CLUSTAL format seed alignment for MF_00758

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y781_AGRFC       -----------MSFSTLMDKRERGSFDSQFLIAMPGLD-DGNFARSVIYICAHSDAGAMG
Y917_RHIME       -----------MAKNVLHTIRERGFLDGQFLIAMPGMF-DTNFARTVIFVCAHSEDGAMG
Y1454_BRUME      ------------MTTHRKPSQEQGFLNGQFLLAMPGMS-DERFARSVVYICAHSDEGAMG
Y480_BRUSU       ------------MTTHRKPSQEQGFLNGQFLLAMPGMS-DERFARSVVYICAHSDEGAMG
Y7511_RHILO      ----------MDLLRHKKTAAGRGFLDDQFLIAMPGMK-DDRFTRSVIYICAHSDEGAMG
Y1492_BRADU      MAPTGKRTGESTRSTGPAPPSSAGYLDGRLLIAMPVMG-DARFERSVIYLCAHSAEGAMG
Y3395_CAUVC      -------------MASLIDDDDGEFLIGRLLVAMPGIE-DPRFERTVLYLCAHDEDAAMG
Y2918_XANAC      ------------------MSVLPTPLANQLLIALPALS-DPTFSRSVALICQHDENGAMG
Y2748_XANCP      ------------------MSVLPTPLANQLLIALPALS-DPTFSRSVALICQHDENGAMG
Y2228_XYLFA      ------------------MSMPTMTLVNQLLIALPSMP-DPHFARGVALICQHDSNGSMG
Y1276_XYLFT      ------------------MSMPTMTLVNQLLIALPSMP-DPHFARGVALICQHDSNGAMG
Y2093_COXBU      ------MRLSGDPRILSVIMVKTNILSNHFLVAMPQLN-DFTFTKAVIYVSQHDAKGALG
Y4405_BORBR      ----MTDSHRPDADDIPDDDELSTDFSNQFLLAMPGVV-EGSLAGTVIYICEHTRRGALG
Y3932_BORPA      ----MTDSHRPDADDIPDDDELSTDFSNQFLLAMPGVV-EGSLAGTVIYICEHTRRGALG
Y319_BORPE       ----MTDSHRPDADDIPDDDELSTDFSNQFLLAMPGVV-EGSLAGTVIYICEHTRRGALG
Y675_RALSO       -------MASPDA---------PINLTNQFLIAMPGMA-DPTFSGTVVYLCEHNERGALG
Y1668_NITEU      --------------------MQSINLTDHFLIAMPGLE-DSFFARTLTYICEHSERGALG
Y1550_NEIMA      -----------------------MNLSNHFLVAMPDME-DAFFSQSVVYICKHDEDGALG
Y1336_NEIMB      -----------------------MNLSNHFLIAMPDME-DAFFSQSVVYICKHDEDGALG
Y3909_CHRVO      --------------------MESLSLSHHFLIAMPGMG-DPLFAKSLVYLCEHGEHGAMG
Y4995_PSEPK      -----------------MKTLAPSYLKHQFLIAMPHMA-DPNFAQTLTYIVEHNEHGAMG
Y5037_PSESM      -----------------MKKVSPSYLKHQFLIAMPHMH-DENFAQTLTYVVEHNANGAMG
ALGH_PSEAE       -----------------MKQSSPTYLKHHFLIAMPHMA-DPNFAQTVTYLVEHNEQGAMG
YQGE_ECOLI       -----------------------MNLQHHFLIAMPALQ-DPIFRRSVVYICEHNTNGAMG
