CLUSTAL format seed alignment for MF_00749

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PROQ_HAEIN            MQTEV-----------------QKLTNAKAIITYLAEKFPLCFVLEGEAKPLKIGLFQDL
PROQ_PASMU            -MTEV-----------------QKLTNNKEVIAYLVEKFPLCFSLEGEAKPLKIGLFQDL
PROQ_SHEON            -MEST-----------------DKLTDTNAILAYLYETFPLCFIAEGETKPLKIGLFQDL
Q3IH05_PSET1          -METT-----------------NKLKDMNEVLEFLYQEFPQCFKQKDGIKPLKVGIFKDI
PROQ_VIBVU            ---MT-----------------EKLKNSKEVIAYIAECFPKCFTLEGEAKPLKIGIFQDL
PROQ_VIBVY            ---MT-----------------EKLKNSKEVIAYIAECFPKCFTLEGEAKPLKIGIFQDL
PROQ_VIBPA            ---MT-----------------EKLKNSKEVIAYIAECFPKCFTLEGEAKPLKIGIFQDL
PROQ_VIBCH            -MENT-----------------EKLKNSKEVIAYIAECFPNCFTLEGEAKPLKIGIFQDL
PROQ_SALTI            -MENQ-----------------PKLNSSKEVIAFLAERFPHCFSAEGEARPLKIGIFQDL
PROQ_SALTY            -MENQ-----------------PKLNSSKEVIAFLAERFPHCFSAEGEARPLKIGIFQDL
PROQ_ECOLI            -MENQ-----------------PKLNSSKEVIAFLAERFPHCFSAEGEARPLKIGIFQDL
PROQ_SHIFL            -MENQ-----------------PKLNSSKEVIAFLAERFPHCFSAEGEARPLKIGIFQDL
PROQ_ECOL6            -MENQ-----------------PKLNSSKEVIAFLAERFPHCFSAEGEARPLKIGIFQDL
PROQ_ECO57            -MENQ-----------------PKLNSSKEVIAFLAERFPHCFSAEGEARPLKIGIFQDL
PROQ_YERPE            -MENQ-----------------PKLNSSKEVIAFLAERFPLCFTAEGEARPLKIGIFQDL
PROQ_PHOLL            -MENQ-----------------PKLNSSKEIIAFLAERFPLCFVAEGEARPLKIGIFQDI
PROQ_HAEDU            -MSVQPETMPDSS--------NKTNPTVKEVIAYLADKFPLCFSIEGEAKPLKVGLSQDL
B0BS24_ACTPJ          -MSEQQVKIQNG---------NKTNPSVKEVITYLAEKFPLCFSVEGEAKPLKVGLFQDL
A0A378NF40_MANHA      -MSEQIEQKVE-------QTQNKTNPSTKEVIAYLAEKFPLCFTLEGEVKPLKVGLFQEL
M4R4F2_BIBTR          -MSEQLNEQLSEQDEQAVQTHQKTAMPIKEVIAYLCEKFPLCFIAEGEAKPLKVGLFQEL
B8F8P3_HAEPS          -MSEQQLNTIQN---------LKTALSTKEIIAYLAEKFPLCFSLEGEAKPLKIGLFQDL
                                             .    : :: :: : ** **  :.  :***:*: :::

