CLUSTAL format seed alignment for MF_00752

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PSBH_CHLVU      ------MATGTTSKVKVSDTGVSTPLGTLLKPL-NSEY-GKVAPGWGTTVLMGIFMALFA
PSBH_MESVI      --------------MADTSQGKRTVVGNFLKPL-NSEY-GKVAPGWGTTVLMGVFMALFA
PSBH_MARPO      -------MATQIIDDTPKTKGKKSGIGDILKPL-NSEY-GKVAPGWGTTPLMGIMMALFA
PSBH_CYACA      -------------------MALKTRLGELLRPL-NSQY-GKVAPGWGTTPIMGIFMALFL
PSBH_NOSS1      -------------------MAQRTRLGDILRPL-NSEY-GKVAPGWGTTPVMGVFMALFL
PSBH_SYNPX      -------------------MAQRTRLGDLLRPL-NSEY-GKVVPGWGTTPVMGIFMVLFL
PSBH_SYNY3      -------------------MAQRTRLGDILRPL-NSEY-GKVVPGWGTTPVMGVFMALFL
PSBH_THEEB      -------------------MARRTWLGDILRPL-NSEY-GKVAPGWGTTPLMAVFMGLFL
PSBH_CHLRE      MATGTSKAKPSKVNSDFQEPGLVTPLGTLLRPL-NSEA-GKVLPGWGTTVLMAVFILLFA
PSBH_PROMA      -------------------MGQKTAVGSLLKSIGNSGQ-GKVVAGWGAVPVMAFVGVLLL
PSBH_PROMP      -------------------MGQKTALGTLLKAIGNSGQ-GKVVPGWGAVPIMTVIGLLLL
PSBH_PROMM      -------------------MAQSTRLGNLIKSL-PGYAPGKVVPGWGTTPVMAGIGFMLL
PSBH_PROHO      -------------------MGQKTALSNFLKPF-NSNA-GKVVPGWGTTPLMGLFMGLLF
PSBH_EUGGR      -------MTTISKNKTSNSKGKTTTLGTILKPL-NSKY-GKVLPGWGTAGIMLIFMTLFA
PSBH_CYAPA      -------------------MPQRTALGNILRPL-NSEY-GKVAPGWGTTPLMAVFMLLFF
PSBH_GUITH      -------------------MALRTRLGELLRPL-NSEY-GKVAPGWGTTPAMGFVMLLFF
PSBH_PORPU      -------------------MALRTRLGEILRPL-NSEY-GKVAPGWGTTPIMGIFMLLFF
PSBH_TRICV      -------------------MALRTRLGEILRPL-NAEY-GKVAPGWGTTPIMGVVMLAFL
PSBH_ARATH      -------MATQTVEDSSRSGPRSTTVGKLLKPL-NSEY-GKVAPGWGTTPLMGVAMALFA
PSBH_SPIOL      -------MATQTVESSSRSRPKPTTVGALLKPL-NSEY-GKVAPGWGTTPLMGVAMALFA
PSBH_POPDE      -------MATQSVEGSSRSGPRRTIVGDLLKPL-NSEY-GKVAPGWGTTPLMGVAMALFA
PSBH_TOBAC      -------MATQTVENSSRSGPRRTAVGDLLKPL-NSEY-GKVAPGWGTTPLMGVAMALFA
PSBH_LOTJA      -------MATQTVEDSSRARPRQTSVGSLLKPL-NSEY-GKVAPGWGTTPLMGIAMALFA
PSBH_OENEH      -------MATQTAEESSRARPKKTGLGGLLKPL-NSEY-GKVAPGWGTTPLMGLAMALFA
PSBH_HORVU      -------MATQTVEDSSKPRPKRTGAGSLLKPL-NSEY-GKVAPGWGTTPFMGVAMALFA
PSBH_MAIZE      -------MATQTVEDSSRPKPKRTGAGSLLKPL-NSEY-GKVAPGWGTTPFMGVAMALFA
PSBH_WHEAT      -------MATQTVEDSSKPRPKRTGAGSLLKPL-NSEY-GKVAPGWGTTPFMGVAMALFA
PSBH_ORYSA      -------MATQTVEDSSRPGPRQTRVGNLLKPL-NSEY-GKVAPGWGTTPFMGVAMALFA
PSBH_PINTH      -------MATQTIDDTSKTTPKETLVGTTLKPL-NSEY-GKVAPGWGTTPLMGFAMALFA
                                       :  .  ::.:  .   *** .***:.  *      : 

PSBH_CHLVU      VFLVIILEIYNSSVLLDDVTMSWESLSK--
PSBH_MESVI      VFLVIILQIYNASVLLDGIPANWSSLSKY-
PSBH_MARPO      VFLVVILELYNSSVLLDGVSVSW-------
PSBH_CYACA      LFLIIILQIYNSSLILENLDISWTTLGI--
PSBH_NOSS1      VFLLIILQLYNKSILIQDVRVGW-------
PSBH_SYNPX      VFLLVILQLYNKSLILEGINVNWNGLG---
PSBH_SYNY3      VFLLIILQIYNSSLILEGFSVDWAG-----
PSBH_THEEB      VFLLIILEIYNSTLILDGVNVSWKALG---
PSBH_CHLRE      AFLLIILEIYNSSLILDDVSMSWETLAKVS
PSBH_PROMA      VFLVILLQIYNQSLLLQGFSVDWNGVN---
PSBH_PROMP      VFLVILLQIYNQSLLLQGFSVDWNGN----
PSBH_PROMM      IFLVTILQIYNQSLLLQSISFE--------
PSBH_PROHO      VFLLIILQIYNSTIVLDAFSVNVGG-----
PSBH_EUGGR      IFLTIILEIYNSSVILDIK-----------
PSBH_CYAPA      VFLLIIIQIYNSSLLLENVQVSWTAATA--
PSBH_GUITH      LFLLIILQIYNSSLILENVDVDWASLGN--
PSBH_PORPU      LFLLIILQIYNSSLVLENVDVDWATLGS--
PSBH_TRICV      VFLLIILQIYNSSLIIENVDVDWSNGIV--
PSBH_ARATH      VFLSIILEIYNSSVLLDGISVN--------
PSBH_SPIOL      VFLSIILEIYNSSVLLDGISMN--------
PSBH_POPDE      VFLSIILEIYNSSVLLDGISMN--------
PSBH_TOBAC      VFLSIILEIYNSSVLLDGISMN--------
PSBH_LOTJA      IFLSIILEIYNSSILLDGISMN--------
PSBH_OENEH      VFLSIILEIYNSSVLLDGISMN--------
PSBH_HORVU      IFLSIILEIYNSSILLDGILTN--------
PSBH_MAIZE      IFLSIILEIYNSSVLLDGILTN--------
PSBH_WHEAT      IFLSIILEIYNSSVLLDGILTN--------
PSBH_ORYSA      VFLSIILEIYNSSVLLDGILMN--------
PSBH_PINTH      VFLSIILEIYNSSVLLDGIPVSWG------
                 **  ::::** :::::