YQGE_ECO57       -----------------------MNLQHHFLIAMPALQ-DPIFRRSVVYICEHNTNGAMG
YQGE_SALTI       -----------------------MNLQHHFLIAMPALQ-DPIFRRSVVYICEHNQDGAMG
YQGE_SALTY       -----------------------MNLQHHFLIAMPALQ-DPIFRRSVVYICEHNQDGAMG
Y1183_PHOLL      -----------------------MNLQHHFLIAMPSLS-DPYFKRSVVYICEHNANGAMG
Y936_YERPE       -----------------------MNLQHHFLIAMPSLQ-DPQFKRSVIYICEHGEKGAMG
Y251_BLOFL       -----------------MFKNEITNLQNHFLVAMPTLQ-DPLFKKSVVYICEHNDTGAMG
Y165_WIGBR       -----------------------MNLKHHFLIAMPSIK-NPLFRRSVVYIYQHSTEGAMG
Y491_BUCBP       ---------------------MIINFKNHFLIAMPGLK-DPLFKNSVIYMCKHDNNGAMG
Y1529_VIBVU      -----------------------MNLTNHFLVAMPGMK-DPYFQHSVIYICEHNEEGAMG
Y2869_VIBVY      -----------------------MNLTNHFLVAMPGMK-DPYFQHSVIYICEHNEEGAMG
Y2612_VIBPA      -----------------------MNLTNHFLVAMPGMK-DPYFQNSVIYVCEHNEEGAMG
Y467_VIBCH       -----------------------MNLTNHFLVAMPSMK-DPYFKRSVIYICEHNQDGAMG
Y304_HAEIN       ----------------------MMELQGKFLIAMPHL--DDYFNRTVVFMCEHNEQGSMG
Y1869_PASMU      ----------------------MMELQDHFLIAMPQME-DDYFAHSVVYICEHNDQGTMG
Y1794_HAEDU      ---------------------MFGNLQGKFIIATPEMD-DEYFDRTVIYICEHNDNGTIG
Y3346_SHEON      ----------------------MESLQNHFLIAMPSLD-DTFFERTVIYLCEHDEKGAMG
Y043_RICCN       -----------------MGDKIFHNLSGKTLVATPHVITKGIYHKSLIYMLSHTEEGAIG
Y032_RICPR       -----------------MCDKIFHNLSGKTLVATPYVITKGIYHKSLIYMLSHTEEGAIG
Y630_CHLCV       ----------------MAKIPYAILEKGSLLLASPDTD-QGVFARSVILLCEHSLNGSFG
Y139_CHLPN       -----------------MKIPYARLEKGSLLVASPDIN-QGVFARSVILLCEHSLNGSFG
Y483_CHLMU       ----------------MTKLPYALLEKGSLLIASPDVN-GGVFSRSVILVCEHSPNGSFG
Y211_CHLTR       ----------------MTKLPYALLDKGSLLVASPDIN-GGIFSRSVVLVCEHSPNGSFG
Y2927_COREF      -------MSDFYADRLFNALERNEVAPGSLLVAAPDLA-SPEFSRSVILVIEHSHATTFG
Y3084_CORGL      -------------------MERNEVAPGMLLVAAPDMA-SEDFERSIVLIIEHSPATTFG
Y028_MYCLE       ------MVIRPEDPEDYVAPAAQRVRAGTLLLANTDLL-EPTFRRSVIYIVEHNEGGTLG
