PUR5_SACD2        AEMPGMYEGED----YDLAGFCVGIVEKSKILDGSK-VAAGDVLLGIPSSGPHSNGYSLI
PUR5_TERTT        AEMPGMYEGDD----YDLAGFCVGIVEKAKIIDGSK-VATGDTLIGLPSSGPHSNGYSLI
PUR5_HAHCH        AEMPGMYEGDD----YDLAGFCVGIVEKSKIIDGSL-VKPGDVLIGLASSGVHSNGYSLV
PUR5_MARHV        AEMPGMYEGDD----YDLAGFCVGIVERDKIIDGSR-AQPGDSLLALGSSGPHSNGYSLI
PUR5_PSEFS        AEMPGMYEGED----YDLAGFCVGVVEKAEIIDGSK-VAAGDALLALPSSGPHSNGYSLI
PUR5_PSEF5        AEMPGMYEGED----YDLAGFCVGVVEKAEIIDGSK-VAAGDALLALPSSGPHSNGYSLI
PUR5_PSESM        AEMPGMYEGED----YDLAGFCVGVVEKAEIIDGSK-VAAGDALLALPSSGPHSNGYSLI
PUR5_PSEMY        AEMPGMYEGED----YDLAGFCVGVVEKSEIIDGSK-VATGDALIALPSSGPHSNGYSLI
PUR5_PSEPK        AEMPGMYEGED----YDLAGFCVGVVEKAEIIDGSK-VATGDALIALPSSGPHSNGYSLI
PUR5_PSEAE        AEMPGMYEGED----YDLAGFCVGVVEKAEIIDGSR-VQAGDALIALPSSGPHSNGYSLI
PUR5_AZOVD        AEMPGMYEGED----YDLAGFCVGVVEKSEIIDGAK-VAAGDALIALPSSGPHSNGYSLI
PUR5_CHRSD        AEMPGMYAGSD----YDLAGFCVGVVEKSEILDGSR-VAEGDVLLGLASSGPHSNGYSLI
PUR5_ACIAD        AEMPGMYEGED----YDLAGFAVGVVEQSKIIDGSK-VKAGDVLIGVASSGAHSNGYSLL
PUR5_PSYA2        AEMPGMYQDDD----YDLAGFCVGVVEEAEVITGEN-VTEGDVLIALASSGAHSNGYSLV
PUR5_HYDCU        AEMPGMYPDGD----YDLAGFCVGIVEKADLIDGTK-VKAGDVLLGLASSGPHSNGYSLI
PUR5_METCA        AEMPGMYAGGD----YDLAGFCVGVVEKEAIIDGSR-VRPGDRLIGLASSGPHSNGYSLI
PUR5_NITOC        AEMPGIYQAGD----YDLAGFCVGVVEKERLIDGSQ-VQAGDHLIGIASSGPHANGYSLI
PUR5_ALKEH        AEMPGMYAEGH----YDLAGFCVGVVEKDEIIDGSR-VGAGDALIALAASGPHSNGYSLI
PUR5_COXBU        AEMPGLYRQKD----YDLAGFCVGVVEKEKIIDGSR-VRVGDALIGIASSGPHSNGYSLI
PUR5_BURCJ        AEMPGMYPDGE----YDLAGFAVGAVEKSKIIDGS-TIAEGDVVLGLASSGIHSNGFSLV
PUR5_BURVG        AEMPGMYPDGE----YDLAGFAVGAVEKSKIIDGS-TIGAGDVVLGLASSGIHSNGFSLV
PUR5_BURPS        AEMPGMYPDGE----YDLAGFAVGAVEKSKIIDGS-TIAEGDVVLGLASSGIHSNGFSLV
PUR5_PARPJ        AEMPGMYPDGE----YDLAGFAVGAVEKSKIIDGS-TIAPGDVVLGLASSGIHSNGFSLV
PUR5_PARXL        AEMPGMYPDGE----YDLAGFAVGAVEKSKIIDGS-TIAPGDVVLGLASSGIHSNGFSLV
PUR5_PARP8        AEMPGMYPDGE----YDLAGFAVGAVEKSKIIDGS-KIVPGDVVLGLASSGIHSNGYSLV
PUR5_CUPMC        AEMPSMYPDGE----YDLAGFAVGAVEKKKIIDGS-TITPGDVVLGLASSGAHSNGYSLV
PUR5_CUPNH        AEMPSMYPDGE----YDLAGFAVGAVEKKKIIDGS-TITPGDVVLGLASSGAHSNGYSLV
PUR5_RALSO        AEMPSMYPAGE----YDLAGFAVGAVEKRKIIDGT-TIACGDVVLGLASSGAHSNGYSLV
PUR5_AZOSB        AEMPSMYPEGE----YDLAGFAVGAVEKADIIDGS-KIVPGDVVLGLASSGAHSNGYSLV
PUR5_AROAE        AEMHGMYPDGE----YDLAGFAVGAVEKSEIIDGS-RIVPGDVVLGLASSGAHSNGYSLI
PUR5_BORA1        AEMPGMYPDGE----YDLAGFAVGAVEKTAIIDGK-SIQPGDVVLGLASSGAHSNGYSLV
PUR5_BORPE        AEMPGMYPDGE----YDLAGFAVGAVDKSAIIDGK-SIQPGDVVLGLASSGAHSNGYSLV
PUR5_BORPD        AEMPGMYPDGE----YDLAGFAVGAVEKSAILDGK-SIQPGDVVLGLASSGAHSNGYSLV
PUR5_DECAR        AEMPGMYPAGE----YDLAGFAVGVVEKSKAIDGKASITPGDVVLGLASSGAHSNGYSLV
PUR5_METFK        AEMPGMYPAGE----YDLAGFVVGAADKDALIDGS-TIAEGDVVLGLASNGAHSNGYSLV
PUR5_CHRVO        AEMPGMYPAGE----YDLAGFAVGVVEKSKVISGR-DIVPGDVVLGLASNGVHSNGYSLV
PUR5_LARHH        AEMPGMYPVGE----YDLAGFAVGVVEKSQVITGR-DIRPGDVVLGLGSNGVHSNGFSLV
PUR5_NEIMB        AEMPGMYPVGE----YDLAGFAVGVVEKENVITGR-SIGVGDVVLGLASNGAHSNGYSLI
PUR5_NEIG1        AEMPGMYPVGE----YDLAGFAVGVVEKENVITGL-SIGAGDVVLGLASNGAHSNGYSLI
PUR5_NITMU        AEMPGMYPEGE----YDLAGFAVGAVEKDRIITGT-TIKAGDAVLGLASSGAHSNGYSLI
PUR5_NITEU        AEMPGMYPEGE----YDLAGFAVGVVEKDRIIDGS-GIRENDIVLGIASSGPHSNGFSLI
PUR5_POLSJ        AEMPGMYPEGE----YDLAGFAVGAVEKSKILTGK-EVQPGDVVLGLASSGVHSNGFSLV
PUR5_RHOFT        AEMPGMYPPGE----YDLAGFCVGAVEKSKILTGV-AIKPGDVVMGLASSGVHSNGFSLV
PUR5_XANOR        AEMPDMYPPGE----YDLAGFTVGAVEKSQLLDGA-QVRDGDVLIGIASSGPHSNGYSLI
PUR5_XANCP        AEMPDMYPPGE----YDLAGFTVGAVEKSQLLDGA-QVREGDVLIGIASSGPHSNGYSLI
PUR5_STRMK        AEMPDMYAPGE----YDLAGFTVAAVEKSELKDGA-SVAAGDVLIGIASSGPHSNGYSLV
PUR5_XYLFA        AEMPDMYPPGE----YDLAGFCVAAVEKSQLLDGS-QVREGDVLIGIASSGPHSNGYSLI
PUR5_OCHA4        AEMPGMYRDGD----YDLAGFAVGAAERDRLLPRGD-IAEGDVILGLASSGVHSNGFSLV
PUR5_BRUA2        AEMPGMYRDGD----YDLAGFAVGAAERDRLLPRGD-IAEGDIILGLASSGVHSNGFSLV
PUR5_AGRRK        AEMPGMYSDGD----YDLAGFAVGAAERGQLLPSGD-IAEGDVILGLASSGVHSNGFSLV
PUR5_RHIEC        AEMPGMYSSGD----YDLAGFAVGAAERGKLLPSGD-IAEGDVILGLASSGVHSNGFSLV
PUR5_AGRFC        AEMPGMYSDGD----YDLAGFAVGAAERGQLLPAGD-IAEGDVILGLSSSGVHSNGFSLV
PUR5_AGRVS        AEMPGMYSGGD----YDLAGFAVGAAERGQLLPAGD-IAEGDVILGLASSGVHSNGFSLV
PUR5_RHIME        AEMPGMYSGGD----YDLAGFAVGAAERGQLLPAGD-IAEGDVILGLASSGVHSNGYSLV
PUR5_SINFN        AEMPGMYSGGD----YDLAGFAVGAAERGQLLPAGG-IAEGDVILGLASSGVHSNGYSLV
PUR5_RHILO        AEMPGMYHGND----YDLAGFAVGAAERGQLLPTDD-IVEGDVLLGLASSGLHSNGFSLV
PUR5_CHESB        AEMPGMYRDGD----YDLAGFAVGAAERGRLLPTND-IVEGDVILGLASTGVHSNGFSLV
PUR5_BARHE        AEMPDMYAKGD----YDLAGFAVGAAERSALLPSKD-LTEGDIILGLSSSGIHSNGFSLV
PUR5_METNO        AEMPGLYDGSD----YDLAGFSVGAAERGALLPRPG-IAPGDLVLGLPSSGVHSNGFSLV
PUR5_METS4        AEMPGLYDGSD----YDLAGFAVGAAERGALLPTDG-VAPGDLVLGLPSSGVHSNGFSLV
PUR5_METSB        AEMPGLYAGAD----YDLAGFAVGAVERGALLPRSD-IAAGDVLLGLASSGAHSNGFSLI
PUR5_BEII9        AEMPGLYTGKD----YDLAGFAVGAVERGHLLPRTD-IAAGDLLLGLPSSGLHSNGFSLV
PUR5_NITWN        AEMPGLYKDGD----YDLAGFAVGAAERGSLLPGRD-IAAGDAVIGLASSGVHSNGYSLV
PUR5_NITHX        AEMPGLYKDGD----YDLAGFAVGAAERGTLLPGRD-IAAGDAVIGLASSGVHSNGYSLV
PUR5_RHOPA        AEMPGLYKDGD----YDLAGFSVGAAERGTLLPSKD-IAEGDAVIGLASSGVHSNGFSLV
PUR5_RHOPB        AEMPGLYTDGD----YDLAGFAVGAAERGTLLPGKD-IAAGDAVIGLASSGVHSNGFSLV
PUR5_PARL1        AEMPGMYAKGD----YDLAGFAVGAVERDGVLPRGD-VAPGDVLLGLASSGFHSNGFSLV
PUR5_RUEST        AEMPGMYPKGD----FDLAGFAVGAMERGTALPAG--VSEGDVLLGLASDGVHSNGYSLV
PUR5_RUEPO        AEMPGMYPAGD----FDLAGFAVGAMERGTALPEG--VVEGDVLLGLASNGVHSNGYSLV
PUR5_ROSDO        AEMPGMYPAGD----FDLAGFSVGAMERGAALPAH--VAQGDVLLGLASDGVHSNGYSLV
PUR5_RHOS4        AEMPGMYHKGD----FDLAGFAVGAMERGADLPQG--VAEGDLLLGLGSNGVHSNGYSFV
PUR5_DINSH        AEMPGMYAKGD----FDLAGFAVGAMERGGALPAN--VAAGDMILGLASDGVHSNGYSLV
PUR5_JANSC        AEMPGMYAPGD----FDLAGFSVGAMERGRALPDG--VAEGDVLLGLASDGVHSNGYSLV
PUR5_RHORT        AEMPGMYGNND----YDLAGFAVGAVERSQLLTDDR-IGLGDVLLGLASSGVHSNGFSLV
PUR5_ERYLH        AEMPGMYAEGD----YDLAGFCVGAVERGEQLTGTK-VAPGHVLLGLASSGIHSNGYSLV
PUR5_NOVAD        AEMPGMYADGD----YDLAGFCVGAVERGEQLTGDR-VAEGDVLLGLASSGVHSNGYSLV
PUR5_SPHAL        AEMPGMYSDGD----YDLAGFCVGAVERDRVLTSDK-VAAGDVILGLASSGVHSNGFSLV
PUR5_MAGMM        AEMPGFYTEGE----YDLAGFAVGAVDKHKIIDGRH-ISPGDAIIGLASSGPHSNGYSLI
PUR5_ANADE        AELPGFYARGE----YDLAGFAVGCVDRPRIVDGTR-VARGDVVIGIASSGLHSNGFSLA
PUR5_ANADF        AELPGFYAPGE----YDLAGFAVGCVERSRIVDGKG-VAPGDVVVGVASTGLHSNGYSLA
PUR5_MYXXD        AEMPGFYARGE----YDLAGFCVGVVERAAIIDGKS-VKPGDALIGLPSSGLHSNGYSLA
PUR5_SORC5        AELPGMYADGE----YDLAGFAVGVVERSRILDGKR-IAAGDAVIGVASSGLHSNGFSLA
PUR5_SYMTH        AELPGMYPPGE----YDLAGFAVGIVNRDRLLTGEK-VAPGDALVGLASSGLHANGYSLA
PUR5_RIPO1        AEMPGFYPVGE----YDVAGFCVGIVEKSKILDGSQ-VNIGDIAIGLASSGVHSNGFSLV
PUR5_CROS5        AEMPGFYGVGE----YDVAGFCVGVVEKANLLDGSQ-INIGDVAIGLSSSGVHSNGFSLV
PUR5_MICAN        AEMPGFYSAGE----YDLAGFCVGIVEKSQLLDGSK-VQIGDVAIGLASSGVHSNGFSLV
PUR5_GLOC7        AEMPGFYGVGE----YDLAGFCVGIVEKSLLLDGSQ-VQIGDAVIGLASSGVHSNGFSLV
PUR5_SYNY3        AEMPGFYGAGE----YDAAGFAVGIVEKSQLLNGSQ-VNIGDVAIAVESSGVHSNGFSLV
PUR5_SYNP2        AEMPGFYQAGE----YDLAGFCVGIVEKSEILDGSQ-VQVGDVAIALPSSGVHSNGFSLV
PUR5_SYNE7        AEMPGFYEAGE----YDVAGFAVGIAEKSELLDGSQ-VQLGDVAIALASSGVHSNGYSLV
PUR5_CYAP4        AEMPGFYPVGE----YDLAGFCVGIVEKAEMLNGSQ-VRMGDRAIGLASSGVHSNGYSLV
PUR5_THEEB        AEMPGFYAEGV----YDLAGFCVGVVEQDQVLDGTQ-VQVGDVVLGLASSGLHSNGFSLV
PUR5_SYNJB        AEMPGFYPPGK----YDLAGFCIGIVEKTAILDGSR-VQLGDRLLALPSSGLHSNGYSLV
PUR5_GLOVI        AEMPGFYAAGE----YDVAGFCVGIVERSQIIDGNR-VQVGDALLGLSSSGVHSNGFSLV
PUR5_PROMA        AEMPGFYSDGR----YDLAGFCVAVVEENKIINGSK-IKVGDQIIGIKSNGFHSNGFSLI
PUR5_PROMT        AEMPGFYPIGR----YDLAGFCVGIVENHHLIDGTK-INCGDQIIGIKSNGVHSNGFSLV
PUR5_SYNPW        AEMPGFYPPGR----YDLAGFCVAVVEEDNLIDGRR-VQAGDSILGIASSGVHSNGFSLV
PUR5_SYNPX        AEMPGFYPAGR----YDLAGFCVAVVEENELIDGQQ-VQPGDAVIGVASSGVHSNGFSLV
PUR5_PROMM        AEMPGFYDPGC----YDLAGFCVAVVEEDEMIDGRK-IKPGDQIIGVASSGVHSNGFSLV
PUR5_SYNR3        AEMPGFYPAGR----YDLAGFCVAVVDEPRLIDGQT-IQAGDQLLAIASSGVHSNGFSLV
PUR5_PROMP        AEMPGFYSKNK----YDLAGFCVGIADEEKLINGKK-ICENDLIIALQSNGMHSNGFSLV
PUR5_BACAN        AEMPGMYSTEE----YDLAGFTVGIVDKKKIVTGEK-IEAGHVLIGLASSGIHSNGYSLV
PUR5_BACCR        AEMPGMYSTEE----YDLAGFTVGIVDKKKIVTGEK-IEAGHVLIGLASSGIHSNGYSLV
PUR5_GEOSW        AEMPGMYDENE----YDVAGFAVGIAEKSKLVTGSA-IQAGDALIGLASNGIHSNGYSLV
PUR5_GEOKA        AEMPGMYDEDE----YDLAGFAVGVAEKERLITGET-IQAGDALVGLPSSGLHSNGYSLV
PUR5_BACSU        AEMPGLYTADE----YDIAGFSVGVAEKDEIVTGEK-IEEGHLLIGLSSSGLHSNGFSLV
PUR5_BACLD        AEMPGLYTEDE----YDIAGFSVGAAEKDGIVTGEN-ISEGHLLIGLSSSGLHSNGFSLV
PUR5_BACP2        AEMPGLYTEEE----YDIAGFSVGVVEKDEIVTGNS-IKEGHLLIGLSSSGIHSNGYSLV
PUR5_LYSSC        AEMPGLYEEDE----YDLAGFAVGACEKSAIVTGER-IVEGDVLIGIASSGVHSNGYSLV
PUR5_BACHD        AEMPGMYDETE----YDVAGFAVGAVEKADLVTGAD-IESGDLILGLPSSGVHSNGFSLV
PUR5_BACSK        AEMPGMYEEDE----YDLAGFSVGAVEKKDLLTGEH-IQAGDVLIGLPSSGLHSNGFSLV
PUR5_BREBN        AEMPGMYAEGE----YDIAGFTVGVVDESKMITGAS-VAAGDVLIGLASSGVHSNGFSLV
PUR5_HUNT2        AEMPGFYPEDE----YDLAGFAVGIVEKSKIIDGSK-IKAGDKLIGLASSGIHSNGYSLV
PUR5_RUMCH        AEMPGFYPVDE----YDLAGFTVGIVDKKKIINGKT-IKAGDKLIGLPSSGIHSNGYSLV
PUR5_EUBE2        AEHPGLMPQDE----YDLAGFAVGVVDKKDLITGEN-IKPGDTLIGIASSGVHSNGFSLV
PUR5_AGARV        AEHPGLMPEDE----YDLAGFAVGVVDRKDIITGEG-LKDGDVLIGMASTGVHSNGFSLV
PUR5_LACP7        AEMPGFYPVEE----YDLAGFAVGIVDRKKLITGDK-LKHGDVLIGIASSGIHSNGYSLV
PUR5_BIFAA        AEMPGMYDEDE----YDLAGFAVGVAEKSAIVDGSS-IVEGDVLIGLPSTGVHSNGFSLV
PUR5_BIFLO        AEMPGMYDEDE----YDLAGFSVGVAEKSAIVDGST-IAEGDVLIGLPSTGVHSNGFSLV
PUR5_BIFA0        AEMPGMYDEDE----YDLAGFTVGCVERSKIVDGST-IEAGDVLIGLPSTGVHSNGFSLV
PUR5_STRGC        AEMPGMYGEDD----YDLAGFAVGVAEKSQIIDGSK-VAEGDVLLGLASSGIHSNGYSLV
PUR5_STRR6        AEMPGMYGEDD----YDLAGFAVGVAEKSQIIDGSK-VVEGDVLLGLVSSGIHSNGYSLV
PUR5_STRT2        AEMPGMYGEDD----YDLAGFAVGVAEKSQIIDGSK-VAEGDVLLGLASSGIHSNGYSLV
PUR5_STRA5        AEMPGMYGEDD----YDLAGFAVGVAEKSQIIDGSK-VKEGDILLGLASSGIHSNGYSLV
PUR5_STRP1        AEMPGMYGQDD----YDLAGFAVGVAEKSQIIDGSK-VKEGDILLGLASSGIHSNGYSLV
PUR5_STRMU        AEMPGMYGKDD----YDLAGFAVGVAEKSQIIDGSK-VKEGDVLLGLASSGIHSNGYSLV
PUR5_STRU0        AEMPGMYGEDD----YDLAGFAVGIAEKSQIIDGSK-VSEGDVLLGLASSGIHSNGYSLV
PUR5_LACLA        AEMPGMYDEDD----YDLAGFAVGVAEKSQLIDGEKDVEAGDVLLGLASSGIHSNGYSLV
PUR5_ENTFA        AEMPDMYEADA----YDVAGFAVGIAEKSQLLTPSN-VKEGDFLIGLPSSGLHSNGYSLV
PUR5_LISMO        AEMPDMYGADD----YDLAGFTVGAVEKQKLITEGA-VQAGDTLIGIPSSGIHSNGYSLV
PUR5_LACSS        AEMPGMYAAKH----YDVAGFAVGIAEQDALVTGET-IQAGDVLIGLASSGIHSNGYSLV
PUR5_LACF3        AEMPDMYDQDE----YDLAGTVTGVVEKDDLLTSDQ-PQAGAILLGLASSGIHSNGFSLV
PUR5_LACRD        AEMPDMYAANE----YDLAGTVTGIAEKEELLTTAG-PQKGDILLGLPSSGLHSNGFSLV
PUR5_LACS1        AEMPDMYAKDE----YDLAGFSSGVVEKSKLLTDAN-PQENDILIGLASSGIHSNGFSLV
