CLUSTAL format seed alignment for MF_00760

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y1542_BACAN      MNTPVSVNEKKDFVKWFLNNYQLKQRECVWILNYLMSHDQLMHKVHFVEHAKYCPRGLVM
Y1520_BACCR      MNTPVSVNEKKDFVKWFLNNYQLKQRECVWILNYLMSHDQLMHKVHFVEHAKYCPRGLVM
YPIB_BACSU       MQTPVSVNEKKDFIRWFLNHYQLKRRECVWILNYLMSHDSLMEKVHFVEQAEFCPRGIIM
Y1670_ALKHC      MDGIIPVVEKKDFLRWFLKEFTLKKRECSWLLNYLMSDDDLMENVHFVEEAERCPKALIM
Y1778_OCEIH      MLSPVTAKDKKSFIQWFLNHYRLKKRESVWILNYLVNHSDLLANVHFVRDVKYCPRGIMM
Y2035_LISIN      MKASISIDEKKDFIRWFLNKHQMKTREAMWVLNYIAGHDQIVKYVHFVDNLEGCARGLSL
Y1921_LISMO      MKASISIDEKKDFIRWFLNKHQMKTREAMWVLNYIAGHDQIVKYVHFVDNLEGCARGLSL
Y1554_ENTFA      --MFVSLSEKKKFLTWLVNTAPFGRREVLWILNYLLTHDAILNNVHFVENVEKTDRGIRV
Y1462_STAAM      -MSETLNQIKESFIEYLLFQYRFKSRIAVWVLNYIKVNEAKLANIHFVDTKINHHETLEI
Y1151_STAES      -MNDSLIRIKQNFIEYILFNYRFKSRITVWVLNYLKANQDKLNNVHFVNSKINNHYTLEI
Y3876_ALKHC      MGKWVSVAEKRQFLKWFLTQ-QLKRKDAKRILEYLLQHYHLLEQVMFTEEIRGRERTLVI
                          *..*: :::    :  :    :*:*:  .   :  : *.         : :

Y1542_BACAN      SANCVKDTPFHFFKQNVMTTDAEKSFHDIRLNRDEDIYIQLNFKSSFQNANYVAVLE-EN
Y1520_BACCR      SANCVKDTPFHFFKQNVMTTDAEKSFHDIRLNRDEDIYIQLNFKSSFQNANYVAVLE-EN
YPIB_BACSU       STHCVEEVPFRFYKENVMTTDAEKSFHDIRLNKQQDLFIQLNFRSAYSSPEYAAVLE-SN
Y1670_ALKHC      STNDVHTVPFCFHKYQQVTMDAEKAFHDIRMNPEEAIYIQLHFSGAKHNPNYIAVLE-DN
Y1778_OCEIH      TSHCSDEVPFRFYKNHLVTTDAEKSFHDIRLNQNESLYVQLNFRKSNQHSYYASVLE-EN
Y2035_LISIN      SAHGVESEPFLFFKGSIMTTDPEKAFHDIRLNWDEELYVELHFEEAMTSPEYALVRE-DN
Y1921_LISMO      SAHGVESEPFLFFKGNIMTTDPEKAFHDIRLNWDEELYVELHFEEAMSSPEYALVRE-DN
Y1554_ENTFA      VADGLGKEPLLLFIQAQEFTDPEQIFHEIRMNWRKALYLECVFPEAWQTSQYLSVLE-DN
Y1462_STAAM      AEVGSHASAIQFTKRNIKLMNTNEIFDYIA-NHNCAFDIQIHFANVSKREQRLDDLI-VA
Y1151_STAES      AEVDATASAIQLSKDNKSYINTNQIFNYIA-NHTLRLDIQIHFANCHIRESRLDDLI-LM
Y3876_ALKHC      STLQSDEPGFAFYLYRRKIEDPIRALGELQANPADPIYLILHFHGKAQNHQYLQMLDSES
                          : :        :. . :  :  *    : :   *                 

Y1542_BACAN      PYLPKHIEVNEKDRLLAERFLEESVFSFRRERLLKQIDEALDKQDKEAFHRLTAELKML-
Y1520_BACCR      PYLPKHIEVNEKDRLLAERFLEESVFSFRRERLLKQIDEALDKQDKEAFHRLTAELKTL-
YPIB_BACSU       PHIPKNLFENKKDQGLAEQILEHAISTFQREKLLKDIDDALDRHDKEAFEQLSRQLNQLT
Y1670_ALKHC      PYVPENEDLIAKQKKLAEAFLERSVQSFEEKELLRRIDEALDARDKETFLTLSQQLQHLR
Y1778_OCEIH      PFIPEDYYLTTDDKETANGLLDYLLFEQKRNKIIFDIDKALDNGDKELFQKLSEKLEKLS
Y2035_LISIN      PFAA--VKLAEEEKEMADALIYQSVHQFSREKLLQQIDEALDTRDEATFHKLVRILQQMD
Y1921_LISMO      PFAA--VKLADEEKEMADALIYQSVHQFSREKVLQQIDEALDTRDEAAFHKLVRILQQMD
Y1554_ENTFA      PFAPWNEQVDQEVARAIDQYFKQEEQTQRMALLKAQIDDALETGNKEAFLELSDELNRLK
Y1462_STAAM      QLTE-SPSYQTYLHDLNSMAIDRHKHALLIDYLLHNIDLSLQMNEKQRFYQLTQILNTLK
Y1151_STAES      QLIH-SPSYSSYVQDLYSISMDKRKQTFIIQTLQNNIDLSLQMNEPDYFYQLTQILNVLK
Y3876_ALKHC      REYIKRFKQFQAYKEETDSLIEAVLIENEKKMLLQQIDEALDLKDERRFKDLVKKLQELD
                                  .  :           :   ** :*:  :   *  *   *: : 

Y1542_BACAN      ---------------
Y1520_BACCR      ---------------
YPIB_BACSU       ---------------
Y1670_ALKHC      QHSD-----------
Y1778_OCEIH      SNRQK----------
Y2035_LISIN      TEKE-----------
Y1921_LISMO      TEKE-----------
Y1554_ENTFA      QQ-------------
Y1462_STAAM      LVNKHNQFEDLADDD
Y1151_STAES      SKDIQSTLHER----
Y3876_ALKHC      RRSS-----------