Y038_MYCTU       ------MVAPHEDPEDHVAPAAQRVRAGTLLLANTDLL-EPTFRRSVIYIVEHNDGGTLG
Y5129_STRAW      ----------------MSGMTEVSSLTGRLLVATPALA-DPNFDRAVVLLLDHDEEGSLG
Y2948_STRCO      ----------------MSGMTEVSSLTGRLLVATPALA-DPNFERAVVLLLDHDEEGSLG
                                               ::* .           :  :  *    ::*

Y781_AGRFC       FIINRPQ-QITFTDILLHLKLVDSNDAIMLPNRTREFPIQCGGPVESGRGFVLHSDDYLS
Y917_RHIME       FILNRPQ-RLTFPDVLLHLQLLDPDEAIRLPSATREFQIQAGGPVETGRGFVLHSDDYLS
Y1454_BRUME      FIINQLQ-PVQFPDLLRQIGVIGEEDLIILPDRAQHMVVRNGGPVDRTRGFVLHSDDYMV
Y480_BRUSU       FIINQLQ-PVQFPDLLRQIGVIGEEDLIILPDRAQHMVVRNGGPVDRTRGFVLHSDDYMV
Y7511_RHILO      LIINQTQ-QMLFPDLLVQLGIMNEQEAIRLPAQARDFVVRNGGPVDRSRGFVLHSGDYRV
Y1492_BRADU      IIVNHPAGSIDFPELLEQLGIIRKGEHIKLPENAESMKVLRGGPVDTGRGFVLHSSDFYI
Y3395_CAUVC      LAVNRPVEGLTVFELLNRLGVRS--E-----IQAPSDLVLLGGPLERERGFVLHTDDFSS
Y2918_XANAC      VLVNRPSE-YTLGEVLSQMGIDTVDE------HLREQIVLSGGPVHPERGFVIHDDARD-
Y2748_XANCP      VLVNRPSE-YTLGEVLSQMGIDTSDE------RLREQPVLSGGPVHPERGFVIHDDARA-
Y2228_XYLFA      VVLNRPSE-YTLGEVLFQMGIETASE------TLREQVVLAGGPVHPDRGFVIYDSEHV-
Y1276_XYLFT      VVLNRPSE-YTLGEVLFQMGIETASE------TLREQVVLAGGPVHPDRGFVIYDSEHV-
Y2093_COXBU      IIINRPLA-LTLGKVLEHLNIEIAQP------QIANHPVLMGGPIGQEHGFIVYEQESP-
Y4405_BORBR      LVINRPTD-LTLATLFERIDLKL-EI-----GPVKDEMVFFGGPVQTDRGFVLHAPAGD-
Y3932_BORPA      LVINRPTD-LTLATLFERIDLKL-EI-----GPVKDEMVFFGGPVQTDRGFVLHAPAGD-
Y319_BORPE       LVINRPTD-LTLATLFERIDLKL-EI-----GPVKDEMVFFGGPVQTDRGFVLHAPAGD-
Y675_RALSO       LVINRPID-IDLATLFDKIDLKL-EI-----HPLAEQPVYYGGPVQTERGFVLHDAMGS-
Y1668_NITEU      LVVNRPTD-LSVENLLLQLGMFP-KG-----TASSNLPVLLGGPVQIDSGFVLHEPVGS-
Y1550_NEIMA      IAINKPSP-ITMDMIFSATGKNI-P------FRMQHDSVMMGGPVQVERGYVVHTPIGN-
Y1336_NEIMB      IAINKPSP-ITMDMIFSATGKNI-P------MRMQHDSVMMGGPVQVERGYVVHTPIGN-
Y3909_CHRVO      LIINKPSG-IAMAQLFDQIDLPL-DD-----EDTRTGLVYFGGPVQPDRGFVLHQPAGN-
Y4995_PSEPK      LVVNRPQE-LSLADILEQLRPDE-TPP----ASTLQVPIYQGGPVQTDRGFVLHSSECS-
