CLUSTAL format seed alignment for MF_00745

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SPRTL_BACAN      -----MDEQEIQRLVEEVSLQYFGMPFLHKAMFNSRLRTTGGRYLLNTHNIELNYRYYEM
SPRTL_BACCR      -----MDEQEIQRLVEEVSLQYFEMPFLHKAVFNNRLRTTGGRYLLKSHNIELNYRYYEL
SPRTL_BACSU      -----MDNKELQKLTEDISETYFKKPFRHQALFNDRLKTTGGRYLLTSHNIELNRKYLIE
SPRTL_LISIN      -----MNQTELQQHMEEVSLQFFQKEFRHQAVFNTRLRTTGGRYLLKSHNIEMNPKYLEN
SPRTL_LISMO      -----MNQAELQRHMEEVSLQFFQKEFRHQAVFNARLRTTGGRYLLKSHNIEMNPKYLEN
SPRTL_BACHD      -----MTEQELQQLVEDISLKSFGMKFRHKARFNPRLRTTGGRYLLHSHDIELNPKHLEL
SPRTL_STAAM      -----MNNDKLQRMVENLSEEKFGRTFRHCAYFNKRLRTTGGRYLLKSHDIEINPKQYEH
SPRTL_STAES      -----MNNLALQSLTESIAIKYFGKAFKHEVYYNKRLRTTGGRYILSSHNIEINPKQYEM
SPRTL_OCEIH      --MKLPSDIELFELVDKLSLTYFNKHFIDKVYFNTRLRTTGGRYLPSKRVIELNPKYVLE
SPRTL_LACPL      -----MTDLELQQLVATISMHDFHRPFQHRAYFNARLRTTGGRYQLASHDIDINPKMLTD
SPRTL_ENTFA      -----MTDQALQTLVEKISIVFFQKPFLHQATFNRRLKTTGGRYHLASHHLDFNPTVFLK
SPRTL_STRA3      MDLVLSSQTDLTNYVKKVSIEDFGCQFLHTAHWNNRLRTTGGRFFPNDRHLDFNPKIYRE
SPRTL_STRA5      ----------MTNYVKKVSIEDFGCQFLHTAHWNNRLRTTGGRFFPNDRHLDFNPKIYRE
SPRTL_STRP3      --------MTLTNYVQEVSLADFGKPFHHKAYWNKRLKTTGGRFFPKDGHLDFNPRMLEE
SPRTL_STRP1      --------MTLTNYVQEVSLADFGKPLHHKAYWNKRLKTTGGRFFPKDGHLDFNPRMLEE
SPRTL_STRP8      --------MKLTNYVQEVSLADFGKPFHHKAYWNKRLKTTGGRFFPKDGHLDFNPRMLEE
SPRTL_STRMU      --------MNLTDYVKEVSRQDFGIEFQHTASWNSRLQTTGGRFFPEDGHLDFNPKFCKK
SPRTL_STRPN      --------MKLTDYVKQVSLEDFGRPFIHHVQWNRRLRSTGGRFFPKDGHLDFNPKVYQE
SPRTL_STRR6      --------MKLTDYVKQVSLEDFGRAFIHHVQWNRRLRSTGGRFFPKDGHLDFNPKVYQK
SPRTL_LACLA      ----MLTNQELTAKVKEISLTYFKQSFDHEAKWNQRLRTTGGRFFPKDLHLDFNPKMAEL
                           :      ::   *   : . . :* **::****:      :::*      