PUR5_LACDA        AEMPDMYAPDE----YDLAGFTVGVAEKDRLLSVDT-PQAGDVLLGLASSGVHSNGFSLV
PUR5_LACAC        AEMPDMYEPHE----YDLAGFSTGIAEKEDLLSSSL-AKAGDHLIALPSSGVHSNGFSLI
PUR5_STACT        AEMGEMYHEGE----YDLAGFAVGAVEKDDYIDGST-VKPGQVIIGLASSGIHSNGYSLV
PUR5_STAS1        AEMGEMYHEGE----YDLAGFAVGAVEKDDYIDGSS-VEPGQAIIGLESSGIHSNGYSLV
PUR5_STAEQ        AEMGEMYHEGE----YDIAGFAVGAVEKEDYIDGSN-VEEGQAIIGLASSGIHSNGYSLV
PUR5_STAA8        AEMGEMYHEGE----YDVAGFAVGAVEKDDYVDGSE-VKEGQVVIGLASSGIHSNGYSLV
PUR5_MACCJ        AEMGDMYHTGD----YDIAGFAVGAVEKDAYITGER-IAEGDVILGLASSGIHSNGYSLV
PUR5_EXIS2        AEMPGMYADGE----YDIAGFAVGAVEKQKLITGEH-VQPGDVILGLASSGVHSNGFSLV
PUR5_EXISA        AEMPGMYPDGE----YDIAGFAVGVVEKEDLLDGST-IQDGDVVLGLASSGVHSNGFSLV
PUR5_OCEIH        AEMPGMYDPDE----YDLAGFVVGIVEKSAMITGKD-IKSGDVVIGLSSSGIHSNGYSLV
PUR5_ALKOO        AEMPGLYAENE----YDLAGFAVGIVDREQIITGAN-IKAGDIILGLPSNGIHSNGYSLV
PUR5_ALKMQ        AEMPGFYQKGE----YDVAGFTVGMVEEKNLITGKE-ISQGDIMIGISSSGVHSNGFSLV
PUR5_CLONN        AEMPGFYKEGE----YDVAGFCVGVVEKDEIIDGSK-IENGDVLIGIESTGIHSNGYSLV
PUR5_CLOAB        AEMPGFYKEGE----YDLAGFAVGLVDKDKIIDGSK-IEDGNVLIGIASSGIHSNGYSLV
PUR5_CLOK5        AEMPGFYSKGE----YDMAGFAVGVVEKDNIINGST-VEEGDVLVGIASSGVHSNGYSLV
PUR5_CLOTE        AEMPGFYKEGE----YDIAGFAVGIVEKENIVDGQD-IKEGDVLIGIASSGVHSNGYSLV
PUR5_CLOPE        AEMPGMYKEGD----YDIAGFAVGIVDKDKIINGKD-IKSGDKLIGIASSGVHSNGYSLI
PUR5_FUSNN        AEMPGFYKEGD----YDIAGFCVGIVEKEDLIDGSK-VKEGNKIIAVASSGFHSNGYSLV
PUR5_CALS8        AEMPGFYREEE----YDLAGFAVGLVKKDLAICGQD-VKEGDILIGLASNGVHSNGYSLV
PUR5_FINM2        AEMPGLYKEND----YDLAGFAVGIVDRDKIIDGSG-IKEGDVAISLSSSGVHSNGFSLV
PUR5_GEODF        AEMPGFYAGDE----YDMAGFTVGVVERDKIIDGSS-ITVGDKLIGLASSGLHSNGYSLA
PUR5_GEOUR        AEMPGFYSGDE----YDMAGFAVGVVDRDKIIDGSS-ITVGNRLIGIASSGLHSNGYSLA
PUR5_GEOBB        AEMPGFYTGDE----YDMAGFAVGVVEREKIIDGSS-ITVGNRLIGLASSGLHSNGYSLA
PUR5_GEOMG        AEMPGFYQDGE----YDLAGFTVGVVDRDKIIDGSS-ITVGNTLIGLASSGLHSNGYSLA
PUR5_GEOSL        AEMPGFYQPGE----YDLAGFTVGVVERDNIIDGSS-ITVGNRLVGIASSGLHSNGYSLA
PUR5_GEOLS        AEMPGFYADGE----YDIAGFTVGVVEKDQIIDGSS-ITVGNKLIGIGSSGLHSNGYSLA
PUR5_PELCD        AEMPGFYGEGE----YDLAGFTVGIVDNTSIIDGSG-ITVGDRLIGLASSGLHSNGYSLA
PUR5_SYNAS        AEMPGIYSENE----YDLAGFCIGVVENGRIIDGSD-IRVGDRVIGIASNGIHSNGYSLV
PUR5_DESAL        AEMPGMYEDGD----YDLAGFAVGIADNFKIVDGSD-VGQGNVLLGIASTGLHSNGYSLA
PUR5_DESPS        AEMPGLYQGSD----YDLAGFVTGIVDRDSIIDGSD-VRSGNKIIGLASSGVHSNGYSLV
PUR5_DESAG        AEMPDMYAPGE----YDLAGFCVGIADNARIVDGSD-IRVGDVIIGLGASGVHSNGYTLV
PUR5_DESVM        AEMPEMYAPGE----YDLAGFCVGLVDNTRIVDGSS-IRVGDSIIGIASTGLHSNGYSLA
PUR5_LAWIP        AELPGMYTEGE----YDLAGFCVGIVDQSKIIDGSS-IKVGDTIIGLASSGIHSNGYSLV
PUR5_PSELT        AQMPDMYKEEE----YDLAGFAVGVVEREKLLDGSK-IKQRDAVIGLASSGLHSNGFSLV
PUR5_CALS4        AELPGFYKEGE----YDLAGFCVGIVEKEEIIDTSS-MAIGDVVIGLSSSGLHSNGYSLV
PUR5_THEYD        AELPRFYKKNE----YDLAGFAVGVVDRKEIIDGSS-IKEGDVFIGVASSGLHSNGFSLA
PUR5_CARHZ        AEMPGVYHPGD----FDIAGFGVGVVEKSKIIDGSS-VKAGDVIIGVASSGIHSNGLSLA
PUR5_MOOTA        AEMPGFYREDE----YDLAGFAVGVVEREELLDGSR-IRPGQVVLGLASSGLHSNGFSLA
PUR5_DESHY        AEMPGFYDEGE----YDIAGFAVGAVNRPDLIDGSQ-IQAGDVLIGLPSSGFHSNGYSLV
PUR5_SYNWW        AEMPGFYREKE----YDLAGFAVGAVERSRLINGSS-IADGDLLIALPSSGLHSNGYSLA
PUR5_METS3        ASLPGIIKD------FDLAGTGIGFVDVDKIITGED-IEAGDVLIGIESNGIHSNGYSLA
PUR5_METTH        ASLPGIIRN------LDLAATGIGFVDVDRIITGED-VSPGDTVIGLESSGIHSNGLSLA
PUR5_METJA        ATLPDMIKG------IDLAGTVLAIVKKDEIITGKD-VKAGDVIVGLRSSGIHSNGLSLA
PUR5_METMP        ASLPNMIKG------VDLAGTVLAVVKKDEIVSGKE-VKSGDLIVGLRSSGIHSNGLSLA
PUR5_METKA        ATLPEVIRGKEEGRGFDLVVACLGRVEGD-PITGED-VEPGDAIVGLRSSGIHSNGLTLA
PUR5_METAC        ATLPDIIKG------FDLAGTCLGVVKKEDILEGGK-VRVGDVLVGIPSTGVHSNGYTLV
PUR5_METMA        ATLPDIIKG------FDLAGTCLGYLKKEDIIEGGR-VRVGDVIVGIPSTGVHSNGYTLV
PUR5_METBF        ATLPEIIKG------FDLAGTCLGIVRKDEIVEGEK-VRVGDVIVGVPSTGVHSNGYTLV
PUR5_METBU        ATLPEIVNG------FDLAGTCLGMVKKEEVITGEK-VRLGDVLVGIPSNGVHSNGYTLV
PUR5_ARCFU        ATLPEIIRG------FDLAGTAIGWVKKDAIITGEK-IEEGDVIFAIPSSGIHSNGLTLA
Q5V4T0_HALMA      AVMPDVIKG------LDIAGTCAGLAPKDAVFPG-E-AEAGDAIVGWPSSGIHSNGLTLA
B0R4C5_HALS3      AVMPDVVRG------FDIAGTAAGVATDAELFPG-R-AEAGDALVGFPSAGIHSNGLTLA
G0LLI6_HALWC      AVLPEVVDG------FDLAGTCAGLTPKDGVFTE-T-ANPGDALVGFASSGIHSNGLTLA
PUR5_PYRFU        AVMPDLVNG------YDLAGTAIGIVEKDKVITGEK-IRPGDAVIGISSSGIHSNGLTLA
PUR5_THEKO        AVMPDLING------FDLAGTAIGVVEKRKVITGKK-IRPGDAVIGIKSSGIHSNGLTLA
PUR5_SULTO        AIMPGVITG------YDLSCSVIGISDR--LKTGED-VAPGDVILGLKSNGVHSNGYSLI
Q4J8F5_SULAC      AIMPGVIKG------YDLSCSAIGIADA--LKTGED-VRPGDVVLGLASNGVHSNGYSLI
PUR5_SACS2        AIMPDVIRG------FDLSCTAIGVVDK--LKTGAE-IRPGDYVLGLESSGIHANGYSLV
PUR5_THEAC        AVLPDVVKH------IDISGAVIGIVQKNQIITGSN-IKEGDVIIGLGSSGLHSNGFTTV
                  *               *      .                    ..  : * *:** :  

PUR5_RHOBA        RKIIAD-------------------------HGHQWSDVIDELNQDTKTPETLAQVCLRP
PUR5_LEPIN        RKLLLK-------------------------EGK-------YLPTDPQQVKFLKDYALKP
PUR5_ACTSZ        RKVIE-------------------------VAGVNPATE--QLAG-----KPLAEQVLAP
PUR5_MANSM        RKVIE-------------------------VAGVNPATE--QLAG-----RPLADQVLAP
PUR5_HISS2        RKVIE-------------------------VSGIDPTTA--QLAE-----HSFAEQVLAP
PUR5_PASMU        RKVIE-------------------------VAGINPAEE--QLAG-----KPLADQVLAP
PUR5_ACTP2        RKVIE-------------------------VSGANPATD--TLEG-----KPLSEHLLAP
PUR5_HAEIN        RKVLE-------------------------VSGANP-TD--LLEG-----KPLSEHLLAP
PUR5_HAEPS        RKVLE-------------------------VSGTKP-MD--LLEG-----KPLSEHFLAP
PUR5_ECOLI        RKILE-------------------------VSGCDPQTT--ELDG-----KPLADHLLAP
PUR5_SHIDS        RKILE-------------------------VSGCDPQTT--ELDG-----KPLADHLLAP
PUR5_ENT38        RKILE-------------------------VSKTDPETT--ELEG-----KPLADHLLAP
PUR5_KLEP7        RKIIE-------------------------VSGVDPQTT--DLDG-----KPLADHLLAP
PUR5_SALTY        RKIID-------------------------VSGCDPQTT--LLEG-----KPLADHLLEP
PUR5_CROS8        RKILE-------------------------VSGADPQTT--ELDG-----KPLADHLLAP
PUR5_ERWT9        RKILA-------------------------FSNTDPETT--QLEG-----KPLADHLLAP
PUR5_PECAS        RKVLE-------------------------VSKTDPEQF--ELEG-----KSLADHLLAP
PUR5_YERPE        RKILD-------------------------VSNTNPEQT--SLEG-----KSLADHLLEP
PUR5_PHOLL        RKILA-------------------------VSNTDPEAT--ELES-----KSLADHLLAP
PUR5_SODGM        RKILS-------------------------FSQTDPEQT--QVEG-----KSLADHLLAP
PUR5_EDWI9        RKILE-------------------------VSGCDPRTT--MLAG-----RPLADHLLAP
PUR5_PROMH        RKILE-------------------------VSGACAETT--PLGD-----TSLADKLLAP
PUR5_HAMD5        RQVLN-------------------------LSKKDPETW--MLNG-----KSLADHLLEP
PUR5_VIBPA        RKILE-------------------------VSGADK-NE--ELAG-----RTIGEHLLEP
PUR5_VIBVY        RKILE-------------------------VSGADK-NE--ELAG-----RTIGEHLLEP
PUR5_VIBA3        RKVLE-------------------------VSGADK-SE--ELEG-----RTIGEHLLEP
PUR5_ALIF1        RKILE-------------------------VSNADL-NE--ELNG-----KTIAAHLIEP
PUR5_VIBCH        RKILE-------------------------VSKADK-NE--RLAG-----KTIGEHLLAP
PUR5_PHOPR        RKIIE-------------------------VSNADL-NE--ELEG-----KSLADHLLTP
PUR5_SHEWM        RKVLE-------------------------VSGANP-EQ--ELEG-----KALIDHLLEP
PUR5_SHEPA        RKVLE-------------------------VSKADP-AQ--ELAG-----KPLIDHLLEP
PUR5_SHEON        RKVLE-------------------------VSQADP-QQ--DLNG-----KPLIQHLLEP
PUR5_SHEAM        RKVLE-------------------------VSKADP-QM--DLNG-----KPLIKHLLEP
PUR5_SHEDO        RKVLE-------------------------VSKADP-QQ--DLNG-----KQLIEHLLEP
PUR5_SHELP        RKVLE-------------------------VSKADP-QQ--DLEG-----KPLIDHLLEP
PUR5_SHEFN        RKVLE-------------------------VSKADP-QQ--DLAG-----KPLIDHLLEP
PUR5_AERHH        RKILE-------------------------VSKADV-QQ--PLGD-----TTLANALLEP
PUR5_TOLAT        RKILE-------------------------VSKADV-QQ--PLGD-----STLANALLAP
PUR5_IDILO        RKIIE-------------------------VSGADL-ES--HLQG-----KTLADHLLEP
PUR5_PSET1        RKVLE-------------------------VSNADT-SA--DFEG-----KTLGETLLEP
PUR5_COLP3        RKVLE-------------------------VNNTDT-NE--LLEG-----KKIADHLLEP
PUR5_ALTMD        RKIIE-------------------------VSGADV-NA--ELNG-----KPIIDQLLEP
PUR5_PSEA6        RKILE-------------------------VSGCEA-SE--VFDG-----KPLSEHLLEP
PUR5_ALCBS        RRIMA-------------------------QAETDI-----DLDG-----KPLIEHLLEP
PUR5_SACD2        RKVLE-------------------------VSGASLDD---KVGD-----TTLGQALLEP
PUR5_TERTT        RKILE-------------------------VSNADLNE---DVGG-----KPLREALMEP
PUR5_HAHCH        RKIVE-------------------------VSGADLNQ---PFGD-----ATLGEALLAP
PUR5_MARHV        RKIIE-------------------------VSGADLSQ---SMGD-----TTLADALMAP
PUR5_PSEFS        RKIIE-------------------------VSGADIENT--QLDG-----KPLTDLLMAP
PUR5_PSEF5        RKIIE-------------------------VSGADIESI--QLDG-----KPLTDLLMAP
PUR5_PSESM        RKIIE-------------------------VAGADIENI--QLDG-----KPLTELLMAP
PUR5_PSEMY        RKIIE-------------------------VSGADIEQV--QLDG-----KALADLLMAP
PUR5_PSEPK        RKILE-------------------------VSATDIENT--QLDG-----KPLTDLLMAP
PUR5_PSEAE        RKIIE-------------------------VSGADIAQV--QLDG-----KPLADLLMAP
PUR5_AZOVD        RKILE-------------------------LSGTDVAGA--TLDG-----KPLADLLMAP
PUR5_CHRSD        RKIIE-------------------------RGQADLEQ---EIDG-----IPLRDALLAP
PUR5_ACIAD        RKILD-------------------------VKNVDLT---QEIDG-----RSLADAAMEP
PUR5_PSYA2        RKVIE-------------------------VSGVDVTSSNEQLDG-----QSIQDALMAP
PUR5_HYDCU        RKIIE-------------------------VNGANLNEE---CDG-----QPLIDALMAP
PUR5_METCA        RKIVG-------------------------HSGLGLDAP---VAG-----RALGDWLLEP
PUR5_NITOC        RKILE-------------------------RSRYSLNSP---LAD-----QTLGDALLTP
PUR5_ALKEH        RKVLE-------------------------RAPEGAATE---VDG-----QPVADLLMAP
PUR5_COXBU        RKILA-------------------------RAKIPLSQS---FEN-----KSLADGLLAP
PUR5_BURCJ        RKIIE-------------------------RANPDLSAD--FHGR------SLADALMAP
PUR5_BURVG        RKIIE-------------------------RANPDLSAD--FHGR------SLADTLMAP
PUR5_BURPS        RKIIE-------------------------RANPDLSAD--FHGR------SLADALMAP
PUR5_PARPJ        RKIIE-------------------------RAQPDLNAD--FDGR------SLADALMAP
PUR5_PARXL        RKIIE-------------------------RAQPDLNAD--FDGR------SLADALMAP
PUR5_PARP8        RKIIE-------------------------RAQPDLDAD--FDGR------TLAEALMAP
PUR5_CUPMC        RKIID-------------------------VARPNLDAD--FHGQ------RLQDAIMAP
PUR5_CUPNH        RKIIE-------------------------VARPDLNAD--FHGQ------RLQDAIMAP
PUR5_RALSO        RKIIE-------------------------VSRPDLNAD--FHGQ------RLQDAIMAP
PUR5_AZOSB        RKIIE-------------------------VAKPDLDAD--FHGR------TFRDVVMEP
PUR5_AROAE        RKIID-------------------------LAKPDLDAD--FHGR------PLRDVILEP