Y5037_PSESM      LVINRPQS-LTLADVLEQLRPEL-PAP----KRCQEIAIHAGGPVQTDRGFVLHPSGQT-
ALGH_PSEAE       LVINRPSG-LNLAEVLEQLKPDA-LPP----ARCQHIDIYNGGPVQTDRGFVLHPSGLS-
YQGE_ECOLI       IIVNKPLENLKIEGILEKLKITP-EPRD--ESIRLDKPVMLGGPLAEDRGFILHTPPSN-
YQGE_ECO57       IIVNKPLENLKIEGILEKLKITP-EPRD--ESIRLDKPVMLGGPLAEDRGFILHTPPSN-
YQGE_SALTI       IIINKPLENLQIEGILEKLKITP-EPRD--SAIRLDKAVMLGGPLAEDRGFILHTPPSR-
YQGE_SALTY       IIVNKPLENLQIEGILEKLKITP-EPRD--SAIRLDKAVMLGGPLAEDRGFILHTPPSR-
Y1183_PHOLL      LVINKPIEQISVRKVLQKLKISP-EDRD--ESVNLNKPVMTGGPLAEDHGFILHTPKPG-
Y936_YERPE       LVINKPLEQLTVETILEKLKIKS-PSRD--PAIRLDNVVLAGGPLAEDRGFILHSPQEG-
Y251_BLOFL       IVINKPVEKYTVETILKNLKITS-TQRD--PSVQLNHPVFSGGPLLNDRGFILHTPQTG-
Y165_WIGBR       ILINKPIHKYTIKNILNKLKINI-EKNI--DMDKLNHPVLFGGPLSDDRSFILHSPCYS-
Y491_BUCBP       IIINKKIKNLTIQKILHQLKINI-KSSN---TLDFKNPVIIGGPILEDRGFILHTFKKK-
Y1529_VIBVU      LMINAPID-ITVGKMLEQVDVQPVHPQL--NTSSLTKPVYNGGPVAEDRGFILHRPKDF-
Y2869_VIBVY      LMINAPID-ITVGKMLEQVDVQPVHPQL--NTSSLTKPVYNGGPVAEDRGFILHRPKDF-
Y2612_VIBPA      LMINAPVD-ITVGNMLKQVDVQPVHPRL--FEASLDRPVYNGGPISEDRGFILHKPKDY-
Y467_VIBCH       LMINAPID-ITVGGMLKQVDIEPAYPQS--HQENLKKPVFNGGPVSEDRGFILHRPRDH-
Y304_HAEIN       LVINQPTD-LSIAELYSKLNFMMKNDR----TFGNE-MVVAGGPMHTERGFILHKNTLNA
Y1869_PASMU      LVLNQPTD-LSIAELCAKMNFMMKTDR----TYGND-LVLAGGPVNIERGFILHTKTAQT
Y1794_HAEDU      VIINTPTD-LSVLELLTRMDFQMAKPR----IYTQDQMVLNGGPVNQDRGFIVHSKTDHE
Y3346_SHEON      LVINKPLG-IEVNSLLEQMDLPT-EQVS--ADLAMGSQVLMGGPVSQDRGFVLHTSQPY-
Y043_RICCN       LIFNRLVNHIDLKSFFKIKNDEI--------TTPVMVPIYLGGPVEHEKGFFLHSSDYN-
Y032_RICPR       LIFNRLVNHVDLKSFFKIKEDKI--------TSQVMVPIYLGGPIEHEKGFFLHSRDYN-
Y630_CHLCV       LILNKTLG-LEISDDIFTFDKVS----------NNNIRFCMGGPLQANQMMLLHSCS-EI
Y139_CHLPN       LILNKTLG-FEISDDIFTFEKVS----------NHNIRFCMGGPLQANQMMLLHSCS-EI
Y483_CHLMU       LILNKTLE-MDSPEEVFPLDHFD----------ESRVRFCMGGPLQANQIMLLHSSSSED
Y211_CHLTR       LILNKILE-IDSPEEIFPLDHFD----------ESKVRFCMGGPLQANQIMLLHTSP-DS
Y2927_COREF      VNLASRSD-LAVANVLPEWTELT----------AKPQALYIGGPLSQQAVVGLGVTKPGV