PROQ_HAEIN            AEALQDDERVSKTQLRQALRQYTSNWRYLYGCREGAVRVDLQGNPAGVLDAEHVAHAAQQ
PROQ_PASMU            AEALQDDERVSKTQLRQALRAYTSNWRYLHGCKAGAERVDLQGNVCGILEQEHAEHAAQQ
PROQ_SHEON            AERLADDSKVSKTQLRVALRRYTSSWRYLKSVKAGAQRVDLDGQPCGELEQEHIDHAQAM
Q3IH05_PSET1          AERIEGSEKVSKTQVRQALRKYTSNWRYLEAVTKSEFRIDLDGNQAEKVEQEHIDHAQKA
PROQ_VIBVU            AERLSEDEKVSKTQLRAALRQYTSSWRYLHGVKLGATRVDLDGNECGVLEEEHVEHAKAT
PROQ_VIBVY            AERLSEDEKVSKTQLRAALRQYTSSWRYLHGVKLGATRVDLDGNECGVLEEEHVEHAKAT
PROQ_VIBPA            AERLNEDEKVSKTQLRAALRQYTSSWRYLHGVKPGAVRVDLDGNPCGELEEEHVEHAKAT
PROQ_VIBCH            ADRLNDDPKVSKTQLRAALRQYTSSWRYLHGVKPGATRVDLDGNPCGELEEQHVEHAQAA
PROQ_SALTI            VERVGGEMNLSKTQLRSALRLYTSSWRYLYGVKPGATRVDLDGNPCGELEEQHVEHARKQ
PROQ_SALTY            VERVGGEMNLSKTQLRSALRLYTSSWRYLYGVKPGATRVDLDGNPCGELEEQHVEHARKQ
PROQ_ECOLI            VDRVAGEMNLSKTQLRSALRLYTSSWRYLYGVKPGATRVDLDGNPCGELDEQHVEHARKQ
PROQ_SHIFL            VDRVAGEMNLSKTQLRSALRLYTSSWRYLYGVKPGATRVDLDGNPCGELDEQHVEHARKQ
PROQ_ECOL6            VDRVAGEMNLSKTQLRSALRLYTSSWRYLYGVKPGATRVDLDGNPCGELDEQHVEHARKQ
PROQ_ECO57            VDRVAGEMNLSKTQLRSALRLYTSSWRYLYGVKPGATRVDLDGNPCGELDEQHVEHARKQ
PROQ_YERPE            VERVQGEENLSKTQLRSALRLYTSSWRYLYGVKVGAERVDLDGNPCGVLEEQHVEHARKQ
PROQ_PHOLL            VERIQDEECLSKTQLRSALRLYTSSWRYLYGVKEGAQRVDLDGNSCGELEAEHIEHALQQ
PROQ_HAEDU            AEALADDEKVSKTLLRQVLRSYTMSWRYLACCKANAQRIGLQGENVGIVDEAQAEHAAQS
B0BS24_ACTPJ          AEALANDEKVSKTLLRQALRTYTMSWRYLACCKANVQRVGLQGEEAGIVDEAQAEHAAQT
A0A378NF40_MANHA      AEALKDDEKISKTLLRQVLRNYTNSWRYLAASQANVARVGLQGEEVGVVTEDEATHAAEA
M4R4F2_BIBTR          AEALAGDDKVSKTLLRQALRSYTMSWRYLHACRDGAVRVGLNGEEAGVVDSQQAEHAAQT
B8F8P3_HAEPS          VEALSDDEKISKTGLRQALRVYTMSWRYLHACKEGAVRVGLQGEEAGVVEAAQAEHAAQS
                      .: :  .  :*** :* .** ** .****     .  *:.*:*:    :   .  **   

PROQ_HAEIN            LAEAKARFAEKRAAAKKAQQKK------------HPRKPA--------------------
PROQ_PASMU            LAEAKAKVAAMRAAEKAAKPEKKRPARRVAAKGQHAKETT--------------------
PROQ_SHEON            LKESQEKAKAKRAAQTPKAAPAG--KAPAKKAPKKVAVPA---------------RKTER
Q3IH05_PSET1          LEESRAKMAKRKKQQRPRPDADA--KSFKKK-PTHAAKNA---------------TSADK
PROQ_VIBVU            LAESKAKVQARRKEQAQKARDE------EKSKPKTK-KAP----------------QQ-R
PROQ_VIBVY            LAESKAKVQARRKEQAQKARDE------EKSKPKTK-KAP----------------QQ-R
PROQ_VIBPA            LAESKAKVQARRKEQAQKAREEG----KAKAKPAAN-KKP----------------QQPR
PROQ_VIBCH            LAESKARVEARRKEQVKKVREE------AKANKPKA-KKP----------------QQAR
PROQ_SALTI            LEEAKARVQAQRAEQQAKKREAA-AAAGEKEDAPRRERKP-RPVA-RRKEGAE---RKPR
PROQ_SALTY            LEEAKARVQAQRAEQQAKKREAA-AAAGEKEDAPRRERKP-RPVA-RRKEGAE---RKPR
PROQ_ECOLI            LEEAKARVQAQRAEQQAKKREAA-ATAGEKEDAPRRERKP-RPTTPRRKEGAE---RKPR
PROQ_SHIFL            LEEAKARVQAQRAEQQAKKREAA-AAAGEKEDAPRRERKP-RPTTPRRKEGAE---RKPR
PROQ_ECOL6            LEEAKARVQAQRAEQQAKKREAA-AAAGEKEDAPRRERKP-RPTTPRRKEGAE---RKPR
PROQ_ECO57            LEEAKARVQAQRAEQQAKKREAA-AAAGEKEDAPRRERKP-RPTTPRRKEGAE---RKPR
PROQ_YERPE            LEEAKARVQAQRAEQQAKKREAA-IAAGETP-EPRRPRPAGKKPAPRREAGAAPENRKPR
PROQ_PHOLL            LTEAKARVQAQRAEQRAKKREAENVAAGEKNERPTAKKPAPRRRANNTEGEKR---QPPR
PROQ_HAEDU            LAVAKEAYAARKAEQRK------------------EQRKD--------------------
B0BS24_ACTPJ          LTVAKEAYAARKAEQRK------------------EQRKE--------------------
A0A378NF40_MANHA      LAAAKVV-AERKAQERK------------------AQRKE--------------------
M4R4F2_BIBTR          LAQAKVVVAERRAAERKE--------------QRKAQRKE--------------------
B8F8P3_HAEPS          LAEAKAAYAERKALQLKE--------------KRKEERKT--------------------
                      *  ::      :                                                