PUR5_BORA1        RKILE-------------------------RAGARPDQD--FHGQ------PLVDVVMAP
PUR5_BORPE        RKILE-------------------------RAGARPDQD--FHGQ------PLVDVVMAP
PUR5_BORPD        RKILD-------------------------RAGARPDQD--FHGQ------PLADVVMAP
PUR5_DECAR        RKIIE-------------------------RSKPDMNAK--FDGE-----RTLADVVMAP
PUR5_METFK        RKLID-------------------------LSGVDLESD--FYGR------PFRDVVMAP
PUR5_CHRVO        RKIID-------------------------RAQPELDAP--FDGD-----KTLRDAVIAP
PUR5_LARHH        RKIIE-------------------------RAGPDLDAP--FDGD-----RTLRDAIIAP
PUR5_NEIMB        RKIIE-------------------------RDNPDLDAE--FDNG-----KTLREAVIAP
PUR5_NEIG1        RKIIE-------------------------RDNPDLDAE--FDNG-----KTLREAVIAP
PUR5_NITMU        RKIIE-------------------------KNNVDLSAD--FHGR------ALIDVIMAP
PUR5_NITEU        RKILD-------------------------LNTVQSDTR--LGET------SLIDALLTP
PUR5_POLSJ        RKCIE-------------------------RAGADRPAT--LDGK------PFKQALMEP
PUR5_RHOFT        RKCIE-------------------------RAGANAPAT--LDGK------PFKQALMEP
PUR5_XANOR        RKIYE-------------------------RAGAPAEHV--LDDG-----TKLIDALMAP
PUR5_XANCP        RKIYE-------------------------RAGSPADLV--LDDG-----VALIDALMAP
PUR5_STRMK        RRIYD-------------------------RAGRPADLE--LEGG-----VKLVDALMAP
PUR5_XYLFA        RRIYE-------------------------RAGSPADLD--IH-G-----TRLIDTLMAP
PUR5_OCHA4        RRIVE-------------------------LSGLGWKSDAPFQPG-----ATLGEALLTP
PUR5_BRUA2        RRIVE-------------------------LSGLGWKSQAPFQPG-----ATLGEALLTP
PUR5_AGRRK        RKIVD-------------------------LSGLAWDAPAPFAEG-----KALGEALLTP
PUR5_RHIEC        RKIVE-------------------------LSGLGWDAPAPFAEG-----KKLGEALLEP
PUR5_AGRFC        RKIVS-------------------------LSGLEWSAPAPFADG-----KKLGEALLTP
PUR5_AGRVS        RKIVE-------------------------LAGLGWDAPAPFAEG-----ATLGAALLTP
PUR5_RHIME        RKIVS-------------------------LSGLAWDAPAPFGEG------TLADLLMTP
PUR5_SINFN        RKIVS-------------------------LSGLAWDAPAPFGEG------TLADLLMTP
PUR5_RHILO        RRIVA-------------------------ASGLAWSDPAPFNDE-----ATLAEALLEP
PUR5_CHESB        RRIVE-------------------------VSGLDWNDPAPFDSD-----RSLAEALLTP
PUR5_BARHE        RRIIQ-------------------------QSDLKWNDHAPFNPQ-----MNLGTALLTP
PUR5_METNO        RRIVA-------------------------ASGLGWDAPAPFAPG-----RSLGEALLTP
PUR5_METS4        RRIVS-------------------------ASGLPWDAPAPFAPG-----RSLGEALLTP
PUR5_METSB        RKIVA-------------------------AQKLGWDAPAPYAPG-----QSLGAALLTP
PUR5_BEII9        RRVLA-------------------------DNGASLDGPAPYEPG-----KTLGESLLTP
PUR5_NITWN        RNIVE-------------------------ASGIALSAPAPFAPV-----ATLGGALLTP
PUR5_NITHX        RKIVE-------------------------ASGLGFSVPAPFAPV-----TTLGGALLTP
PUR5_RHOPA        RKIVE-------------------------KSGLPYDAPAPFSPV-----MTLGGALLAP
PUR5_RHOPB        RKIVE-------------------------RSGLGYDANAPFSPV-----MTLGGALLAP
PUR5_PARL1        RRIVE-------------------------DNRISYSAPFPGGDG-----ASIGEVLLAP
PUR5_RUEST        RQIVK-------------------------YSGLGWDGDNPFG-E-----GKLGEALLTP
PUR5_RUEPO        RKLVE-------------------------ISGNTWESDCPFG-D-----GKLGQALLTP
PUR5_ROSDO        RKLVE-------------------------VSGLSWDAPCPWA-E-----QSLGAELLTP
PUR5_RHOS4        RKVVE-------------------------LSGLGWDAPAPFG-G-----DSLGRALLAP
PUR5_DINSH        RRIVE-------------------------RSGLGWGDPAPFE-G-----RTLGAALLTP
PUR5_JANSC        RRVVE-------------------------RSGLAWDAPAPFA-Q-----SSLGEALLAP
PUR5_RHORT        RRIVE-------------------------RSGLAWDAPAPFAPE-----TTLARALLTP
PUR5_ERYLH        RRLAA-------------------------DKGWKLDRPALFDNE-----RLLIEHLLEP
PUR5_NOVAD        RRLAA-------------------------DKGWKLDRPALFDNE-----RLLIDYLIEP
PUR5_SPHAL        RRLAA-------------------------DKGWKLDRPALFDQT-----VLLIDALMAP
PUR5_MAGMM        RKLVLG------------------------QSGPGLEAD---FNG-----KPLGEVLLTP
PUR5_ANADE        RKALLD--------------------------RYPLDHRFEGLGG-----RTLADALLEP
PUR5_ANADF        RKALMD--------------------------RHPLDRRFDGLGG-----RTLGEALLEP
PUR5_MYXXD        RKVLLDD------------------------GKLALDATPEGLD------RPLVDALLEP
PUR5_SORC5        RRVLEKE------------------------MGLTMSDRVADLG------GTVGEALLTP
PUR5_SYMTH        RRVLLKVD----------------------GGAFDLDDRPPELGG-----RTVLEVMLTP
PUR5_RIPO1        RKIVE-------------------------VNGLNWSDRPQLLNG-----QTLGEVLLTP
PUR5_CROS5        RKIVE-------------------------VNGLSWGDRFESLGN-----QTLGEVLLTP
PUR5_MICAN        RKIID-------------------------TQGLNWQDCPEILAG-----SSLGEVLLTP
PUR5_GLOC7        RKIVE-------------------------TQGLSWDFCPDILEG-----KSLGEVLLTP
PUR5_SYNY3        RKIIE-------------------------SNGWQWSDCLPEWGG-----QSLGEIFLEP
PUR5_SYNP2        RKIIE-------------------------MNQLSWDDKPAAFQG-----KTLGEVFLTP
PUR5_SYNE7        RKVVA-------------------------NSGLDWTSSQTIFEG-----QSLGDVFLTP
PUR5_CYAP4        RKIVDEFIGPAAREQSEAGATEALVSPWSITPWAEREDLPPVDRQ-----QSLGAALLTP
PUR5_THEEB        RKIVS-------------------------DRQLSWQDTP--LGP-----TSLGELCLEP
PUR5_SYNJB        RRIVA-------------------------DRGWRWDHRPPGWDR-----P-LAEVFLTP
PUR5_GLOVI        RRIVE-------------------------LAGLDWHHRPEDFPA-----S-LGEVLLTP
PUR5_PROMA        RKVVK-------------------------LAGVN-EKSCFGSRK-----VPLIDYLLKP
PUR5_PROMT        RKVLS-------------------------MANVD-ENTLFGKDK-----RNLIQSLLEP
PUR5_SYNPW        RKILE-------------------------CCAAG-ADTRVGPEQ-----TPVIEALLKP
PUR5_SYNPX        RRVLA-------------------------QAKAD-RSTLYGPDQ-----RPLIDDLLRP
PUR5_PROMM        RKVLA-------------------------LTEAN-KNTLFGCDN-----KPLIETLLTP
PUR5_SYNR3        RRILE-------------------------ANQVPLETSQAALGG-----RSAAEALLEP
PUR5_PROMP        RKIIE-------------------------NNNQI-DKQFEKKYN-----LDFYDELLKP
PUR5_BACAN        RKVLLE------------------------DGELSLDRIYGRLE------LPLGEELLKP
PUR5_BACCR        RKVLLE------------------------DGELSLERIYGRLE------LPLGEELLKP
PUR5_GEOSW        RRIVFE------------------------QAKLALDRVYEPLS------VPLGEELLKP
PUR5_GEOKA        RRIVFE------------------------QAKLSLDEIYEPLD------VPLGEELLKP
PUR5_BACSU        RKVLLD------------------------DAELDLDTTYEPFE------RPLGEELLEP
PUR5_BACLD        RKVLLE------------------------DAGLNLDETYAPFE------RPLGEELLEP
PUR5_BACP2        RKVLLE------------------------DAGLDLHQTYEPFK------RPLGEELLEP
PUR5_LYSSC        RKIVFA------------------------DRQYAVDAIVENYEDL----GPIGEALLVP
PUR5_BACHD        RKILLH------------------------DHGYTLDSEIPALG------KKLGEELLTP
PUR5_BACSK        RKVLLQ------------------------DAGLTLQTECATLG------KTLGEELLTP
PUR5_BREBN        RKVLLA------------------------DKGMSLHDHVDVLG------KKLGEELLTP
PUR5_HUNT2        RKILAP------------------------T-AKKLAEEIKMLG------TTLGEELIKP
PUR5_RUMCH        RKLINP------------------------T-ENNLKEYVEKLG------CTLGEELLKP
PUR5_EUBE2        RSVFTM------------------------T-EESLNTYYDSLG------KTLGEALLAP
PUR5_AGARV        RKIFKM------------------------D-KETLNTYHEELG------TTLGEALLAP
PUR5_LACP7        RKVFRM------------------------E-KEALNTYYESLS------GTLGEVLLTP
PUR5_BIFAA        RKALFE------------------------QAGYTVDTQLDELGG-----EKLGDVLLTP
PUR5_BIFLO        RKALFE------------------------QAGYTVDTELDELGG-----EKLGDVLLTP
PUR5_BIFA0        RKALFE------------------------QAGYTVHTRLPELDD-----RELGDVLLTP
PUR5_STRGC        RRVF---------------------------ADYTGEEVLPELEG-----KKLKEVLLEP
PUR5_STRR6        RRVF---------------------------ADYTGEEVLPELEG-----KKLKEVLLEP
PUR5_STRT2        RRVF---------------------------ADYTGEEVLPELEG-----QKLKDVLLEP
PUR5_STRA5        RRVF---------------------------ADYTGDEVLPELEG-----KQLKDVLLEP
PUR5_STRP1        RRVF---------------------------ADYTGKELLPELEG-----KQLKDVLLEP
PUR5_STRMU        RRVF---------------------------ADYTGEEELPELEG-----KKLKDVLLEP
PUR5_STRU0        RRVF---------------------------ADYEGEAILPELEG-----KALKEVLLEP
PUR5_LACLA        RKVF---------------------------SDFDLNESLPELD------QSLIDTLLTP
PUR5_ENTFA        RNIFFK------------------------KHSFKTTDKLPELAP-----KTLGEELLTP
PUR5_LISMO        RKIFFK------------------------DNEFTLDAEISELD------VPLVEELLKP
PUR5_LACSS        RKIFFE------------------------QNNLTVASQLPELPG-----KTLGDWLLTP
PUR5_LACF3        RQILFK------------------------DHQVDLAATPAKLGG-----QTVGQAVLAP
PUR5_LACRD        RQILFK------------------------DNHVKLTDRPEALRG-----KTVGETILTP
PUR5_LACS1        RQILFK------------------------DNKIDLSEKREEFGG-----KTIGEVILEP
PUR5_LACDA        RKILFK------------------------DHDVKLTDKPAELKG-----KSVGESLLAP
PUR5_LACAC        RKILFK------------------------DHDVSLDDKPAELSG-----KTVGETLLTP
PUR5_STACT        RHLIK-------------------------ASEVDLNAEFENG-------KSYLDTFLEP
PUR5_STAS1        RKLIQ-------------------------QSGIKLSEPFNQE-------QTFLDAFLKP
PUR5_STAEQ        RKMIK-------------------------ESGVQLHDQFNG--------QTFLETFLAP
PUR5_STAA8        RKLIN-------------------------ESGIDLASNFDN--------RPFIDVFLEP
PUR5_MACCJ        RKIIK-------------------------DNNLDLDAEFDNG-------KTLLDVVLEP
PUR5_EXIS2        RKIVA-------------------------ESGLRYEDELMMFG------STIGNTLLMP
PUR5_EXISA        RHIVE-------------------------AQGLHYTDEIAMLD------TTLGNALLLP
PUR5_OCEIH        RKLIA-------------------------D--VDLNQTYPGLS------QTVKDAVMAP
PUR5_ALKOO        RKLFFE------------------------VLDMKITDYVEEF-G-----TTLGEELLKP
PUR5_ALKMQ        RKLFFE------------------------DKQYSVDQYVDGL-G-----ETLGEALLRP
PUR5_CLONN        RKLIK-------------------------DFNEDFNGE------------KIGNVLLTP
PUR5_CLOAB        RKLIT-------------------------DFNEEFNGK------------KIGEVLLTP
PUR5_CLOK5        RKLVD-------------------------NFQVDFFGS------------ALGEVLLTP
PUR5_CLOTE        RSVIK-------------------------DFREEFHGK------------IIGEELLTP
PUR5_CLOPE        RKVFK-------------------------NLDEDFNGK------------AIWEELLTP
PUR5_FUSNN        RKVFT-------------------------DYNEKIFLKEYGE-N-----VTMGDVLLTP
PUR5_CALS8        RKVFGI------------------------DENPKVLTKVYEELN-----LSLGEELLKP
PUR5_FINM2        RAALD-------------------------MANVKLSDKFED--------TTVGERLLVP
PUR5_GEODF        RKVIMD------------------------VMGLGINDTIPGLDK------SVADELLTP
PUR5_GEOUR        RKIIFD------------------------KMGLGIDDIIPGLDK------TVADELLTP
PUR5_GEOBB        RKVILE------------------------HMGLGIDDQLPGLGK------TVAEELLTP
PUR5_GEOMG        RKIIFD------------------------TLGFGINDMLPGHDR------SVADELLTP
PUR5_GEOSL        RKIIFE------------------------SMGLGIDSILPGLGM------SAADALLTP
PUR5_GEOLS        RRIIFD------------------------RMGLAINSPLPDSTK------TVDEELLTP
PUR5_PELCD        RKVLFE------------------------HLGLNADSKVEELDL------SVGEELLKP
PUR5_SYNAS        RKVIFD------------------------KAKLNVDDTIEGIEN------SIGEELLRP
PUR5_DESAL        RKVFFD------------------------HLGLKVDSYVEDLGM------TVGEAMLEP
PUR5_DESPS        RKICFD------------------------DNDYSVEDHIEELGS------TLGEELLKP