Y3084_CORGL      VNISSRSD-VAVANVLPEWVDLT----------SKPQALYIGGPLSQQAVVGLGVTKPGV
Y028_MYCLE       VVLNRPSE-TAVYNVLPQWAKLA----------AKPKTMFIGGPVKRDAALCLAVLRIGA
Y038_MYCTU       VVLNRPSE-TAVYNVLPQWAKLA----------AKPKTMFIGGPVKRDAALCLAVLRVGA
Y5129_STRAW      VVLNRPTP-VDVSDILEGWADLA----------GEPGVVFQGGPVSLDSALGVAVIPGGA
Y2948_STRCO      VVLNRPTP-VDVGDILEDWADLA----------GEPGVVFQGGPVSLDSALGVAVVPGGA
                 . .                                   .  ***:       :       

Y781_AGRFC       ----E-SSIPVSDDISLTATLDIVRAISNG-RGPQKATMMLGYAGWGPGQLENEIANNGW
Y917_RHIME       ----D-SSIPVSDDICLTATLDIVRAISRG-EGPLKATMLLGYAGWGPGQLEAEITQNGW
Y1454_BRUME      ----D-STMPVSDDVCLTATVDILRAIYGG-GGPERALMALGYSGWAPGQLEMEVAENGW
Y480_BRUSU       ----D-STMPVSDDVCLTATVDILRAIYGG-GGPERALMALGYSGWAPGQLEMEVAENGW
Y7511_RHILO      ----E-SSLTVSDDICLTATVDILRAISSG-RGPRHALMALGYSGWGAGQLETEIAENGW
Y1492_BRADU      ----ENATLRIDDGVCLTATVDILRAIANG-SGPKHAILALGYAGWAPGQLETEIQSNGW
Y3395_CAUVC      ----PDSTLPVADGVALTATRDALDAMASAIKRPRKSLLALGYAGWGPGQLEQELRDNVW
Y2918_XANAC      ----WDSSLEVGQGVYLTTSRDILEAMAAG-EGPRNALVALGCAGWGAGQLEFELGENSW
Y2748_XANCP      ----WDSSLEVGQGVYLTTSRDILEAMAAG-DGPRNALVALGCAGWGAGQLEFELGENSW
Y2228_XYLFA      ----WGPSLLIGDGLYLTTSRDVLTAMAEG-SGPSRALVALGCAGWAAGQLELELVENNW
Y1276_XYLFT      ----WGPSLLIGDGLYLTTSRDVLAAMAEG-SGPSRALVALGCAGWAAGQLELELVENNW
Y2093_COXBU      ------Q----GAEILLSASKDMLDDIAKN-KGPDDFLITLGYAGWEAGQLENEIARNDW
Y4405_BORBR      ----YTSSINL-GELALTTSRDVLQAVADG-NGPARMLVTLGYAGWGAGQLESEMAQNSW
Y3932_BORPA      ----YTSSINL-GELALTTSRDVLQAVADG-NGPARMLVTLGYAGWGAGQLESEMAQNSW
Y319_BORPE       ----YTSSINL-GELALTTSRDVLQAVADG-NGPARMLVTLGYAGWGAGQLESEMAQNSW
Y675_RALSO       ----YSSSLTVPGGLEMTTSKDVLEAVARG-GGPQRFILTLGYAGWSAGQLEEEIGRNGW
Y1668_NITEU      ----WKFTLSSNESIGLTSSADILQAVADC-EGPKRMLIALGYSGWAAGQLEQELAQNAW
Y1550_NEIMA      ----WQSSIGVSDNIALTSSRDVIENISRE-GAVDKILISIGYSSWGKGQLERELADNAW
Y1336_NEIMB      ----WQSSIGVSDNIALTSSRDVIENISRE-GAVDKALISIGYSSWSKGQLERELADNAW