SPRTL_BACAN      YGKEELVGIVKHELCHYHLHITGRGYKHRDKDFRELLKAVDAPRFCKRMVNAEKE-KRVY
SPRTL_BACCR      YGEEELVGIIKHELCHYHLHIAGRGYKHGDRDFRELLKKVDAPRFCKRMINEEKE-KKIY
SPRTL_BACSU      HGREELIGIIKHELCHYHLHLEGKGYKHRDRDFRMLLQQVNAPRFCTPLKKKAEN-KKTY
SPRTL_LISIN      FGLEYFFGIMKHELCHYHLHLEKKGYQHRDKDFRELLKKVDAPRFCAAIPRE----ITMH
SPRTL_LISMO      FGLAYFIGIMKHELCHYHLHLEKKGYQHRDQDFRELLKKVDAPRFCATIPRE----ITMH
SPRTL_BACHD      FGLDELIGIIKHELCHYHLHLQKKGYHHRDADFKLLLKEVDAPRYCAKIPHAQNSVKTRH
SPRTL_STAAM      YGEDAVVKIILHELCHYHLHIAGKGYQHKDQDFKRLSQQVGAPRFCNSIESYQQR--ANY
SPRTL_STAES      FGEKAVIDIIKHELCHYFLHLAGEGYQHRDKAFKSLSAKVGAPRFCTPTESYQDR--ANY
SPRTL_OCEIH      SNKEEFYGIIKHELCHYHLHIEGKGYKHGDRDFKELLKATGSPRHCSPLPSQQRE--YRY
SPRTL_LACPL      FDEATLIGVIKHELCHYHLHLTKRGYRHRDADFKRLLAQVGGSRYAPAPKQATAR-PYRY
SPRTL_ENTFA      YGQEELEKVIKHELCHYHLHLAGKGYQHKDKDFKELLAKTGGARYAPPLVERKKA--VFH
SPRTL_STRA3      FGIDIFRKIVRHELCHYHLYIQGKGYQHRDKAFKELLEKVDGLRYTPRV-TAVKV--NYH
SPRTL_STRA5      FGIDIFRKIVRHELCHYHLYIQGKGYQHRDKAFKELLEKVDGLRYTPRV-TAVKV--NYH
SPRTL_STRP3      HGELIFRKIVRHELCHYHLYFEGRGYHHKDRDFKDLLAQVNGLRYVPTS-SKSK---TNH
SPRTL_STRP1      HGELIFRKIVRHELCHYHLYFEGRGYHHKDRDFKDLLAQVNGLRYVPTS-SKSK---TNH
SPRTL_STRP8      NGELIFRKIVRHELCHYHLYFEGRGYHHKDRDFKDLLAQVNGLRYVPTS-SKSK---TNH
SPRTL_STRMU      GDAGTFRKIVRHELCHYHLYYAGKGYRHGDKDFKDLLLQVNGVRYAPSI-QSNT---FYH
SPRTL_STRPN      LGLDVFRKIVRHELCHYHLYFQGKGYQHKDRDFKELLKAVDGLRFVPSLPNSNSK--PIK
SPRTL_STRR6      LGMEVFRKIVRHELCHYHLYFQGKGYQHKDRDFKELLKAVDGLRFVPSLPNSNSK--PLK
SPRTL_LACLA      KD---FEGVILHELTHYHLYRSKRGYKHRDADFKRLLSQVGGLRYAPSV--IDKK--IKY
                  .   .  :: *** **.*:   .**:* *  *: *   ... *.               

SPRTL_BACAN      VYECMECLLQYVRRRQINTKRYVCGKCKGKLNLIKKTS------
SPRTL_BACCR      KYECMECSLQYVRRRQINIKRYVCGKCKGKLKPISKTS------
SPRTL_BACSU      MYICTTCGQQYIKKRAMNPDRYRCGKCRGKIKRIFS--------
SPRTL_LISIN      EYTCKSCGKSFLRQRRFNVNRYRCGSCGGRLKQTGSKKVYTESP
SPRTL_LISMO      EYTCKSCGKSFLRQRRFNVNRYRCGSCGGKLIQTDSKKIYTENP
SPRTL_BACHD      LYVCTGCGTRFERKREVDTSRYVCGKCNGRLKKIKG--------
SPRTL_STAAM      EYYCTKCHAKYIRIRKVDTNRMRCGHCNGKLRMKRQLK------
SPRTL_STAES      KYRCIYCEQEFIRIKRVNLEKMRCGRCGGILKLLQTRK------
SPRTL_OCEIH      KYQCIQCGFVYKRVRKVNMRKYRCGKCRGSLKEI----------
SPRTL_LACPL      IYECQRCGRRYYRKRRMDTRRYTCGRCQGPIKLV----------
SPRTL_ENTFA      QYQCQSCGEVILRKRRIDTTRYVCGKCHGRLSWQAKKEQI----
SPRTL_STRA3      HYSCQSCGQVYRRRRRVNLRKFACGYCHGRLIESF---------
SPRTL_STRA5      HYSCQSCGQVYRRRRRVNLRKFACGYCHGRLIESF---------
SPRTL_STRP3      HYSCQTCGQVYQRKRRINLAKYVCGNCHGKLMEKNQS-------
SPRTL_STRP1      HYSCQTCGQVYQRKRRINLAKYVCGNCHGKLMEKNQS-------
SPRTL_STRP8      HYSCQTCGQVYQRKRRINLSKYVCGNCHGKLIEKNQS-------
SPRTL_STRMU      YYQCESCGQVYQRKRRMNTKKYACGNCHGKLRHQNQS-------
SPRTL_STRPN      LYRCQSCQQRYQRKRRIDTQRYRCGLCRGKLLLVNQPED-----
SPRTL_STRR6      LYRCQSCQQRYQRKRRIDTKRYRCGLCRGKLLLINQPED-----
SPRTL_LACLA      YYSCQNCGQLYPRQRKIDTKKYRCGKCRGKLILKTSGN------
                  * *  *     : : .:  :  ** * * :