PUR5_DESAG        RKLFE-------------------------KSGLGADDIMPGTDA------SVRDVLMTP
PUR5_DESVM        RKVLA-------------------------QSGLNGNDPLPGSDR------TVAEVLLEP
PUR5_LAWIP        RQIIN-------------------------QCAIEPDNIIPGSRD------TFKQVLLKP
PUR5_PSELT        RKVLLG------------------------K--MKVDEYISDLKK------TLGEELLTP
PUR5_CALS4        RKVFFE------------------------KNNFSIEDYVPDIGK------TLGEVLLTP
PUR5_THEYD        RKVLFD------------------------IGKLRIDQYIPELNC------ILAKELLKP
PUR5_CARHZ        RKALLE------------------------YGNYHLTAYVEEFGK------TLGEELLTP
PUR5_MOOTA        RRVLLV------------------------EAGYTLERKLPELGR------TLGEELLEP
PUR5_DESHY        RKIFTP------------------------DL---WEKNYPELGE------TLGEALIRP
PUR5_SYNWW        RKVLLE------------------------KAGIKLEENIAELGH------SLGEELLCP
PUR5_METS3        RKALFD-------------------------DAGFSIDDKMPNCD-----TTIGEELIRP
PUR5_METTH        RRVFFD-------------------------ELELSPEDEMPGSS-----SSVGDELLRP
PUR5_METJA        RKVFFD-------------------------IAKLDINDKL-SYG-----KTVAEELLTP
PUR5_METMP        RKVFFD-------------------------IANLDVNSKL-SHG-----KTVAEELLTP
PUR5_METKA        RKVLL---------------------------SEYDVHDEL-PHG-----RTVAEELLEP
PUR5_METAC        RKIIEK-------------------------SGYSYHDPCPYDSS-----KTIGDELLEP
PUR5_METMA        RKIIQE-------------------------SGYSYHDPCPYDSS-----KTIGDDLLEP
PUR5_METBF        RKIIEE-------------------------SRYSYHDPCPYDNS-----KMIGDELLTP
PUR5_METBU        RDIIKE-------------------------SGHSYHEDFSYNTE-----TTIGDELLIP
PUR5_ARCFU        RKVVEA-------------------------AGLSYHDKF---GD-----KTIGEELLTP
Q5V4T0_HALMA      REAVTQ-------------------------D-HEYTDPFPPNPD-----TTIAEALLTP
B0R4C5_HALS3      REAATR-------------------------D-GGYDEPYPYEGY-----ETVGDALLEP
G0LLI6_HALWC      RTAITR-------------------------E-YEYTAPCPFDEY-----ETLGAALLEP
PUR5_PYRFU        RKLLIP-------------------------KYGLDYEYES---------RKLWEWLLEP
PUR5_THEKO        RKLLIP-------------------------KYGLDYEYEG---------KKLWEWLLEP
PUR5_SULTO        RKLID------------------------------EGKLSL---------NDWGEELMRP
Q4J8F5_SULAC      RKLID------------------------------EGKLRL---------DDWAEELMKP
PUR5_SACS2        RKLIE------------------------------EGKLSL---------DEYKNELLKP
PUR5_THEAC        RKIIAD-------------------------NNLDLQDTFP-GDS-----KKTYEVLLEP
                  *                                                        : *

PUR5_RHOBA        TKIYVSAIRSIQSHYRVKQVLHGIAHITGGGIEENLDRIL-PPGVNAEIDPNAWTPNPIF
PUR5_LEPIN        TRIYVSSILKLLQQVSVK----GMVHITGGGYQENVPRIL-PQGTQSKFFKEKIPSGYFF
PUR5_ACTSZ        TKIYVKSVLELIE----KTDVHAIAHLTGGGFWENIPRVL-PENVKAVIDETSWDWQPVF
PUR5_MANSM        TKIYVKSVLELIE----HVDVHAIAHLTGGGFWENIPRVL-PEDVKVVINENSWEWQPVF
PUR5_HISS2        TKIYVKPVLQLIK----HTDVHAICHLTGGGFWENIPRVL-PSSVKAVINEKSWEWHPIF
PUR5_PASMU        TKIYVKSILQLIK----HADVHAICHLTGGGFWENIPRVL-PKNVKAVIDESSWEWQPVF
PUR5_ACTP2        TKIYVKSVLQLIK----QADVHAIAHLTGGGFWENIPRVL-PATAKAVIDEKSWEWPAAF
PUR5_HAEIN        TKIYVKSILQLIK----QTEVHAIAHLTGGGFWENIPRVL-PDNTKAVIDESSWQWPAIF
PUR5_HAEPS        TKIYVKSVLELIK----QAEVHAIAHLTGGGFWENIPRVL-PADVKAVINEASWEWLPSF
PUR5_ECOLI        TRIYVKSVLELIE----KVDVHAIAHLTGGGFWENIPRVL-PDNTQAVIDESSWQWPEVF
PUR5_SHIDS        TRIYVKSVLELIE----KVDVHAIAHLTGGGFWENIPRVL-PDNTQAVIDESSWQWPEVF
PUR5_ENT38        TRIYVKNILELIE----NVDVHAIAHLTGGGFWENIPRVL-PDNTQAVIDESSWQWPAVF
PUR5_KLEP7        TRIYVKSVLDLIA----SVDVHAIAHLTGGGFWENIPRVL-PDNTQAIIDESSWQWPSVF
PUR5_SALTY        TRIYVKSVLELIE----NVDVHAIAHLTGGGFWENIPRVL-PENTQAVINESSWQWPAIF
PUR5_CROS8        TRIYVKPVLELIE----KLEVHAIAHLTGGGFWENIPRVL-PDNTQAVIDEASWQWPAVF
PUR5_ERWT9        TRIYVKNILSLIE----QVDVHAIAHLTGGGFWENIPRVL-PDNTQAVLDESSWEWPAVF
PUR5_PECAS        TKIYVKSVLSLIE----KVDVHAISHLTGGGFWENIPRVL-PEGMQATIDESSWQWPAVF
PUR5_YERPE        TKIYVKSILSLIE----QLDIHAIAHLTGGGFWENIPRVL-PQGMQAVIDEASWQWPAVF
PUR5_PHOLL        TKIYVKSLLSLIE----QVDIHAIAHLTGGGFWENIPRVL-PENTQAQINESSWQWPAIF
PUR5_SODGM        TCIYVKALLSLIA----QTEVHAIAHLTGGGFWENIPRVL-PAGTQAVIDKNSWQWPAVF
PUR5_EDWI9        TRIYVAACLDLIA----SHEVHALAHLTGGGFWENIPRVL-PAGVKAVIDEGRWQWPAIF
PUR5_PROMH        TRIYVKSLLSLIE----NVDIHAVAHITGGGFWENIPRVL-PENTQARINSQSWQWPEVF
PUR5_HAMD5        TRIYVKSILTLIETQ--NVDIHAIAHLTGGGFFENIPRVL-PKNTCVLIEESSWQWPCIF
PUR5_VIBPA        TKIYIKSALKMIE----KHDIHAISHITGGGFWENIPRVL-PEGTKAVIDGNSWEWPIIF
PUR5_VIBVY        TKIYIKSALKMIE----QHDIHAISHITGGGFWENIPRVL-PEGTKAVIDGKSWEWPVIF
PUR5_VIBA3        TKIYIKSALKMIA----EHDIHAISHITGGGFWENIPRVL-PEGTKAVIDGKSWEWPAIF
PUR5_ALIF1        TKIYIKSALKMIA----EHDIHAISHITGGGFWENIPRVL-PQGTKAVVDGSSWEWPAIF
PUR5_VIBCH        TKIYIKSGLKLIA----EHDIHAISHITGGGFWENIPRVL-PEGTKAVIDGKSWEWPVIF
PUR5_PHOPR        TKIYVKSTLKMME----SCDVHAISHITGGGFWENIPRVL-PEGAKAVVDGNSWQWPAIF
PUR5_SHEWM        TKIYVKSLLKLLE----QTEVHAMAHITGGGFWENIPRVL-PDDCKAVIQGDSWQWPSIF
PUR5_SHEPA        TKIYVKSLLKLLE----QHDVHAMSHITGGGFWENIPRVL-PEDCKAVVKSDSWQWPVVF
PUR5_SHEON        TKIYVKSLLKLIE----ASDVHAMAHITGGGFWENIPRVL-PENCKAVIQGDSWQWPAVF
PUR5_SHEAM        TKIYVKSLLKLIA----ESDVHAMAHITGGGFWENIPRVL-PDNCKAVVQGDSWQWPVVF
PUR5_SHEDO        TKIYVKSVLKLIE----ESDVHAMAHITGGGFWENIPRVL-PANAKAVIDGASWQWPVVF
PUR5_SHELP        TKIYVKPLLKLLE----KHDIHAMAHITGGGFWENIPRVL-PNDAKAVVKGDSWQWPTVF
PUR5_SHEFN        TRIYVKPLLKLIE----QSDIHAMAHITGGGFWENIPRVL-PDDCKAVVKGDSWKWPVVF
PUR5_AERHH        TRIYVKPVLKLIK----ECEIHALSHITGGGFWENIPRVL-PANTQAVIDEQSWQWPAVF
PUR5_TOLAT        TRIYVKPVLKLLK----NCEVHALSHITGGGFWENIPRVL-PENTKAVIDGSSWQWPEVF
PUR5_IDILO        TRIYVKPVLELIK----HVPVHALSHITGGGFWENIPRVL-PKGSKAVIDGNSWDWPVIF
PUR5_PSET1        TRIYVKPLLELFK----HVDVHALSHITGGGFWENIPRVL-PASAKAVVKGDSWQWPPIF
PUR5_COLP3        TKIYVKSVLELLK----NVDVHALSHITGGGFWENIPRVL-PETAQAVIKGDSWQWPSIF
PUR5_ALTMD        TRIYVKSVLALLE----EVQVSAISHITGGGFWENIPRVL-PEDAKVVIDEKSWEWPAVF
PUR5_PSEA6        TRIYVKSVLHLLE----SVQVNAITHITGGGFWENIPRVL-PQGTKAVIDESSWQWPSIF
PUR5_ALCBS        TRIYVKSLLKLIE----QVPVHAMAHITGGGLPENLPRVL-PDNTRAVIDTKSWEFPAVF
PUR5_SACD2        TRIYVKPLLELFKNV----QVNALSHITGGGLLENIPRVL-PENTRAQIDCASWELPPVF
PUR5_TERTT        TRIYVKTLLALFAEL----DVKALSHITGGGLTENIPRVL-PDNAKAVIDCASWEFPPVF
PUR5_HAHCH        TRIYVKPLLELIRQT----PVHALSHITGGGLLENLPRVL-PAHAKAVVDVNAFEMPELF
PUR5_MARHV        TRIYVKNLLKLIREV----DVRALSHITGGGLPENIPRVL-PKGTIAALDTQSWELPPVF
PUR5_PSEFS        TRIYVKPLLKLIKDT---GAVKAMAHITGGGLLDNIPRVL-PKGAQAIVDVASWQRPAVF
PUR5_PSEF5        TRIYVKPLLKLIKDT---GAVKAMAHITGGGLLDNIPRVL-PKGAQAVVDVASWQRPAVF
PUR5_PSESM        TRIYVKPLLKLIKET---GAVKAMAHITGGGLLDNIPRVL-PEGAQAVVDVASWQRPAVF
PUR5_PSEMY        TRIYVKPLLKLIKDT---GAVKAMAHITGGGLLDNIPRVL-PQGAQAVIDVASWNRPAVF
PUR5_PSEPK        TRIYVKPLLQLIKNT---GAVKAMAHITGGGLLDNIPRVL-PKNAQAVVDVASWQRPAVF
PUR5_PSEAE        TRIYVKPLLQLIKQT---GAVKAMAHITGGGLLDNIPRVL-PDNAQAVIDVASWNRPAVF
PUR5_AZOVD        TRIYVKPLLKLIRET---GAVKAMAHITGGGLTENIPRVL-PQGTRAVIDVASWTRPAVF
PUR5_CHRSD        TRIYVKSLLSLIKES-D-VTVHALSHITGGGLLENVPRVL-PDTLAARIDAASWTRPAVF
PUR5_ACIAD        TRIYVKPVLELCKQV-D---VHAMAHITGGGLPGNLPRVL-PNGAQAVIDEASWEWPELF
PUR5_PSYA2        TRIYVKAIKALQDTL-GSSALHAMSHITGGGLTDNLPRVL-PDHLAASIDTSSWQFSELF
PUR5_HYDCU        TRIYVKSILALMK----QIEIHAISHITGGGLLENLPRVM-PNNTKAKVDTKSWNRPAVF
PUR5_METCA        TRIYVKPLLELLK----SVEVHALAHITGGGITENLPRVL-PVGTAARIDTAAWTMPEIF
PUR5_NITOC        TRIYVKPLLQLLE----VIEIHALAHITGGGLPENLPRVL-PPMLSAEIDTSRWPRLPIF
PUR5_ALKEH        TRIYAKPVLDLIR----NLPVHAMAHITGGGLPENLPRVL-PEGLGAKLQP--WSWPPVF
PUR5_COXBU        TRIYVKTIKRLFS----EINVHALAHITGGGLIENVPRVL-PSYTQAVIDSNGWEWPAIF
PUR5_BURCJ        TRIYVKPLLALMQKL--S--VKGMAHITGGGLVENIPRVL-REGLTAELDQNAWPLPPLF
PUR5_BURVG        TRIYVKPLLALMQKL--T--VKGMAHITGGGLVENIPRVL-REGLTAELDQNAWPLPPLF
PUR5_BURPS        TRIYVKPLLALMEKI--A--VKGMAHITGGGLVENIPRVL-RDGLTAELDQHAWPLPPLF
PUR5_PARPJ        THIYVKPLLALMQQI--A--VKGMAHITGGGLVENIPRVL-REGLTAELDHRGWPLPPLF
PUR5_PARXL        THIYVKPLLALMQQI--A--VKGMAHITGGGLVENIPRVL-REGLTAELDHRGWPLPPLF
PUR5_PARP8        THIYVKPLLALMQQL--E--VKGMAHITGGGLVENIPRVL-REGLTAELDHRAWPLPPLF
PUR5_CUPMC        TRIYVKPLLSLIETL--P--VKGMAHITGGGLTENVPRVL-ADNVTAVIQRDAWTLPPLF
PUR5_CUPNH        TRIYVKPLLSLIETL--P--VKGMAHITGGGLTENVPRVL-AQDVTAVLKRDAWTLPPLF
PUR5_RALSO        TRIYVKPLLALIDKL--P--VKGMAHITGGGLVENVPRVL-PEGVTAVLHQDAWTLPPLF
PUR5_AZOSB        TRIYVKPLLALMQAM--PGVVKGMAHITGGGITENVPRIL-RDELTARIDAASWTLPPLF
PUR5_AROAE        TRLYVKPMLGLMQAI--PGVVKGMAHITGGGLLENVPRIL-ADGLAARLDVSSWTLPPLF
PUR5_BORA1        TRIYVKQVLAALAEH--GTAIKGLAHITGGGLLDNVPRIL-QQGLSAKLYRDGWQMPQLF
PUR5_BORPE        TRIYVKQVLAALDRH--GPAIKGLAHITGGGLLDNVPRIL-QPGMAAQLQRDGWEMPKLF
PUR5_BORPD        TRIYVKQVLAALAAH--TGGIKGLAHITGGGLLDNVPRIL-QPGLSARLHRDAWQMPQLF
PUR5_DECAR        TRIYVKQVLATMQK----VTIKGMAHITGGGLLENVPRVL-PENTVAELEKAAWPRPKLF
PUR5_METFK        TRIYVKPILKLLQAI--K--VKGMAHITGGGITENVPRVL-PEGLTAEVRQGSWEIPPLF
PUR5_CHRVO        TRIYVKPLLKLMETL--P--VKGMAHITGGGITENTPRVL-PDNTVAQIDAASWQLPKLF
PUR5_LARHH        TRIYVKPLLKLMAGV--P--VKGMAHITGGGITENTPRVL-PDNCVAQIDAASWTLPKLF
PUR5_NEIMB        TRLYVKPILAALEKF--T--IKGMAHITGGGITENVPRVL-PENTVAQIDAKSWELPKLF
PUR5_NEIG1        TRLYVKPILAALEKF--T--IKGMAHITGGGITENVPRVL-PKNTVAQIDAESWELPKLF
PUR5_NITMU        TRIYVKPLLELMRQV--P--VKGMAHITGGGLLENIPRIL-PEGVTAVLKKETWEMPPLF
PUR5_NITEU        TRIYVKSLLTLMAEL--P--VKGLAHITGGGLLENIPRVL-PDGVMAHIDSSTWVRPSLF
PUR5_POLSJ        TRLYVKNVLAALAAH--P--IKALAHITGGGLLENIPRVL-PEGTAAHLKKGSWPQTELF
PUR5_RHOFT        TRLYVKNVLAALAAH--P--IKALAHITGGGLLENIPRVL-PEGTAAHLTKGSWPQTELF
PUR5_XANOR        TALYVKPVLALLKSH--GQAIHAMAHITGGGLTENIIRVI-PDGLGLDIDASAWTLPPVF
PUR5_XANCP        TALYVKPILALLKSH--GEAIHAMAHVTGGGLTENIIRVI-PDGLGLDIDATAWILPPVF
PUR5_STRMK        TRLYVKPILSLLKSH--GEAIHGMAHITGGGLTENIIRVV-PDGLGLDIQASSWTLPPVF
PUR5_XYLFA        TTLYVKPILKLLHTH--SDAIHAMAHITGGGLTENIIRVI-PPNLGLRIDANAWTQPPVF
PUR5_OCHA4        TRIYVKPLLAAIRA---SDGIKALAHITGGGFPDNIPRVL-PEGLAAEIDLESISVPAVF
PUR5_BRUA2        TRIYVKPLLAAIRA---CDGIKALAHITGGGFPDNIPRVL-PKGLAAEIDLPAIAVPPVF
PUR5_AGRRK        TRIYVKPLLKAIRE---THAIKALAHITGGGFPENIPRVL-PKHLAAEIDLTAVKVPPVF
PUR5_RHIEC        TRIYVKPLLKAIRE---TGALKALAHITGGGFPENIPRVL-PEHLAAEIDLGAVKVPPVF
PUR5_AGRFC        TRIYVKPLLKAIRE---TGALKALAHITGGGFPENIPRVL-PKHLAAEIDLAAIKVPAVF
PUR5_AGRVS        TRIYVKPLLKAIRE---TKALKALAHITGGGFPENIPRVL-PKHLAAEIDLASITVPTVF
PUR5_RHIME        TRIYVKPLLKAIRE---TGAIKALAHITGGGFPENIPRVL-PKHLAAEIDLGAIKPPAVF
PUR5_SINFN        TRIYVKPLLKAIRA---TGAIKALAHITGGGFPENIPRVL-PKHLAAEIDLDAIKPPAVF
PUR5_RHILO        TRIYVKSILKAIRN---THGIKALAHITGGGFPENIPRVL-PKDFSAELDLEAIDVPPVF
PUR5_CHESB        TRIYVKPILSAIAR---THGIKALAHITGGGFPENIPRVL-PPAYAAEIDLEAVNVLPVF
PUR5_BARHE        TRIYVKSLLPIIKS---YKGIKALAHITGGGFLENIPRVL-PSSLCAEINLSAIHVPSIF
PUR5_METNO        TRIYVRPLLAALKAT-GAGAIKALAHITGGGFPDNLPRVL-PEGVGIALDLDEIAVPPVF
PUR5_METS4        TRIYVRPLLAALRAT-GRGAIKALAHITGGGFPDNLPRVL-PEAVGIALDLDAVAVPPVF