Y3909_CHRVO      ----WQSSLMVTDDIALTTSKDVLVAVSEG-KKPEQLLISLGYAGWSAGQLEKEIADNGW
Y4995_PSEPK      ----FQASVALEG-LSLTTSQDILLAIAAG-VGPKQSLITLGYAGWEAGQLEAELADNAW
Y5037_PSESM      ----FQATVDLPGGISLSTSQDVLFSIADG-YGPDQNVITLGYAGWDAGQLDAEMADNAW
ALGH_PSEAE       ----YQSTLELGE-LAMSTSQDVLFAIAAG-TGPEKSLISLGYAGWEAGQLEAELSDNAW
YQGE_ECOLI       ----FASSIRISDNTVMTTSRDVLETLGTD-KQPSDVLVALGYASWEKGQLEQEILDNAW
YQGE_ECO57       ----FASSIRISDNTVMTTSRDVLETLGTD-KQPSDVLVALGYASWEKGQLEQEILDNAW
YQGE_SALTI       ----FASSIRISDNTVITTSRDVLETLGTQ-QQPSDVLVALGYASWDKGQLEQELLDNAW
YQGE_SALTY       ----FASSIRISDNTVITTSRDVLETLGTQ-QQPSDVLVALGYASWDKGQLEQELLDNAW
Y1183_PHOLL      ----FSSSIKISDDTMITTSKDVLETLGTP-RQPKQILVTLGYTSWEKGQLEKEIMENSW
Y936_YERPE       ----FASSIHISPETMITTSKDVLETLGTS-GQPKNLLVALGYASWRQGQLEQELLDNVW
Y251_BLOFL       ----FGSSINISSQTMITTSKDILETLGTP-NQPKNILVALGYSGWTKGQLEQELIESTW
Y165_WIGBR       ----FKSSVNISREITITTSNDIFNTIGTS-SQPEKILVALGCSEWGKGQLEQEVIHNAW
Y491_BUCBP       ----FTTSTHISNDLSITTSRDILEYIANL-NNPKNILMALGHCIWKQHQLEQEIAKNIW
Y1529_VIBVU      ----YESSLQMTEQISVTTSKDILTVLGTE-AEPSSYIVALGYSGWSAGQLEAELAENSW
Y2869_VIBVY      ----YESSLQMTEQISVTTSKDILTVLGTE-AEPSSYIVALGYSGWSAGQLEAELAENSW
Y2612_VIBPA      ----YESSIQMTDDLAVTTSRDILSVLGTE-AEPSDYLVALGYSGWSAGQLENELVENSW
Y467_VIBCH       ----YESSMKMTDDIAVTTSKDILTVLGTE-AEPEGYIVALGYSGWSAGQLEVELTENSW
Y304_HAEIN       ----FQHTYKVTKELSMTTSADVVETLGST-FAPEKYLVALGCSSWGAGQLEKEIRDNAW
Y1869_PASMU      ----FKHSYKVTDQLSLTTSADIIDTFGTA-QAPEKYLVALGCASWTVNQLESEIANNDW
Y1794_HAEDU      ----FTHSYKVTDDITLTTSGDVLDSFGTQ-TAPEKFIVCLGCSTWKPHQLEQEIAQNYW
Y3346_SHEON      ----WANSTELGSGLMLTTSRDVLTAIGSK-RSPDKFLVALGYAGWSKNQLEQELADNSW
Y043_RICCN       ----KNLLLDFHNDLAVSSNLEISEDIAFG-KGPKNSLFIVGYTAWKPGQLEEELETNLW
Y032_RICPR       ----KNLLLDFHNDLAVSSNLEISEDIAFG-KGPKNSLFIVGYTAWKPGQLEEELEKNLW
Y630_CHLCV       ----SEQTLEICPSVYLGGDLSFLQEIAAS-ESGPTINLCFGYSGWQAGQLEKEFLEGNW
Y139_CHLPN       ----PEQTLEICPSVYLGGDLPFLQEIASS-ESGPEINLCFGYSGWQAGQLEKEFLSNDW