PROQ_HAEIN            -NKNLK--KESKL-----------SLSAVDFSQISVGSVVKVKAGDNAKKATVVEVLKDS
PROQ_PASMU            -TNKAKVTRKPKV-----------ILNAIELASLQKGDSVKVKVGESAKKAIVLEVVKDS
PROQ_SHEON            PAKAAPKVEPVV------------NLVQAQLTDLAKKQRVNVKLGMTPVAGVITDINKED
Q3IH05_PSET1          TAKAAP-VKRSG------------KIEPLPASEVKVNNKVKVKLGQALVNAIITEVNKDD
PROQ_VIBVU            RANKPQAQKPAKQ---------PVETRALNADELITGKAVNVNMGKGNMAATIVEINKDD
PROQ_VIBVY            RANKPQAQKPAKQ---------PVETRALNADELITGKAVNVNMGKGNMAATIVEINKDD
PROQ_VIBPA            RTNKPKVQKPTK----------PVETRALNADEITVGNAVNVNMGKGNMAATIVEINKDD
PROQ_VIBCH            RPQN--APKVEKK---------PVETRALAASELNVGNQVNVNMGKGNMAATIVEVNKED
PROQ_SALTI            -ADKP-TTKAPR------APREEKHTPVSDISVLTVGQSLKVKAGNNAMDATVLEITKDG
PROQ_SALTY            -ADKP-TTKAPR------APREEKHTPVSDISVLTVGQSLKVKAGNNAMDATVLEITKDG
PROQ_ECOLI            -AQKP-VEKAPKT---VKAPREEQHTPVSDISALTVGQALKVKAGQNAMDATVLEITKDG
PROQ_SHIFL            -AQKP-VEKAPKT---VKAPREEQHTPVSDISALTVGQALKVKAGQNAMDATVLEITKDG
PROQ_ECOL6            -SQKP-VEKAPKT---VKAPREEQHTPVSDISALTVGQALKVKAGQNAMDATVLEITKDG
PROQ_ECO57            -AQKP-VEKAPKT---AKAPREEQHTPVSDISALTVGQALKVKAGQNAMDATVLEITKDG
PROQ_YERPE            QSPRPQQVRPPRP---QVEENQPRPVPVTDISKLQIGQEIKVRAGKSAMDATVLEIAKDG
PROQ_PHOLL            PQKRPQQARKPVAKPVQAKPIQAAPIQIVDVSSLKIGQEIKVRVGKSSVDASVLEVAKDG
PROQ_HAEDU            ------------------------------FFKKKAREERNAKTMNKAVKKGSP-KKDTF
B0BS24_ACTPJ          ------------------------------FFKKKAQEEKAKKNAANQVKKTPRVAKEAS
A0A378NF40_MANHA      ------------------------------YFKQKAREENAKKRAEFKAK----KAIDNL
M4R4F2_BIBTR          ------------------------------FFKQKAREENAKKRTE----------RHNA
B8F8P3_HAEPS          ------------------------------FFKQKAREAHAKKRAETK--------KQEM
                                                           .    .              .  

PROQ_HAEIN            ARVELENGLIMNVAADRLFA-
PROQ_PASMU            ARVQLENGLVITVTAEHLFA-
PROQ_SHEON            IHVQLDSGLTIKVKAEHILL-
Q3IH05_PSET1          VHVELVTGMQVKTKADSLYII
PROQ_VIBVU            VRVQLSNGLQMVVKAEHLRA-
PROQ_VIBVY            VRVQLSNGLQMVVKAEHLRA-
PROQ_VIBPA            VRVQLANGLQMVVKAEHLRA-
PROQ_VIBCH            VRVQLANGLQMVVKAEHLRA-
PROQ_SALTI            VRVQLNSGMSLIVRAEHLVF-
PROQ_SALTY            VRVQLNSGMSLIVRAEHLVF-
PROQ_ECOLI            VRVQLNSGMSLIVRAEHLVF-
PROQ_SHIFL            VRVQLNSGMSLIVRAEHLVF-
PROQ_ECOL6            VRVQLNSGMSLIVRAEHLVF-
PROQ_ECO57            VRVQLNSGMSLIVRAEHLVF-
PROQ_YERPE            VRVQLSSGLAMIVRAEHLQF-
PROQ_PHOLL            VRVQLPSGLAMIVRAEHLQF-
PROQ_HAEDU            AKATAESLAVLTHKFSKGNK-
B0BS24_ACTPJ          VKATAESLAALTSKFGKGNK-
A0A378NF40_MANHA      PKASEEKLAALADKFGRK---
M4R4F2_BIBTR          PKASLESLAALESKFSRK---
B8F8P3_HAEPS          PKASLESLSALESKFAKGKK-
                       :.   .   :