PUR5_METSB        TRIYVKTLLPLLRA---QAGIKGLAHITGGGFPDNLPRVL-PQGLGVEVDLSAIAVPPVF
PUR5_BEII9        TRIYVRPLLHVFAA---TQAVKALAHITGGGFQENLPRVL-PAGFGLALDLSALAVPPVF
PUR5_NITWN        TRLYVKSCLRAIRE---TGAVKGLAHITGGGFTDNIPRVL-PEGLGVRIDLAGLTVLPVF
PUR5_NITHX        TRLYVKSCLRAIRE---TGAVKGLAHITGGGFTDNIPRVL-PKHLGIRIDLSRLTVLPVF
PUR5_RHOPA        TKLYVKSCLQAIRD---TGAVKGLAHITGGGFTENIPRVL-PKHLGVGIDLPRIPVLPVF
PUR5_RHOPB        TKLYVKSCLRAIRE---TGAVKGLAHITGGGFTDNIPRVL-PPHLGVGIDLPRLPVLPVF
PUR5_PARL1        TRIYVKAMLKTIRE---TAAVKAVAHITGGGFVENIPRVL-PEGINVEIDGASWTMPPVF
PUR5_RUEST        TRLYVKQSLAAVRA----GGVNALAHITGGGLTENLPRVL-PDDLGADIDLGAWELPGVF
PUR5_RUEPO        TRLYVRQVLAAIRA----GGVHALAHITGGGLTENLPRVL-PEGMGATIDLDTWDLPPVF
PUR5_ROSDO        TRLYVKQALAAIDA----GGVHALAHITGGGLTENLPRVL-PEGLGADIDLSTWSLPAVF
PUR5_RHOS4        TRLYVKQALAAVRA----GGVHALAHITGGGLTENLPRVL-PKGLGARIDLSAWELPPVF
PUR5_DINSH        TRLYVQPALAAIRA----GGVHGLAHVTGGGLTENLPRVL-PEGLGIEINLGAWELPPVF
PUR5_JANSC        TRLYVQPALAAIRA----GGVHALAHITGGGLTENIPRVL-PDGLGVDIDLSSWSLPPVF
PUR5_RHORT        TRIYVKSCLALHRA----GLVHGFAHITGGGFWENIPRVL-PQGACAHLDGLSWPFPPVF
PUR5_ERYLH        TRIYVASLLPAVRA----GEIDALAHITGGGLLENIPRVL-PQGAHAVIDADAWEQPRLM
PUR5_NOVAD        TRIYVKSLLPFIRS----GRINALAHITGGGLLENVPRVL-PRGLHARIDADSWEQSRLM
PUR5_SPHAL        TRIYVKSLLPLVKT----GKIHALAHITGGGLLENIPRVL-PKTLHAHVDADSWEQPRLM
PUR5_MAGMM        THIYVLPLLELAKTH----AIHGLVHITGGGFWENIPRIL-PDATGALLKRSCWQQPEVF
PUR5_ANADE        TRIYAKDVLALLDQV----PVRAFAHITGGGLPGNVPRTL-PDGTRAVLEEKRWPRPAIF
PUR5_ANADF        TRIYAKDVLALLDAV----PVKAFSHITGGGLPGNVPRTL-PDGTRAVLEEKRWPRPAIF
PUR5_MYXXD        TRIYVKDVLALLQAV----KVKGLAHITGSGIPGNLPRCL-PDGTRAVLSEQTWPKPPIF
PUR5_SORC5        TRIYARAITALLAACG--DAVRGLSHITGGGLPGNLPRVL-PDGLGARLDLGSYQRPAVF
PUR5_SYMTH        TRIYVRTVLRLLARF----DVHGIANITGGGLHENIPRML-PEGTAAVLRRGAWKEPPVF
PUR5_RIPO1        TQLYVKPILNALNS---GLDIHAMAHITGGGLPENLPRCL-DKGQSVEIIDKSWNILPIF
PUR5_CROS5        TQIYVKPILEALKS---GIEIKGMAHITGGGLPENLPRCL-NNNQSIKINSESWSILPIF
PUR5_MICAN        TRLYVKPVLELLRS---GLDIHAMAHITGGGIPENLPRCL-GKGHSVQIYCESWPVLPIF
PUR5_GLOC7        TQIYVKPILEALSS---NLKIHGMAHITGGGLPENLPRCL-QANQSVQINPNSWEILPIF
PUR5_SYNY3        TRIYVKPIQALLKS---GINIHGMAHITGGGLPENLPRCL-GQGQSIQVKAGSWQPLPVF
PUR5_SYNP2        TQIYVQAIQGALKA---KMEIHGMAHITGGGLPENLPRCL-QANQSMAIDPSTWEIPTLF
PUR5_SYNE7        TRLYVKPILAAKAQ---KIPIHGMAHITGGGLPENLPRCL-GPNQTVAIDLESWKWPTVF
PUR5_CYAP4        TQIYVKPVLAAQRS---GLTLHGMAHITGGGLPENLPRCL-GEGQSVQLDPQSWPAPPIF
PUR5_THEEB        TRIYVQPIRAALSQ---GIPIHGMAHITGGGLPENLPRCL-GQGRSAHLDPQAWPIPPLF
PUR5_SYNJB        TRIYVQAVQRLQAA---GIAIHGMAHITGGGIPENLPRCL-APNQAARLQPHSWPIPQEF
PUR5_GLOVI        TRIYVKPVRAALEA---GFDIRGIAHITGGGLIENVPRAL-G-GLGACLERNSWPVPPVF
PUR5_PROMA        TQLYVHLVQALLQA---NLPVKGMAHITGGGLPENLPRCL-PDGLAASIDRNNWEEPSIY
PUR5_PROMT        TAIYVQLVEKLLRE---NLPIHGMTHITGGGLPENLPRIF-PSGLSPHIDITTWEITEIF
PUR5_SYNPW        THLYGALVRTLLGA---NTRIHAMAHITGGGIPENLPRCL-PKGLMASVDPHSWPRPELF
PUR5_SYNPX        TQLYASLVKHLLSS---SLPIHAMAHITGGGLPENLPRCL-PTGCRAQVSPTSWARPPLF
PUR5_PROMM        TTLYGQLVKNLLEA---KVPLHGMAHITGGGLPENLPRCC-PKDLVTVIDPSSWTRPELF
PUR5_SYNR3        TLLYAPLVKALLQSP--ELELRGMAHITGGGLPENLPRPL-PQGLAAQIDPGSWQRPALF
PUR5_PROMP        TKIYFKIVNQILSQ---NIQIKGMSHITGGGIPENLPRCM-SSDFIPYIDKKSWKIPVLF
PUR5_BACAN        TKIYVKPILELL----KNHEVYGMAHITGGGFIENIPRML-PEGIGAEIELGSWKIQPIF
PUR5_BACCR        TKIYVKPILELL----KKHEVYGMAHITGGGFIENIPRML-PEGIGAEIELGSWEIQPIF
PUR5_GEOSW        TRIYVKPLLNVM----KQFEIKGMAHITGGGFIENIPRML-PKGLGAEIDYGSWPIPPVF
PUR5_GEOKA        TRIYAKLLRSVR----ERFTIKGMAHITGGGLIENIPRML-PPGIGARIQLGSWPILPIF
PUR5_BACSU        TRIYVKPVLAAV----KSGKIDGMAHVTGGGFIENIPRML-PEGLSAEIDHGSWPIPPIF
PUR5_BACLD        TKIYVKPVLEAV----KSGKIAGMAHVTGGGFIENLPRMM-PDGLGVEIDIGSWPVPPIF
PUR5_BACP2        TKIYVKPVLKQV----KAGKVDGMAHVTGGGFIENLPRML-PEGLGVEIDNGSWPVPPIF
PUR5_LYSSC        TKLYAKPVLAAL----KAADVHGCAHVTGGGFYENLPRMM-PEGLATEIDLGSWPVLRIF
PUR5_BACHD        TKIYVKTVLQTL----KTGKVKGLSHITGGGFYENVPRML-PEGLGAEIDYGSWPVPPIF
PUR5_BACSK        TKIYVKPLLACL----KQGLLAGAAHITGGGFYENIPRML-PKGVGIHIDYGSWPIPPIF
PUR5_BREBN        TRIYVKQVLSVL----ESHEVKALVHITGGGFTENIPRVL-PEGMQAVINVGSWPVLPIF
PUR5_HUNT2        TRLYVKTILDLK----EKFEIKGIAHITGGGFIENIPRML-PQGLGVKVVRGSWPVLPIF
PUR5_RUMCH        TKIYVKTIMDII----GKYEIKGISHITGGGFIENIPRMI-PDGLRAQIQKGSWPVLPIF
PUR5_EUBE2        TKIYVKTMKEIKK---AGVKVKGCSHITGGGFYENVPRML-PDGVKAVIKKDSYEVPPIF
PUR5_AGARV        TRIYVKALKAVKD---AGVTVKACSHITGGGFYENIPRML-IDGKRAVVEKNSYPVPPIF
PUR5_LACP7        TKIYVKALNSLKT---GNVEVKACSHITGGGFYENIPRML-REGVTAIVKKDSYVIPPIF
PUR5_BIFAA        TKIYVKTLSPLF----KAGVVKGVAHITGGGFIENIPRMI-PDGLAAHINLGSWPVLPIF
PUR5_BIFLO        TKIYVKALSPLF----KAGVVKGVAHITGGGFIENIPRMI-PDGLAAEIELGTWPVLPIF
PUR5_BIFA0        TKIYVKALMPLF----EANLVRGVAHITGGGFIENVPRML-PEGLAASIELGSWPVPPIF
PUR5_STRGC        TRIYVKAVLPLI----KEELVNGIAHITGGGFIENVPRMF-ADDLAAEIEESKVPVLPIF
PUR5_STRR6        TRIYVKAVLPLI----KEELVNGIAHITGGGFIENVPRMF-ADDLAAEIDESKVPVLPIF
PUR5_STRT2        TRIYVKAALPLI----KEELVNGIAHITGGGFIENVPRMF-SDDLAAEIDESKVPVLPIF
PUR5_STRA5        TRIYVKAALPLI----KEELVNGIAHITGGGFIENVPRMF-ADDLAAEIDEDKVPVLPIF
PUR5_STRP1        TRIYVKAALPLI----KEELVKGIGHITGGGFIENIPRMF-ADDLAAEIDEDKVPVLPIF
PUR5_STRMU        TRIYVKAALPLI----KEELVNGIAHITGGGFIENVPRMF-GDDLAAEIEEDKVPVLPIF
PUR5_STRU0        TRIYVKAVLPLV----KENLVNGIAHITGGGFIENVPRMF-SEELAAEIWEEKVPVLPIF
PUR5_LACLA        TKIYVKELLPLI----KQNKIKGIAHITGGGFHENLPRMF-GNSLSAEIVEGSWNILPIF
PUR5_ENTFA        TKIYVKELLPLL----KAGLVHGAAHITGGGFLENLPRMF-SSALAAEIQLNSWPVLPIF
PUR5_LISMO        TRIYVKPVLEVL----KEVTVHGITHVTGGGFVENLPRML-TNDLAVKVELGSWPMLPIF
PUR5_LACSS        TKIYVEDLQPLL----QQRVIKGAAHITGGGFIENVPRML-PADLAAHLTLGSWPILPIF
PUR5_LACF3        TKIYVKPVLPLL----KDHLVEGVAHITGGGLIENLPRMF-GDDLQAQVDSSAWPSLPVF
PUR5_LACRD        TRIYVQAVLPLV----HRKLVHGISHITGGGLIENVPRML-GDNLQAVIDPGRWPQLPVF
PUR5_LACS1        TRIYIDSVLPLV----KENLVNGIAHITGGGLIENLPRMF-ADDLTAEIDASSWKVLPIF
PUR5_LACDA        TRIYIKSVLPLI----KQGLVHGVAHITGGGLIENVPRMF-NDGLRAEIAAGSWEVPDIF
PUR5_LACAC        TRIYIKAVLPLV----KKHLIHGIAHITGGGFIENLPRIY-DDNLQAVINKGSWPGLPIF
PUR5_STACT        TRLYVKPVLAVK----EQVKLYAMTHITGGGFYENIPRAL-PEGVTAEIDVQSFPTPAVF
PUR5_STAS1        TRLYVKPVLAVK----SSIKIYAMTHITGGGFYENIPRAL-PEGITAKIDVTQFPTPAIF
PUR5_STAEQ        TKLYVKPILELK----KHIDIKAMSHITGGGFYENIPRAL-PKGLSAKIDTQSFPTLEVF
PUR5_STAA8        TKLYVKPVLALK----KEVSIKAMNHITGGGFYENIPRAL-PAGYAARIDTTSFPTPKIF
PUR5_MACCJ        TRLYVKSAKAIL----DAADVHGMCHVTGGGFIENVPRVFVTDGLYPEIDVTNIPRQKIF
PUR5_EXIS2        TRIYVEAVKAAL----ETEKIQAMVHITGGGFYENVPRVL-PEGCGATFDPKKWPTLPVF
PUR5_EXISA        TRIYAEAAKAAI----STGKVQGMAHITGGGFYENVPRML-PGGLGITFDASSWPSLPVF
PUR5_OCEIH        TKIYAKSIQALK----KEVNLKGISHITGGGFDENIPRML-PDGLGVLIETNSWDIPEVF
PUR5_ALKOO        TKIYVKEILSLI----EAIPVKGISHITGGGFFENIPRIL-PENVDAKINVDAWQIPPIF
PUR5_ALKMQ        TKIYVKPILEVL----QQEKIKGMVHVTGGGFYENIPRIL-PEGIDANVHLDTWQAPPIF
PUR5_CLONN        TKIYVKTVLELI----KKYNIHGMAHITGGGFYENIPRMF-KGDFTAVINKGSFKVPEIF
PUR5_CLOAB        TKIYVKPVLKVL----ESFDVKGMAHITGGGFYENIPRMF-KGDFTAVINKESLEIPEIF
PUR5_CLOK5        TRIYVKPVLKLL----EKFKIKAMAHITGGGFYENIPRMF-KEDFTAVIDKNSFEMPEIF
PUR5_CLOTE        TKIYVKPVLQLL----KSYPIKGMAHITGGGFYENIPRMF-KDDLNVVISKNSFPRPDIF
PUR5_CLOPE        TKIYVKPVLSLL----EKFNIKGMAHVTGGGFYENLPRMLSKEGLSIVINKNSYEIPEIF
PUR5_FUSNN        TKIYVKPILKVL----EKFNVNGMAHITGGGLFENLPRCM-GKNLSPVVFKDKVRVPEIF
PUR5_CALS8        TRIYVKPVLKVL----EKIKIKGIAHITGGGFFENIPRAF-PKGFVAVIEKGTWNILPIF
PUR5_FINM2        TRIYEKEISALL----KEVEIKGIAHITGGGLYENVPRML-PENIGIEFDIKESEIDSVF
PUR5_GEODF        TRIYVKSILNLL----RDFTIHGIAHITGGGLLENIPRIL-PNGCKAVVDKTTWQVPEIF
PUR5_GEOUR        TRIYVRSILNLL----RDFPINGIAHITGGGLLENIPRIL-PNGCKALVHKNSWQPPPIY
PUR5_GEOBB        TRIYVRSVMNLL----RDFNVSGLAHITGGGLLENIPRVL-PNGCKAVIKKDSWDVPEIF
PUR5_GEOMG        TRIYVKSVLNLL----RDFRVNGIAHITGGGLLENVPRIL-PKGCKAIIRRDSWTMPEIF
PUR5_GEOSL        TKIYVKTILNLL----RDFHVNGIAHITGGGLLENVPRVL-PNGCKALVHLDSCPLPPLF
PUR5_GEOLS        TRIYVRSVMNLL----KDFRINGIAHITGGGLLENVPRIL-PKGCSASFKLGSWDMPSIF
PUR5_PELCD        TRIYVKTILNLL----RDFQIKGMAHITGGGLVENVPRMM-PKNCQAIIHKDSWPKPPIF
PUR5_SYNAS        TRIYVKPVLNLM----KSFNIKGIVHITGGGFVDNIPRIV-PNQCCTVIRMNSWQIPPIF
PUR5_DESAL        TKIYAEIVRNLI----RDIHVNGMAHITGGGIIDNLPRTI-PQSCKAIIREGSWEYPAIF
PUR5_DESPS        TRIYVQQVLNVI----KNYPIHGMVHNTGGGFIDNIPRIL-PKGYKATLQAGSWDVPAIF
PUR5_DESAG        TRIYVETIRNLM----RDFQIKGMVHVTGGGFYDNIPRVL-PASVDARIAFGAWDILPVF
PUR5_DESVM        TAIYVDIVRSVM----RDFAIKGMVHVTGGGFYDNIPRVL-PATVEAHIDFGSWTVPPVF
PUR5_LAWIP        TFIYSDIICNLI----KDISIKGMVHITGGGFYDNIPRVL-PQSVVANIQFSSWDIPPIF
PUR5_PSELT        TKIYVRTVLDVL----ND-KIHGMAHITGGGLLENLPRIL-PEGLEFRIDKNSWEVPVIF
PUR5_CALS4        TKIYVKSVEVLK----GL-KIKGMAHITGGGFIENIPRIL-RKGVSARIYKGSWEVPIIF
PUR5_THEYD        TEIYVKAYFALK----DKVKVKGMAHITGGGIPGNLSRIL-PKNITAILDKNSWTVPSIF
PUR5_CARHZ        TRIYVKPVLDLM----QKVEIKGMAHITGGGIVDNLPRIL-PEKVEARITVN-WEIPKIF
PUR5_MOOTA        TRIYVASILPLL----KEGLIKGLAHITGGGLIENPPRIL-PPGCSLRLDRRSWPVPPAF
PUR5_DESHY        TRIYVKTVLPLI----ESRKVLGMAHITGGGLTENIPRIL-PEGLGIKIARSAWQVPALF
PUR5_SYNWW        TRIYVPAILALL----EACEVKGLAHITGGGIVENLQRIM-PSGLGAVIDSQAIEIKPVF
PUR5_METS3        TELYVKPIVALFK-E--EYDIHGLAHITGGGFT----NLRRLKKGVGYDIYDLPEAPEIF
PUR5_METTH        TRIYVEPIMELIE-S--DVDVHGLAHITGGGFG----NLKRLRKDVGYRLDSLPEPQQIF
PUR5_METJA        TRIYVKPVLEMIRDK--DIEVKGLAHITGGSFR----KLKRLNDKVTYYIDNLPEPLPIF
PUR5_METMP        TKIYVKPVLEMI--K--QVNVKGLAHITGGGFR----KLKRLNKEVCYKIDELPEILPIF
PUR5_METKA        TRIYVRPVMEVLR----DYEVRGIAHITGGGVE----NLKRLRDDVRYVLDDPFEPHPVF
PUR5_METAC        TRIYIEVLDVLKA-----CEVHGLAHITGSGLL----KLRRVTK-LGFEFSDPIEPQEIF
PUR5_METMA        TRIYIEVLDVLKA-----CEVHGLAHITGSGLL----KLRRVTK-LGFDFYDPLEPQEIF
PUR5_METBF        TRIYIEILDVLKA-----CEVHGLAHITGSGLL----KLRRVTK-LGFDFYDPLEPQEIF
PUR5_METBU        TRIYMEVLDVIKE-----CDVHGLAHITGSGLL----KLKRVTG-LGFDFTDPIEPGNIF
PUR5_ARCFU        TRIYMEILDVLRE-----CEVHGLAHITGSGLL----KLKRLKN-MKYVIDKPLKPQEIF
Q5V4T0_HALMA      TRIYSEVLAPLRA-----SETHAAAHVTGGGWT----NLTRMGS-YRYEITDPFEAQPVF
B0R4C5_HALS3      TRIYTHLLDAFRE-----HGVHAAAHITGGGWT----NLDRMGG-FRYEVSDPLPAQPVF
G0LLI6_HALWC      TRIYTDLLDPMHA-----HDVRTAAHITGGGLR----NLERLGS-HRYVIDDPFETPPIF
PUR5_PYRFU        TRIYVKPILELLK----SVEVHGLAHITGGGLL----NLKRITN-YGFRLNMP-PINGIF
PUR5_THEKO        TRIYVKAVLELIE----NVKVHGLAHITGGGLL----NLKRLTS-FGFSIEMP-PIEGIF
PUR5_SULTO        TRIYSSSIIPILD----KIK--ALAHITGGAFS----KLKRITN-YRINLKMP-DPPEVF
Q4J8F5_SULAC      TKIYVKSVLSVKD----KIK--AVAHITGGSFS----KLRRITK-FGISLKMP-EPLDIF
PUR5_SACS2        TKIYVKPILEVMN----MIK--GAAHVTGGAFS----KLKRLTS-YKIVLNMP-DPPQIF
PUR5_THEAC        TRIYVREILDIMG----IITIKGMANITGGGFK----NITRMKD-MKYVIDDPFEPQNVF
                  * :*                     : **..      .                      