Y483_CHLMU       ----ANSSIEICPSVFLGGDFSFIQEGEIK-SNDEKMLFCFGYSGWQAGQLEKEFLEGLW
Y211_CHLTR       ----ANSSIEICPSVFLGGDFSFAGEKEGR-TRDDKMLLCFGYSGWQGGQLEKEFLERLW
Y2927_COREF      DIE-SSTKFNKLANRLVHVDLRVTPD-EVR-DDLEGMRFFAGYAEWAPGQLNDEIEQGDW
Y3084_CORGL      DIE-NSTSFNKLANRLVHVDLRSAPE-DVA-DDLEGMRFFAGYAEWAPGQLNEEIEQGDW
Y028_MYCLE       DPD-GVAGLRHVAGRLVMVDLDAEPD-LIA-PLVDGLRIFVGYSGWTIGQLKGEIERDDW
Y038_MYCTU       DPE-GVPGLRHVAGRLVMVDLDADPE-VLA-AAVEGVRIYAGYSGWTIGQLEGEIERDDW
Y5129_STRAW      SVDGAPLGWRRVHGAIGLVDLEAPPE-LLA-KALGSLRIFAGYAGWGPGQLEDELVEGAW
Y2948_STRCO      SGERAPLGWRRVHGAIGLVDLEAPPE-LLA-PAVGALRIFAGYAGWGPGQLEDELTEGAW
                                                       .  *   *   **. *.    *

Y781_AGRFC       LNCPAAEELIFDRGLDNKYERALALMGV-DARMLSTDAGHA---
Y917_RHIME       LTCPAQEELIFSRDLDEKYDRALALMGV-SPAMLSTDSGHA---
Y1454_BRUME      LTCDAPLDMLFDSDIEGKYSRLMLHMGI-DMSRLVSDAGHA---
Y480_BRUSU       LTCDAPLDMLFDSDIEGKYSRLMLHMGI-DMSRLVSDAGHA---
Y7511_RHILO      LTCPASPELLFDADIERKYDRILASIGI-DLAHLSLAAGHA---
Y1492_BRADU      LHCDADADLIFGDDVDEKYGRALRKIGI-DPGMLSNEAGHA---
Y3395_CAUVC      LICDADEGLLFDEDHEHKWTRALAKLGI-TADHLSATAGRA---
Y2918_XANAC      LTAPSDANVLFATALEDRWQTAAGRIGV-DLFRLTDYSGHA---
Y2748_XANCP      LTAPSDANVLFDTALEDRWQTAAGRIGV-DLFRLTDYSGHA---
Y2228_XYLFA      LMVPADASLLFDTALEQRWQRAAGRIGV-DLFRLTDYTGHA---
Y1276_XYLFT      LMVPADASLLFDTALEQRWQRAAGRIGV-DLFRLTDYTGHA---
Y2093_COXBU      LVVPFNRKILFETPLKSRWQKAAALIGV-DINQLSGQIGHA---
Y4405_BORBR      LSVGADSHIIFDVAPEDRYPAALKLLGV-DPVMLAGGAGHA---
Y3932_BORPA      LSVGADSHIIFDVAPEDRYPAALKLLGV-DPVMLAGGAGHA---
Y319_BORPE       LSVGADSHIIFDVAPEDRYPAALKLLGV-DPVMLAGGAGHA---
Y675_RALSO       LTVQADPEIIFNVPAEERFAAALRLLGI-NPAMLSGEAGHA---
Y1668_NITEU      LTVPAESQILFELSSEERLPAAMKLLGI-DFCNLSSEVGHA---
Y1550_NEIMA      LTVPADEHILFDIPYEHRYAAAFAKLGI-DPLALFSGAGHA---
Y1336_NEIMB      LTVPADEHILFDIPYEHRYAAAFAKLGI-DPLALFSGAGHA---
Y3909_CHRVO      LTVPAEPSIVFDLPYEERYDAAMALLGF-DPSLLSSDVGHA---
Y4995_PSEPK      LNCPFDPEIVFGMASDLRLEAAAASLGI-NLHLLTSQAGHA---