PUR5_RHOBA        QWLQQTGDVATSEMRRVFNMGIGMAVVVNEYYAASVASQVAKAGIECSPIGRIVEG----
PUR5_LEPIN        EKIKKDHKIEELELFATFNMGIGYMVIVSEENAELAKKIMESSGEVVHEIGEIVSG----
PUR5_ACTSZ        KWLQEQGNITRHEMYRTFNCGVGMVLALPQAEADKALDILRAAGENAWLIGRIEAL----
PUR5_MANSM        KWLQEQGNITRHEMYRTFNCGVGMVIALPQADAEKALQVLKAAGENAWLIGQVEPL----
PUR5_HISS2        KWLQEQGNIDRYEMYRTFNCGVGMIIALPQEDVETALALLQQVGEKAWVIGKIEHA----
PUR5_PASMU        KWLQEKGNIDTHEMYRTFNCGVGMIIALPQEDVDTALGLLKQTGEKAWVIGQIEHA----
PUR5_ACTP2        KWLQEKGNISRYEMYRTFNCGVGMVIALPEKDIETALAVLKQAGENAWVIGKIENL----
PUR5_HAEIN        NWLQEKGNISRYEMYRTFNCGVGMVIALPEKEVETALALLEQSGEKAWVIGKIEHL----
PUR5_HAEPS        KWLQEKGNISRYEMYRTFNCGVGMVIALPEKDVETALKVLTEAGENAWVIGKIEAL----
PUR5_ECOLI        NWLQTAGNVEHHEMYRTFNCGVGMIIALPAPEVDKALALLNANGENAWKIGIIKA-----
PUR5_SHIDS        NWLQTAGNVERHEMYRTFNCGVGMIIALPAPEVDKALALLNANGENTWKIGIIKA-----
PUR5_ENT38        NWLQTAGNVSQHEMYRTFNCGVGMLIALPASEADKAIALMTAKGENAWKIGIIKA-----
PUR5_KLEP7        NWLQTAGNVSQHEMYRTFNCGVGMIIALPAAEADKAIALLNDKGENAWKIGYIKA-----
PUR5_SALTY        TWLQTAGNVSRHEMYRTFNCGVGMVIALSAPEADKALALLNEKGENAWKIGIIKA-----
PUR5_CROS8        NWLQQAGNVSRHEMYRTFNCGVGMVIALPAAEADNAVALLNSLGETAWKIGAIKA-----
PUR5_ERWT9        GWMQQAGNVSRFEMYRTFNCGVGMVIALSAADADKALRLMNDAGEKAWKIGVIKA-----
PUR5_PECAS        NWLQQAGNVSRYEMYRTFNCGVGMIIVLPAEQADEAVALLNSSGENAWKIGVITQ-----
PUR5_YERPE        SWLQQAGNVSRHEMYRTFNCGVGMVVALPAELADKAVELLTASGEKAWKIGVIAAA----
PUR5_PHOLL        NWLQQTGNVSRHEMYRTFNCGVGMVIALPPTAVEQAIELLTAAGEKAWQIGTIATL----
PUR5_SODGM        RWLQQAGNVSRHEMYRTFNCGVGMVIAVPADSTAKALAILADLGETAWVLGQIHP-----
PUR5_EDWI9        DWLQQAGNVSRHEMYRTFNCGVGMVIALPPAQVDSALARLSQRGEQAWLLGHIAEA----
PUR5_PROMH        NWLQQAGNVSTHEMYRTFNCGVGLLIAVSQADVEKTLSHLNACGEKAWLIGDIAPQ----
PUR5_HAMD5        DWLQKTGNINKQEMYRTFNCGVGMIIALPENQADKTLDFLTSVGEKAWRIGRVDSS----
PUR5_VIBPA        KWLQEKGNVETHEMYRTFNCGVGLVVALPKDQADAAVALLKEEGENAWVIGEIAQA----
PUR5_VIBVY        QWLQEKGNVATREMYRTFNCGVGLIVALPQDQAEAAVALLQQEGEKAWVIGAIAQA----
PUR5_VIBA3        NWLQEKGNVETFEMYRTFNCGVGLVVALPKDQADAAVELLKAEGENAWVIGEIANA----
PUR5_ALIF1        NWLQEKGNVDTYEMYRTFNCGVGLVVALPKEQAEQAVALLNAEGENAWVIGEIAAA----
PUR5_VIBCH        QWLQEKGNVTTHEMYRTFNCGVGLIIALPKDQANAAVALLQAEGETAWVIGEIAAA----
PUR5_PHOPR        NWLQTAGNVETYEMYRTFNCGVGLVIALPQAQAEQAIEILKAEGENAWLLGSIANA----
PUR5_SHEWM        NWLMENGNIAEFEMYRTFNCGVGMVVALPSDKVEAALTLLNAEGEKAWLIGEIAKR----
PUR5_SHEPA        NWLMENGNISEFEMYRTFNCGVGMVVALPADKVDSALELLTAEGENAWLIGNIAKR----
PUR5_SHEON        SWLMENGNIAEYEMYRTFNCGVGMIVALPADKVDAALALLAAEGEQAWLIGAIAAR----
PUR5_SHEAM        DWLQTAGNIETYEMYRTFNCGVGMIVALPADKVDAALELLKAEGENAWHIGHIAAR----
PUR5_SHEDO        DWLKTNGNISQHEMYRTFNCGVGMIIALPADKVDAALSLLEAAGEQAWLIGSIASR----
PUR5_SHELP        NWLMENGNIAEFEMYRTFNCGVGMIIALPQDQVDAALTLLKAEGENAWLIGDIASR----
PUR5_SHEFN        DWLMTNGNIAQHEMFLTFNCGVGMVIALPTEKVDAALALLTAEGENAWLIGEIATR----
PUR5_AERHH        SWLQQAGNVTRHEMYRTFNCGVGMIIALPADQLEKALTLLKTEGENAWHIGYITKA----
PUR5_TOLAT        NWLQKSGNVETYEMYRTFNCGVGMIIALPQAQVDAALALLKAEGENAWLIGQIEQA----
PUR5_IDILO        DWLKENGNISMKEMYRTFNCGVGMVIAVPNEQADKAIQILTDAGEDAWKIGRIANA----
PUR5_PSET1        NWLQENGNITTHEMYRTFNCGVGMVLVVPADKLEQSLSMLKDLGENAWHLGEIQDA----
PUR5_COLP3        NWLQENGNITEHEMYRTFNCGVGMVIVVPADKVAQSIEVLTAHGENAWHLGEIADK----
PUR5_ALTMD        SWLQENGNVTRHEMYRTFNCGVGLVIVVDDADTEQAVNILKQHGENAWVIGDIASK----
PUR5_PSEA6        NWLQENGNVTTHEMYRTFNCGVGLMIALEADKADEAIAILKSQGENVWQIGHIEDS----
PUR5_ALCBS        QWLQQEGQVPAFEMYRTFNCGVGMVIAVPASHVDDALALLEAEGESAFLIGEIQAG----
PUR5_SACD2        KWLQEQGNINAVEMYRTFNCGVGMIVCVPAAEAANAIAQLKQSGEDAFEIGKIVA-----
PUR5_TERTT        SWLQQRGNVADTEMYRTFNCGVGMVICVSANDAERAISFLSDAGEAPFVIGQIEPL----
PUR5_HAHCH        NWLQKNGNVAWNEMFRTFNCGIGMVVCVPADSADKALELLSAAGETVFRIGSIETH----
PUR5_MARHV        QWLQNAGGVAQEEMYRTFNCGIGMVICVPEDQKALAMDTLNAMGEKVWQIGVMEAAE---
PUR5_PSEFS        DWLQEKGNVDETEMHRVLNCGVGMVICVAQEHVETALNVLREAGEQPWVIGQIAT-----
PUR5_PSEF5        DWLQEKGNVDEHEMHRVLNCGVGMVICVAQDQVENALKVLREAGEQPWVIGQIAT-----
PUR5_PSESM        DWLQQQGNVEENEMHRVLNCGVGMVICVAQEHVDAALNVLREAGEQPWVIGQIAT-----
PUR5_PSEMY        DWLQEKGNVDEHEMHRVLNCGVGMVICVAQDQVEAALASLRASGESPWVIGQIAE-----
PUR5_PSEPK        DFLQEKGNVDEHEMHRVLNCGVGMVICVAQDQVEAALNELRAAGEQPWVIGHIAE-----
PUR5_PSEAE        DWLQEQGNVDETEMHRVLNCGVGMVICVAQSDAEKALEVLRAAGEQPWQIGRIET-----
PUR5_AZOVD        DWLQEKGNVDEREMHRVLNCGVGMVVCVARDKVEQALAVLRAAGEQPWLIGDIA------
PUR5_CHRSD        DWLQREGNVDEHEMHRVLNCGIGMVVVVPAAQAERAQAALEAAGETVHRLGEIVP-----
PUR5_ACIAD        KLLQREGGVEQFEMYRTFNCGVGMVIAVDAADADKTIQVLNAQGEKSWKIGHIQDNAESI
PUR5_PSYA2        TWLQTQGNIEQSEMYRTFNCGVGFVIVVPKDKADAAIKTLTDAGEKAWKLGEMV------
PUR5_HYDCU        DWIQTHGNVEFHEMHRTLNCGIGMVVVVDEKDQQAAIDALTAQGEVVSVIGKIESS----
PUR5_METCA        RWLQRHGGVETPEMFRTFNCGVGMIVCVAPEDEARTLEALSSLGERAFAVGEIIAG----
PUR5_NITOC        DWLQREGNLSEQELYRTFNCGIGMVVCVDQADTEQALEFLKDRGESAWLIGRIVPQ----
PUR5_ALKEH        RWLQQTGQIAEAEMLRTFNCGVGMVLVVPAEQADAALQRLRQTGETAWRLGEIGTH----
PUR5_COXBU        HWLQKQGKVPIEEMWRTFNMGVGMVLCLDKKEVRKTLELLAALGETAWILGEIQSS----
PUR5_BURCJ        KWLQEHGGVADAEMHRVFNCGIGMAVIVSAADADAAIADLTAAGEQVWKIGTVRAT----
PUR5_BURVG        KWLQEHGGVADAEMHRVFNCGIGMAVIVAAADADAAIADLTAAGEQVWKIGTVRAS----
PUR5_BURPS        QWLRQHGGVADAEMHRVFNCGIGMAVIVSAADADDALRQLADAGEQVWKIGTVRAS----
PUR5_PARPJ        SWLQKHGGVADAEMHRVFNCGIGMAVVVSAADADAAIGLLSAAGEQVWKIGVIRES----
PUR5_PARXL        SWLQKHGGVADAEMHRVFNCGIGMAVVVSAADADAAIGLLSAAGEQVWKIGVIRES----
PUR5_PARP8        AWLQKHGGVADAEMHRVFNCGIGMVVIVSAADADAATGLLAAAGEQVWKIGTVRQS----
PUR5_CUPMC        QWLQAEGRVADAEMHRVFNCGIGMVVIVAKEDAERAIRHLQAAGEAVWQIGEIRER----
PUR5_CUPNH        QWLQAQGRVADDEMHRVFNCGIGMVVIVAKEDAERAIRHLQAAGEAVWQIGEIRER----
PUR5_RALSO        QWLQKAGNVADDEMHRVFNCGIGMIVIVSAADAPAAIAHLKDAGETVYQIGEIRAR----
PUR5_AZOSB        QWLQQAGNVDTQEMYRVFNCGIGMAVVVAADVADAVAAQLTAAGETVYRIGRIDSR----
PUR5_AROAE        QWLRDAGNVDAQEMYRVFNCGVGMVVIVSAAQAGAAVQNLEAAGEIVYRLGRIESR----
PUR5_BORA1        QWLQQQGAVADTEMYRVFNCGIGMVLVVAADQADAISATLRAQGEAVSRLGEIVPQ----
PUR5_BORPE        QWLQQQGSVADAEMHRVFNCGIGMVLVVAADQADAVAATLREQGEIVNRIGEIVPQ----
PUR5_BORPD        QWLQQQGGVADTEMHRVFNCGIGMVIVVDAAQADAVAATLAAQGETVSRIGEIVAQ----
PUR5_DECAR        DWMQAEGNVAENEMHRVFNCGIGLVIVVAAADADAAMAELKAQGEAVYRIGKIRAR----
PUR5_METFK        SWLQEQGNITDQEMYRTFNCGIGMVVIVSAQDVAAAKALLSAEGEQVWEIGRIRAQ----
PUR5_CHRVO        QWLQREGNVDIQEMYRTFNCGIGMVVVVAPEHAEQALALLREAGETVYRIGQVRER----
PUR5_LARHH        QWLQQEGNVDAQEMYRTFNCGIGMVVIVAPEQADAATALLTAEGETVHRLGLVRAR----
PUR5_NEIMB        QWLQKAGNVETQEMYRTFNCGIGMVVIVAAEDADAVQGLLGEQGETVYRLGLIRER----
PUR5_NEIG1        QWLQKAGNVETQEMYRTFNCGIGMVVIVAAEDADAVRSFLSGQGETVYRLGCIRER----
PUR5_NITMU        AWLQREGNVADNEMHRVFNCGIGMAVVVAPEYIDAAAQLLQSKGEIAWRIGTIREQ----
PUR5_NITEU        DWLQQHGNVAREEMLRVFNCGIGMVVVIAPEHAQTAIEILHNAGETVWQIGEIRPR----
PUR5_POLSJ        AWLQKTAGIDDFEMNRTFNNGIGMVVVVDAANAQATAKTLRDAGEQVYEIGVIAPR----
PUR5_RHOFT        AWLQKTAGIDDFEMNRTFNNGIGMVVVIDASQAAACAATLRAAGEAVYVIGVIAAR----
PUR5_XANOR        AWLQREGAVADAEMWRTFNCGIGFVLIAAPAEAAALEQALDAQSLAHWRIGQVVPA----
PUR5_XANCP        AWLQREGAVADAEMWRTFNCGIGFVLVAAPAQAAALEQALDAQSLAHWRIGQVVTA----
PUR5_STRMK        QWLQKEGAVADSEMWRTFNCGIGFVLIVAADQVAAVSDAVKAQGLEHWTIGQVVTA----
PUR5_XYLFA        QWLQSEGALADTEMWRTFNCGIGFVLVATPNQVAPLGQALDNQGLAHWQIGRVFTP----
PUR5_OCHA4        SWLAKTGGVEPNEMLRTFNCGIGMIAVVKPEKVEEVVAALAAEGEKVVTLGQMVKRDK--
PUR5_BRUA2        SWLAKTGNVEPNEMLRTFNCGIGMIAVVNPAKVDEVIAALAAEGEKVVTLGRMTRREK--
PUR5_AGRRK        SWLAKTGGVEAKEMLRTFNCGIGMIAVVAAENVDTVKAALEAEGESIVTLGRMIARDEGA
PUR5_RHIEC        SWLARTGGVEAKEMLRTFNCGIGMIVVVAEENVAAVSKALEAEGEKVVTLGRMIARAEGA
PUR5_AGRFC        SWLAKTGGVEAHEMLRTFNCGVGMIVVVSAENATKVTEALTAEGETVFPLGRMVAREDGA
PUR5_AGRVS        SWLSKTGGVAQNEMLRTFNCGVGMIVVVAAENADAVAAALEAEGETVARLGRMISREEGA
PUR5_RHIME        SWLAKTGGVAANEMLRTFNCGVGMIAVVPASEAEKVAAVLAGEGETVFTLGRMVARAEGA
PUR5_SINFN        SWLAKTGGVAANEMLRTFNCGVGMIAVVPAEEADRVAAVLAGEGETVFRLGRMVARQDGA
PUR5_RHILO        SWLAKTGGVAPEEMMRTFNCGVGMILAVASGQAAQVAAVLQEAGETVTPIGRIVPRRD--
PUR5_CHESB        SWLAERGGVAAQEMLRTFNCGIGMIAVVAAGQAAQVAAVLQKEGEHVEILGSIVPRRD--
PUR5_BARHE        SWIAKQGKIEKIEMLRTFNCGVGMIIIVAQHEVEKVTQELKMQGETVTLLGKLTKRQN--
PUR5_METNO        GWLARTGKVAEAEMLRTFNCGIGMVVVVAADRIASVEAALREAGEAPVRLGRITPRGE--
PUR5_METS4        GWLARTGGVAVPEMLRTFNCGIGMVVVVAPERIEAVEAALRAAGEAPVRLGTVTPRGE--
PUR5_METSB        AWLAEAGHVSAAEMLRTFNCGVGMALICAEADAGALLASLRAAGEQPVALGRVTPAGA--
PUR5_BEII9        GWLAREGGIAETEMLRTFNCGIGMVLIVANDEASKVEEALRAAGEQPIRLGSVIPAPETG
PUR5_NITWN        KWLAQQGRVVEREMLRTFNCGIGMVAIVRRDAVQQVVDVLTQAGERVSLLGDVIVAGD-E
PUR5_NITHX        KWLARQGGIAELELLRTFNCGVGMIAIVRRDAVEQVVDVLTQAGERVAPLGSVIEASG-D
PUR5_RHOPA        KWLAEQGEIAELELLRTFNCGIGMVIIVKADAVDQVTESLTASGESVHLLGQVIAAKG-E
PUR5_RHOPB        KWLAEQGEIAELELLRTFNCGIGMIAIVRADAVEQVSDILTEAGETVCLLGEVIEAKG-E
PUR5_PARL1        RWLMELGGIDDTEMGRTFNCGIGMVVVVREDQALEVSDALAEAGETVFRIGRLIETVPGA
PUR5_RUEST        KWMAQTGGIEESEMLKTFNCGIGMILVVKADRADALTEVLEGEGETVARLGTVTR-GEG-
PUR5_RUEPO        GWMAETGGIAEAEMLKTFNCGIGMIVVCAADRAEALAELLSAEGETVARIGTVTT-TPG-
PUR5_ROSDO        GWMAQTGGMQEAEMLKTFNCGIGMILVVAQEEADKLTQLLASLGEDVARIGHVSA-REG-
PUR5_RHOS4        RWLAETASMAEPELLKTFNCGIGMIVVVAADRADEIAALLAAEGETVTRIGEVIA-GEG-
PUR5_DINSH        RWLAAEGGLDEAELLKTFNAGIGMALIVAPDRAEALADLLAGAGERVAVIGHVTE-GAGA
PUR5_JANSC        GWLAQEGALDQAELLKTFNAGLGMVLVVSADAVDGLTWTLEDAGESVHRIGTVTA-GAG-
PUR5_RHORT        RWLMDQGGVSAHEMARTFNCGIGMVVAVPADKAEAAIALLGEHGETVHRLGTIAARGEGE
PUR5_ERYLH        AFLQAQGGIEPGEMARTFNCGIGMVLAVTPDKVEAVTARLNEAGETVHRIGTIEAGEKGC
PUR5_NOVAD        AFLQAQGNIEPEEMARTFNCGIGMILAVNPAQADALAADLAAAGETVYRVGTIVKGEKGC
PUR5_SPHAL        AFLQAQGNIEPEEMARTFNCGIGMAVVVAEADVADVTAALEAVGETVFRIGHIAEGERGC
PUR5_MAGMM        NLLQKLGNIAEDEMLRTFNCGLGMLVIVPATQADSALAQLRAAGEQAELVGEITSC----
PUR5_ANADE        DVVEREGQVPRDEMYRTFNMGLGLVAVVAPGDEAAAHAALRARGLEAWTVGAIEAGG---
PUR5_ANADF        DLVEREGGVPRDEMYRTFNMGLGLVAVVAPGDEAAAHAALRARGLDAWTVGQIEVG----
PUR5_MYXXD        DLIAKLGSVARDEMFNTFNMGLGLILVVAKEDVAQALSVLSGRGVQAFEVGRVEAG----
PUR5_SORC5        QVLQRGGPVEEAEMRRTFNLGVGLVAVVEKGAADRAIEAFAKSGEQAWVLGEVVSVG---
PUR5_SYMTH        DLIRRLGPVAQAEMEATFNLGLGMVLAVPADQAEAVAAAARELGEEAWVVGEVAAAE---
PUR5_RIPO1        QWIAQQGQISPASMYETFNMGIGFVVIVPPEKAQLAVNFLENQGILAYEIGKVIE-----
PUR5_CROS5        QWIANMGNVATAAMFDTFNMGIGFVIIVPKNQGKTSIEWLKSQGISAYEIGEVIE-----
PUR5_MICAN        HWLAQMGSVNAEAMFNTFNMGIGFVIIVPSDLARSTINQLQSSGINAYQIGEVIA-----
PUR5_GLOC7        TWLAQAGQVSPSAMFNTFNMGIGFVVIVPVDQAETTLNWFNNKGIKAYQMGEVIE-----
PUR5_SYNY3        NWLADKGQVNSTAMLETFNLGVGFVVLVSPEQRQTTLDFFSGQGLVANQIGTVIE-----
PUR5_SYNP2        QWLQTMGDVPQAAMWDTFNMGVGYVVIVPAPKAAENVAWFKAQGIAAWQVGTVVA-----
PUR5_SYNE7        RWLAKQGNIADSEMFNTFNMGVGLVVIVPAAAETQALKFFKAQGQTAWTLGEVVT-----
PUR5_CYAP4        DWIASTGSVPTAAMFDTFNMGIGFVLIVPPDEVESALRWFNTQQCPAYGIGEVVA-----
PUR5_THEEB        HWLGEVGNVSLGELFNTFNMGIGYTVVLPASAVAAAQTCFAKWGIESWPIGTVVA-----
PUR5_SYNJB        LWLQEQGQVETLEMFRTFNLGVGYVLVIPPEAENQVRSLLP----EAFPIGEVVAAC---
PUR5_GLOVI        TWLERTGGVGRQDMDQTFNLGLGLVLACPTEQADALQAYLAKQGEQVLRIGAVVE-----
PUR5_PROMA        KWLRNEGDIPESDLWNTFNFGIGFCLVVSPDQSKDLIDMCSANGFVAWNIGQVEE-QP--
PUR5_PROMT        NWLQNAGDIPEIDLWNTFNMGIGFCLIVPKNEVNSALEICIKNDFEAWNIGQVVESQN--
PUR5_SYNPW        SWLQTQGELQERDLWHTFNLGIGYCLILPEADVEGARTLCSNSGFESWVIGEVIPASE--
PUR5_SYNPX        DWLQSAGGIPERDLWHTFNLGIGFCVVVPRDQIDRTVAACRAQQLQAWPIGSIVEGN---
PUR5_PROMM        QWLQDAGQIPEHDLWHTFNLGVGFCLVVAEEVVSDVLQVCNEQALQAWPIGQVETASP--
PUR5_SYNR3        HWLQELGSVPERDLWHTFNLGIGYVLVLPESSCQQALEVVHNSGFTGWICGEIVVGQ---
PUR5_PROMP        EFLKDVGQIPEKDFWNTFNLGVGFCLIIDKKYKDKILNICNAFDISSWVLGKVLKKNN--
PUR5_BACAN        SLLQEVGKLEEKEMFNIFNMGIGMVVAVKEEDAKDIVRLLEEQGETARIIGRTVQGA---
PUR5_BACCR        SLLQEVGKLEEKEMFNIFNMGIGMVVAVKEEDAKDVVRLLEEQGEMARIIGRTIQGA---
PUR5_GEOSW        DLLQEKGNLLRHDMFSIFNMGIGMVLAVDSEMIHPVIARLEELGEKAYLIGRVKQGE---
PUR5_GEOKA        DFLREKGSLEEEEMFSVFNMGIGLVLAVSPETAAPLVEWLSERGEPAYIIGEVAKGA---
PUR5_BACSU        SFLQEYGKLKEEDMFNVFNMGIGFVLAVKEEHLTDVIGTLESHGEKAYLIGRVKKGE---
PUR5_BACLD        PFIQEKGGLKSEEMFNVFNMGIGFVLAVKEEDMTDVIQTLENNGEKAYLIGRVKAGS---
PUR5_BACP2        SFIQEKGQLKAEEMFNVFNMGIGFVLAVKEDDLVDVIRELEQDGEKAFLIGRVQKGE---
PUR5_LYSSC        EFLKDKGQLEDKDLYNVFNMGIGFVIAAPAAEADKVMAAVEANGEKAYTIGRVIKGN---
PUR5_BACHD        SFIRETGQLSAKDMFSTFNMGIGMAVVVSSDDAPHVIRQIQETGEDAYIIGRVTDTS---
PUR5_BACSK        SLIQEKGGLSEQDLFHTFNMGIGMVLAVPEDKHQQALATLEANGEDAYIIGRVTPTE---
PUR5_BREBN        ELVQGAGNISYPDMYKTFNMGIGMMLVVKPEDAVSVMEKLQELGEQAYLIGNIQAGE---
PUR5_HUNT2        TLLKDLGNLDEMDMYNTFNMGIGMTIAVDAEIANSVVEYLNKDKEQAYIIGEVVSDK---
PUR5_RUMCH        DLLRDLGNMADKDIFNTFNMGIGMIMAVDAQKADEIISYLDSKGEKAYVIGSISEGE---
PUR5_EUBE2        KMLAEDGNIEEHMMYNTFNMGIGLVLAVDPADVDTVMEAVKAAGETPYVIGSIEAGE---
PUR5_AGARV        KMMAREGNVEEQMMYNTYNMGLGMIVAVDPADVDKTMEAMKSAGDTPYVVGKIIDGE---
PUR5_LACP7        HMLQKDGSIEEQMMYNTYNMGIGMMIAVDKADADKAVSLLSVAGETAYIVGEIQDGE---
PUR5_BIFAA        DVLEKAGEIDHMEMFNIFNMGIGMVLAVSAEDADKTMELLKSNGEAGYVLGNI-VKK---
PUR5_BIFLO        DVLEKAGNIDHKEMYNIFNMGIGMVLAIDPARKDEALKLLADNNEPAYVLGSITADT---
PUR5_BIFA0        DVIEKAGDVDHMEMYNIFNMGLGMVVAIRPDRVDEAMNLLEHAGEKAYRVGHV-IEQ---
PUR5_STRGC        KALEKYGEIKHEEMFEIFNMGVGLMLAVSPENVGRVKELLDEP---VYEIGRI-VKK---
PUR5_STRR6        KALEKYGQIKHEEMFEIFNMGVGLMLAVSPENVERVKELLDEA---VYEIGRI-VKK---
PUR5_STRT2        KALEKYGEIKHEEMFEIFNMGIGLMFAVKPENVERVKELLDEP---VYEIGRI-VKK---
PUR5_STRA5        KALEKYGDIKHEEMFEIFNMGVGLMLDVNPENVDRVKELLDEP---VYEIGRI-IKK---
PUR5_STRP1        KALEKYGDIKHEEMFEIFNMGVGLMLAVSPENVNRVKELLDEP---VYEIGRI-IKK---
PUR5_STRMU        KALEKYGEIKHDEMFEIFNMGIGLMLAVSPEKVDRVKEVLDEP---VYELGRI-VKK---
PUR5_STRU0        KALETYGEIKHDEMFEIFNMGIGMMLAVKAENVARVKELLDEP---VYEIGRI-IKK---
PUR5_LACLA        KALEKYGDIKHEEMYEIFNMGIGMVIAVAPENAEALKKVLN-----AFEIGKM-VKR---
PUR5_ENTFA        KLIQKYGEIPPEEMYEIFNMGLGMILAVSPEHVEKVQELLPE----AFEIGRL-VPR---
PUR5_LISMO        DVVKKYGQLNEMEMYEIFNMGIGMVLAVAKSDVEKTLEVLVQNGEAAYVIGEV-TTR---
PUR5_LACSS        KALQQYGQLAEMEMYNIFNMGIGMVLAVAPEAAPAVLAQLNAKQEQAYQIGTV-QKR---
PUR5_LACF3        DYLKELGGLSDDDCWQTFNMGLGMILAVQPDLVDQVKSRLNQAGEACYQVGQLVNRP---
PUR5_LACRD        DYLRVLGGLTKEDCFEAFNMGIGMVLAVAPDQVAQVQEILSNKNMTSYQIGYLRHCL---
PUR5_LACS1        EYLKKLGNLSQDDCYETFNMGIGMVLAVSEDKLESVKKLLSDKDEDFYIIGNLRKRK---
PUR5_LACDA        NYLKQVGNLSDDDCWQTFNMGLGMILAVPADKKEEAKKLLLASGEKVFEVGHLSERT---
PUR5_LACAC        DYLKKIGVLSDQDCYNTFNMGIGLVLAVSSENVDAVKEQLNTENEEFYEIGKLTARP---
PUR5_STACT        DWLQKEGNIETEEMYNIFNMGIGFTLVVDEAEAEKTLSILKEQNVDAYQIGKITEAS---
PUR5_STAS1        DWLQEQGNISTDEMYNIFNMGIGFTLVVDNNQVESTLEILNGQNIKAYKIGETVKG----
PUR5_STAEQ        NWLQKQGNISTNEMYNIFNMGIGYTIIVDKKDVQTTLTTLRAMDTTAYEIGEIIKDD---
PUR5_STAA8        DWLQQQGNIDTNEMYNIFNMGIGYTVIVDEKDVSRALKILAEQNVEAYQIGHIVKNE---
PUR5_MACCJ        DLLQEKGSIDKMEMYNIFNMGIGFIFIVPREAVEKVRSAVNE---EVFEIGRVVRG----
PUR5_EXIS2        DWLEQAGNVPRHDMYNVFNMGIGYMMIVKPEDVAAVSARLARENETVYTIGTVTSE----
PUR5_EXISA        DWLEQVGNISKQEMFNVFNMGIGYMITVRAEDVELVEAALERVGETAHRIGKVESR----
PUR5_OCEIH        HFLEEKGNIDNREMYGVFNMGIGMAVVVAEEDVSIALQLLEKVDEQAYVIGKVTEE----
PUR5_ALKOO        KFMAEKGNMSKDDIFGTFNMGIGMVVVVSKEDVNGAIAVLNKAGQEAHIIGEVVEGA---
PUR5_ALKMQ        QFIQQEGQIEQDEMFSTFNMGIGMIVVVERSAGEKVVQLLQELGEEASIIGEMVRGS---
PUR5_CLONN        NHIMSLG-VEEEHMYNTFNMGIGYVLCVKEEDAENIIRYIEKMGSKAYKIGHVEAGG---
PUR5_CLOAB        KHIMSLG-VDENHAFNTFNMGIGFVICAAKEDKDGIIASLKESGEKAYEIGYVKAGG---
PUR5_CLOK5        KYIMDLG-VDEEHMYNTYNMGIGFVLCVDSKDAPDIIKDLNEMGEKAYIIGHVKRRE---
PUR5_CLOTE        EYIISKG-IEENHMFNVFNMGIGFVLCVDPCYEKKIIEKLIEQGEKAYKIGHIEKGE---
PUR5_CLOPE        KKLMELG-VKEEEMYNTFNMGIGFVLCVEEDEVEEVLKELSKQGEKAFEIGYINAGG---
PUR5_FUSNN        KLIAERSKIKEEELFGTFNMGVGFTLVVEEKDVETIIELLTSLGETAYEIGHIEKGD---
PUR5_CALS8        RLIQKYSKVDDNEMFSTFNMGIGMVLIVSKDDVETAMEILNEEGINSYVIGTIEKGE---
PUR5_FINM2        KAIQKWGNVETKEMFSTFNMGIGMVVVVDAKDVDKSLEILQKIDPKAKQCGVCKKTE---
PUR5_GEODF        KLIQNAGNIEEQEMFRTFNCGIGMVLSVPEKEVEEILIRLSGLNETAFVIGEIAKCD---
PUR5_GEOUR        QILQNAGNIEENELFRTFNCGIGMVLAVPEKEADEVLIRLSGLNEHAFVIGEIAKCE---
PUR5_GEOBB        RIMQKAGNIEENEMFRTFNCGIGMVLVVPEKESEEIMIRLSGLNETAFVIGEVAKCD---
PUR5_GEOMG        RILQNGGNMEWTEMYRTFNCGIGMVLAVPENDVDEVLIRLSGLQEKAFVIGEVAKCE---
PUR5_GEOSL        SLLQEAGSVERDEMYRTFNCGIGMVLAVPENEADEILIRLSGLQEKAFIIGEIAKCE---
PUR5_GEOLS        TTLQEAGNVEQNEMYRTFNMGIGMVLAVAAADVDDILSRLNGLGEQAWLIGEVKSMS---
PUR5_PELCD        ELLRKAGNIEEEEMYRTLNYGIGMVLVVPETEAEEIMVRLSGLKEDAFIIGEIAKSA---
PUR5_SYNAS        SIIQELGDIDQMEMVRVFNMGIGMILIVSEKETDDIVERLNMLGEKAYIIGSIEKAD---
PUR5_DESAL        PFMKKAGDIDEMEMMRTFNNGIGLVAVIPEPQVQEALELMQAMGEKAYVIGEIAARG---
PUR5_DESPS        TFLEEKGKVPREEMYRTFNMGVGLLVIVAEDKAEDILHHFEALGEKASIIGEIQKQT---
PUR5_DESAG        HWLRDLGELSWPEMLQIFNCGIGYVVIVGQEEADDVLGRLAALDQPAWAIGTVERRR---
PUR5_DESVM        NWLLAQGNLTWPEMLQIFNCGIGYIMIVSPDVCDEVLGRVNAMHAQAWRIGSIGRRR---
PUR5_LAWIP        YWLQEQGSLSWSEMLQVFNCGIGYVLIIPNDSVTRAMNILKSMEVSAWIIGSIEKQ----
PUR5_PSELT        KIIQRLGKIDSKEMYRTFNMGIGFVMVVERDEVENLLRKLNELGQNAWVIGDIVPG----
PUR5_CALS4        DMIRRLGEIEEKEMYRTFNMGIGMVVIIDKEEVEKALKRLKEVGETAFVIGEIVEG----
PUR5_THEYD        HLIKNIGKINEAEMFKVFNMGIGYIFVVEQNEIQKSLAILNKKGYKAYLIGKASKGG---
PUR5_CARHZ        KLIEKAGNVPRREMWRTFNMGIGFILIVEEAKVQEAIKTLESFNYKAWVIGEITAG----
PUR5_MOOTA        RLIQATGRVPEEEMYRTFNMGLGMLVVVEESDAGRVKSRLEAAGEKVFVVGEVIPG----
PUR5_DESHY        TLLQRLGEVEEAEMLRTFNMGIGFVLIVHPEDVDFIQTQLQAAGEKCFVLGEVSGQ----
PUR5_SYNWW        KLIEKLGQVDKSEMFRTFNMGIGYIIVVSPLYHDKALKCLRDKGEKPILIGRVEKD----
PUR5_METS3        KLIYQ-QNVPLEEMYKVFNMGIGFVVITNENEAEKIMETLKDY-CNCQIIGKVTD-DE--
PUR5_METTH        RVIHE-AGVDIREMYRVFNMGVGFCAVVAPDDVDEALSILGD---RAHPIGEVTDRGS--
PUR5_METJA        KEIQRLGNVPDEEMFRTFNMGIGFCVIVDEEDANKVIKIANKYNIPAQVIGRVVDSLE--
PUR5_METMP        KEMQKLGNVADEEMFKTFNMGIGFCVIVEKEDAEKIIEISNHHNIPAFVIGKIEDSVE--
PUR5_METKA        EIIRELGNVPVEEMYRTFNMGMGMALIVPEEEAEDVVDTVSKH-VEAKIVGHVEE--G--
PUR5_METAC        KFLQKEGEVEDLEMYRTFNMGMGFLMILPE-KDAAKAAELTG----GKIVGKIVES----
PUR5_METMA        KFLRKEGGVDDLEMYRTFNMGMGFLIILPE-KDAEKAAEITG----GKIVGKIVES----
PUR5_METBF        KFLQKEGGVEDLEMYRTFNMGMGFLVILPE-KDAAKAAKITG----GKIVGKIVES----
PUR5_METBU        KFLQEEGNVDDLEMYRTFNMGMGFLIILPE-ADAEKAAEMTG----GKIVGKIVES----
PUR5_ARCFU        RFIQKLGEVEEAEMYRTFNMGMGFMVILPE-DEADKLKKLCE----GRVVGYVEKGE---
Q5V4T0_HALMA      EFVQAEGEVSDEEMHRTFNMGTGFVAAVPEADAAEIVADSED----ARVIGEVADGDE--
B0R4C5_HALS3      DYVQDAGGVSDAEMHRTFNMGTGFVVALPE-DAAAALASQTD----GEVVGRVADGD---
G0LLI6_HALWC      EFVQSAGNVSDSEMYQTFNMGTGFVCAMSP-ENAEMLAEATE----GKIIGQVDTGE---
PUR5_PYRFU        KLIHE-NGVPLEEMFRVFNMGVGFVVVVSQEDKEEALQILNRY-YESFELGTVSERP---
PUR5_THEKO        RLIYE-NGVPLEEMFRVFNMGVGMVAVVPREEKEEALQLLNRH-FESFELGKVVGEP---
PUR5_SULTO        KAIEN-AGVPHFEMYKIFNMGIGMIIFVSKDLKDDIIEFLSKK-ETVYELGYVEKGE---
Q4J8F5_SULAC      KAIES-AGVSHEEMYKVFNMGVGMVIFVDKKLKDDVIDTLAKRNDVVYELGVVTEGN---
PUR5_SACS2        KTIEK-AGVAHEEMYKVFNMGIGIVLFVSEELMKEVKTKLEGY-GTVYELGRVYNGN---
PUR5_THEAC        IRLMEMGNLNYAQMFEIFNMGTGFVLVIDEDEKVDIMNALKGK-VPVKVMGHVENGS---
                    :     :         * * *                           *         

PUR5_RHOBA        ----SSKVVYKEA-------------
PUR5_LEPIN        ----NKEEVQFV--------------
PUR5_ACTSZ        --NAGEQQVIIR--------------
PUR5_MANSM        --NAGEEQVIIR--------------
PUR5_HISS2        --NADEEKVVIC--------------
PUR5_PASMU        --TDGEEQVIIR--------------
PUR5_ACTP2        --GEGSEQVEII--------------
PUR5_HAEIN        --GESEAQVEIQ--------------
PUR5_HAEPS        --GSGTEQVEIL--------------
PUR5_ECOLI        --SDSEQRVVIE--------------
PUR5_SHIDS        --SDSEQRVVIE--------------
PUR5_ENT38        --SDSDERVVIE--------------
PUR5_KLEP7        --SDSEQRVVIA--------------
PUR5_SALTY        --SDSEQRVVIE--------------
PUR5_CROS8        --SDAQERVVIA--------------
PUR5_ERWT9        --SDSEERVVINA-------------
PUR5_PECAS        --TDAGDAVVIN--------------
PUR5_YERPE        --TEGAEQVIINP-------------
PUR5_PHOLL        --KEGEQQVVIQ--------------