Y5037_PSESM      LTCSFDPAILFDVDSDQRLDAAARRLGI-NLALISTQAGHA---
ALGH_PSEAE       LTCPADPAILFDLPPEERLSAAAARLGV-NLSLLTAQAGHA---
YQGE_ECOLI       LTAPADLNILFKTPIADRWREAAKLIGV-DILTMPGVAGHA---
YQGE_ECO57       LTAPADLNILFKTPIADRWREAAKLIGV-DILTMPGVAGHA---
YQGE_SALTI       LTAPADLNILFKTPIAERWREAAKLIGI-DILTMPGVAGHA---
YQGE_SALTY       LTAPADLNILFKTPIAERWREAAKLIGI-DILTMPGVAGHA---
Y1183_PHOLL      LTTNADPHIIFNSPIADRWREAASLLGI-NIYNIAPQAGHA---
Y936_YERPE       LTTEADTHILFNTPIAERWQAAANKLGI-NIFNIAPQAGHA---
Y251_BLOFL       IAVPADETILFHTPIFNRWNAAAKIIGV-NMYNMNSQTGHA---
Y165_WIGBR       ITTLANLKILFNTPIYDRWYESAKIIGI-DIRNISSEIGHS---
Y491_BUCBP       LTTPADIDIIFNTPISEKWKKSMYSIGIMNILQLTSEIGHA---
Y1529_VIBVU      LTVEANPDIIFDTPIAMRWQKAVQMLGI-HASQLSDQAGHA---
Y2869_VIBVY      LTVEANPDIIFDTPIAMRWQKAVQMLGI-HASQLSDQAGHA---
Y2612_VIBPA      LTIEATPEIIFDTPITERWKKAVEKLGI-DPSQLSADAGHA---
Y467_VIBCH       LTIEADPELIFNTPVHEKWQKAIQKLGI-SPAQLSSDAGHA---
Y304_HAEIN       LVVSSNDQILFDMPYEDRYAAANQLLGIHPYNFALAQVGHS---
Y1869_PASMU      LVVPANNRILFDVPYEDRWLEANLLLGIQHHNFA-HQAGHC---
Y1794_HAEDU      LLSEANNQTLFETSYLDRWVEANEMLGISGILAP---AGRA---
Y3346_SHEON      LTIPADHALLFDINHEDRWQQASRSLGF-EAWQLSTQAGHA---
Y043_RICCN       LVMDCNKEFIFADNPESKWHNALKHLGI-DEIHFSSQIGNA---
Y032_RICPR       LVMDCSKEFIFAENPENKWHNALKHLGI-DEIYFSSQIGNA---
Y630_CHLCV       FLAPASYEYVFSDNPDNLWSRILKDLGG-KYASLSTVPENLLLN
Y139_CHLPN       FLAPGNKDYVFYSEPEDLWALVLKDLGG-KYASLSTVPDNLLLN
Y483_CHLMU       FLAPASQEIVFTARPDKLWSDVLQNLGG-RFASMSTVPENLLLN
Y211_CHLTR       FLAPSSQEIIFTDAPERMWSDVLQHLGG-RFASLSTIPENLLLN
Y2927_COREF      YVAPALPSDVLAPGRVDVWGDVMRRQPM-PLPLYSTHPSDPSDN
Y3084_CORGL      FVTPALPSDIIAPGRVDIWGDVMRRQAM-PLPLYSTFPSDPSDN
Y028_MYCLE       IVLSALPSDVLVGKRADLWAQVLRRQPL-LLSLLATHPIDVSRN
Y038_MYCTU       IVLSALPSDVLVGPRADLWGQVLRRQPL-PLSLLATHPIDLSRN
Y5129_STRAW      YVVESEPGDVSSPSPERLWREVLRRQRN-ELAMVATYPDDPSLN
Y2948_STRCO      YVVESEPGDVSSPFPERLWREVLRRQRG-DLAMVATYPDDPSLN
                          :