PUR5_SODGM        --ADGEHQVIIR--------------
PUR5_EDWI9        --QGDGPQVEILR-------------
PUR5_PROMH        --AAGDAQVIIN--------------
PUR5_HAMD5        --KTSSERIIFKKSILNN--------
PUR5_VIBPA        --EANEEQVEIN--------------
PUR5_VIBVY        --EAGEEQVEIN--------------
PUR5_VIBA3        --EAGEEQVEIK--------------
PUR5_ALIF1        --EQGEEQVEIR--------------
PUR5_VIBCH        --NSNEAQVEIN--------------
PUR5_PHOPR        --EVGEEQVEIK--------------
PUR5_SHEWM        --DDSEEQVEIL--------------
PUR5_SHEPA        --NGEEEQVEIL--------------
PUR5_SHEON        --EGNEEQVEIL--------------
PUR5_SHEAM        --NGDEEQVEIL--------------
PUR5_SHEDO        --EGEEEQVEIV--------------
PUR5_SHELP        --NGDEEQVEIC--------------
PUR5_SHEFN        --QGDEEQVEII--------------
PUR5_AERHH        --ADGEEQVIIQ--------------
PUR5_TOLAT        --AAGEKQVEIN--------------
PUR5_IDILO        --AEGEEQVDILADETH---------
PUR5_PSET1        --APGEEQVEIVGGAK----------
PUR5_COLP3        --ADGEEQVVFA--------------
PUR5_ALTMD        --D-GEEQVEINA-------------
PUR5_PSEA6        --S-DNNQVEIK--------------
PUR5_ALCBS        --DGQPDVVLDGLSA-----------
PUR5_SACD2        --AEGAPEVDLLNL------------
PUR5_TERTT        --AAGEEQVELRRN------------
PUR5_HAHCH        --TEEEPVVELKGLVD----------
PUR5_MARHV        -SSDAEPVVRYAPGLLTA--------
PUR5_PSEFS        -APEGAAQVELKNLKAH---------
PUR5_PSEF5        -AAEGAAQVELKNLKAH---------
PUR5_PSESM        -AAEGAAQVELKNLKAH---------
PUR5_PSEMY        -AAEGAAQVQLNNLKTH---------
PUR5_PSEPK        -AAEGAAQVELQNLKAH---------
PUR5_PSEAE        -CGADAERVVLNNLKNH---------
PUR5_AZOVD        -AGDGAERVQLHNLKAH---------
PUR5_CHRSD        -RQDEEEQVRLENVR-----------
PUR5_ACIAD        EGADEKIRVIFA--------------
PUR5_PSYA2        --SREADAVVYR--------------
PUR5_HYDCU        --ESETPEVDLV--------------
PUR5_METCA        --EPAVHYV-----------------
PUR5_NITOC        --TSDGQRVAFNTGNPL---------
PUR5_ALKEH        --EAGAPRVQVVAA------------
PUR5_COXBU        --SEEQPRVTITP-------------
PUR5_BURCJ        --REGEAQTVVV--------------
PUR5_BURVG        --REGEAQTVVV--------------
PUR5_BURPS        --REGEAQTVVV--------------
PUR5_PARPJ        --AAGEAQTVVV--------------
PUR5_PARXL        --AAGEAQTVVI--------------
PUR5_PARP8        --KEGEAQTVVV--------------
PUR5_CUPMC        --AEGQAQTVVV--------------
PUR5_CUPNH        --AEGEAQTIVV--------------
PUR5_RALSO        --QPGEAQTIVI--------------
PUR5_AZOSB        --KDGEAQTIVA--------------
PUR5_AROAE        --AEGAAQTTVG--------------
PUR5_BORA1        --QDGMAQTFVV--------------
PUR5_BORPE        --QDGMAQTVVV--------------
PUR5_BORPD        --KDGEAQTVVV--------------
PUR5_DECAR        --SGDEAQTLVV--------------
PUR5_METFK        --GAGEAQTVVV--------------
PUR5_CHRVO        --QGGEHQTQIA--------------
PUR5_LARHH        --QGDEHQTQIA--------------
PUR5_NEIMB        --QGDEHQTQVA--------------
PUR5_NEIG1        --QGNEHQTQVA--------------
PUR5_NITMU        --RADEPRTILE--------------
PUR5_NITEU        --QSETLPIVIA--------------
PUR5_POLSJ        --GEGAAVIVG---------------
PUR5_RHOFT        --GDDAAVLVR---------------
PUR5_XANOR        --HGDERVRID---------------
PUR5_XANCP        --QGDERVRIG---------------
PUR5_STRMK        --EGAERVHIG---------------
PUR5_XYLFA        --VGNERVHIG---------------
PUR5_OCHA4        DGVVYKGTLSL---------------
PUR5_BRUA2        DGVIYKGQLAL---------------
PUR5_AGRRK        AGTVYKGTLDL---------------
PUR5_RHIEC        AGTVYKGTLAI---------------
PUR5_AGRFC        HGTIYKGTLGL---------------
PUR5_AGRVS        PGTVYKGTLGL---------------
PUR5_RHIME        PGTIYKGNLAI---------------
PUR5_SINFN        PGTIYKGSLAL---------------
PUR5_RHILO        AGVIYRGSIGL---------------
PUR5_CHESB        KGVIYQGALEL---------------
PUR5_BARHE        KGITFKGALHL---------------
PUR5_METNO        APVTFSGSLAL---------------
PUR5_METS4        APVSFAGRLGL---------------
PUR5_METSB        ERVTYSGRLSL---------------
PUR5_BEII9        PRVTFQGQLSL---------------
PUR5_NITWN        GRVVYDGQLDLAV-------------
PUR5_NITHX        -RVVYDNHLDLAM-------------
PUR5_RHOPA        QRVVYDGHLDLAW-------------
PUR5_RHOPB        HRVVYSGHLDLAW-------------
PUR5_PARL1        ARVAVKGALGSGK-------------
PUR5_RUEST        --IRYTGALL----------------
PUR5_RUEPO        --IAYTGKLL----------------
PUR5_ROSDO        --VRYSGTLL----------------
PUR5_RHOS4        --VSYDGRLL----------------
PUR5_DINSH        --VHYRGTLL----------------
PUR5_JANSC        --VRYSGSLG----------------
PUR5_RHORT        --AVIIDHLDEAFAR-----------
PUR5_ERYLH        TVRGSTGTWSATADWETRHLG-----
PUR5_NOVAD        TVTGSAETWSARSAWEATHIG-----
PUR5_SPHAL        TVTGSAETWSARADWSARHNA-----
PUR5_MAGMM        --KEGDARVVIL--------------
PUR5_ANADE        ---PGEATCEVVR-------------
PUR5_ANADF        ---TGEATCEVVR-------------
PUR5_MYXXD        ---QGEATAVIDP-------------
PUR5_SORC5        ---DVPFEERVLFG------------
PUR5_SYMTH        ---PGGPRVVVRR-------------
PUR5_RIPO1        ---GKGEVVIESND------------
PUR5_CROS5        ---GNRELVGL---------------
PUR5_MICAN        ---GKGEIVGLD--------------
PUR5_GLOC7        ---GTGHLVGLDF-------------
PUR5_SYNY3        ---GDGAFVWLD--------------
PUR5_SYNP2        ---GQGEVLGLQ--------------
PUR5_SYNE7        ---GDGTLIGLP--------------
PUR5_CYAP4        ---GAGEVLGLPG-------------
PUR5_THEEB        ---GAGEVLGLPAA------------
PUR5_SYNJB        --PGESRVLGLEQWGSLTSPAD----
PUR5_GLOVI        ---AAGVRFA----------------
PUR5_PROMA        -KQMQSRIVGLPT-------------
PUR5_PROMT        -NSKNIGIFGIPS-------------
PUR5_SYNPW        -PQ-DGPVAGLPA-------------
PUR5_SYNPX        -PE-DG-VIGLPD-------------
PUR5_PROMM        -ST-GERLRGLPS-------------
PUR5_SYNR3        ------GVLGLPAGA-----------
PUR5_PROMP        -SKENNFLPEIII-------------
PUR5_BACAN        ----G-VTFNG---GKAL--------
PUR5_BACCR        ----G-VTFNG---GTAL--------
PUR5_GEOSW        ----G-VSFAG---GAMS--------
PUR5_GEOKA        ----G-VSFAG---GGRA--------
PUR5_BACSU        ----G-VTFGG---AALS--------
PUR5_BACLD        ----G-VVFGG---AGLS--------
PUR5_BACP2        ----G-VTFGG---GSLS--------
PUR5_LYSSC        ----G-VVFNGTHDGSLV--------
PUR5_BACHD        ----G-VVIGG----AFE--------
PUR5_BACSK        ----G-TVIGG----IGA--------
PUR5_BREBN        ----RKVVYNG-----VEW-------
PUR5_HUNT2        ----EGLEIC----------------
PUR5_RUMCH        ----DGVDIC----------------
PUR5_EUBE2        ----KGVTLC----------------
PUR5_AGARV        ----KGVDLV----------------
PUR5_LACP7        ----KGICLC----------------
PUR5_BIFAA        ----TGEDVELQ--------------
PUR5_BIFLO        ----TGTQIVLK--------------
PUR5_BIFA0        ----VNERVDLA--------------
PUR5_STRGC        ----ENESVIIK--------------
PUR5_STRR6        ----ENESVIIK--------------
PUR5_STRT2        ----DGASVVIK--------------
PUR5_STRA5        ----ADDSVVIK--------------
PUR5_STRP1        ----ADASVVIK--------------
PUR5_STRMU        ----ADASVVIK--------------
PUR5_STRU0        ----EDKSVIIK--------------
PUR5_LACLA        ----QDSAVVIKK-------------
PUR5_ENTFA        ----KTKAVIFKEAL-----------
PUR5_LISMO        ----ESNAVIFAGGKKG---------
PUR5_LACSS        ----QQAAVELVTAK-----------
PUR5_LACF3        ----AGEEKIVIK-------------
PUR5_LACRD        ----PDTKKIVIK-------------
PUR5_LACS1        ----GNEEKIIVH-------------
PUR5_LACDA        ----DGE-KIFIKLVE----------
PUR5_LACAC        ----AGKAKIVIE-------------
PUR5_STACT        ----DEPIVLTGVKA-----------
PUR5_STAS1        ----NEPIQLTGV-------------
PUR5_STAEQ        ----DTPIHLLEVE------------
PUR5_STAA8        ----STAIELLGV-------------
PUR5_MACCJ        ----DKAIDIKGV-------------
PUR5_EXIS2        -----PGVRILGVDQ-----------
PUR5_EXISA        -----PGIRISGVDQ-----------
PUR5_OCEIH        -----EGVHFTL--------------
PUR5_ALKOO        ----KQVIL-----------------
PUR5_ALKMQ        ----KQVVLCQK--------------
PUR5_CLONN        ----HGVCLK----------------
PUR5_CLOAB        ----SGVCIK----------------
PUR5_CLOK5        ----KRVCLK----------------
PUR5_CLOTE        ----RKVIIK----------------
PUR5_CLOPE        ----EGVCIK----------------
PUR5_FUSNN        ----HSLCLK----------------
PUR5_CALS8        ----GGVVLR----------------
PUR5_FINM2        ----TSVKINLK--------------
PUR5_GEODF        ----AG-TECVEMV------------
PUR5_GEOUR        ----AG-SECVEMI------------
PUR5_GEOBB        ----AG-KECVDLV------------
PUR5_GEOMG        ----AG-TESVEMI------------
PUR5_GEOSL        ----PG-AEMVELV------------
PUR5_GEOLS        ----KNQTEQVVLV------------
PUR5_PELCD        ----EEGEPTVTLI------------
PUR5_SYNAS        ----GE-KSAVSFT------------
PUR5_DESAL        -----ENDDRIEWK------------
PUR5_DESPS        ----DENDERVTILPEG---------
PUR5_DESAG        ----EESEEQVYVDFG----------
PUR5_DESVM        ----DKAAEQVQVAF-----------
PUR5_LAWIP        ----NVGDEQVIITY-----------
PUR5_PSELT        -------EKGVII-------------
PUR5_CALS4        -------EGGVIL-------------
PUR5_THEYD        -------EDKITIK------------
PUR5_CARHZ        -------ERRVIINE-----------
PUR5_MOOTA        -------RREVEFVPGLQ--------
PUR5_DESHY        -------SEGVSYL------------
PUR5_SYNWW        -------REKVSIQ------------
PUR5_METS3        ----KITVKTFEGSEVTY--------
PUR5_METTH        ----EVELEACTGETIKL--------
PUR5_METJA        ----VNGNKIVGKAVVKYNDKHIILE
PUR5_METMP        ----VNGETKKETVLVEYNNKKMIME
PUR5_METKA        ----RGVVVHMDGHEVKL--------
PUR5_METAC        ----GIRVKDLIIE------------
PUR5_METMA        ----GIRVKDLVIE------------
PUR5_METBF        ----GIRVKDLVIE------------
PUR5_METBU        ----GIRVRDLEIV------------
PUR5_ARCFU        ----GVYVKDLRLDA-----------
Q5V4T0_HALMA      ----AVAIRNLELTE-----------
B0R4C5_HALS3      ----GVSIRGLSL-------------
G0LLI6_HALWC      ----GVSIRGLEL-------------
PUR5_PYRFU        ----GIIVENYGVKFI----------
PUR5_THEKO        ----GIRVENYGIKL-----------
PUR5_SULTO        ----GIKITTYKNEILYI--------
Q4J8F5_SULAC      ----GIKISTYKNSIVYL--------
PUR5_SACS2        ----GITIKTYKNEILRL--------
PUR5_THEAC        ----GVEIPKYEVSLKGYY-------