CLUSTAL format seed alignment for MF_00765

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

YJGA_ECOLI       --------MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAEIVDLGKN
YJGA_ECOL6       --------MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAEIVDLGKN
YJGA_SHIFL       --------MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAEIVDLGKN
YJGA_SALTI       --------MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAELVDLGKN
YJGA_SALTY       --------MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAELVDLGKN
Y3691_YERPE      --------MNKQPEDWLDDVP-ENKNDDDDEIIWVSKSEIKRDAEALKDLGTELVDLGKN
Y4061_PHOLL      --------MAKQPEDWLNDYP---AEEEEEEIIWVSKSEIKRDAEALKKLGTELVELSKS
Y1151_HAEIN      --------MAKRKKK----EVFDWEDEDQEEIIWVSKSEIKRDAEDLKQLGEKIVNLTKA
Y119_PASMU       --------MAKRGKNKIEWDNTDWEQEE-EEIIWVSKSEIKRDAEALKKLGEKLVDLTKA
Y1362_HAEDU      --------MAKKRGK----PEIDWTDDD-KEIIWVSKSEIKRDSEHLKKLGAELIELTPQ
Y700_VIBVU       --------MARKNQK-----A-PWEPEE--EYILVSKSEMKRDMDALQKLGEELVELKPS
Y440_VIBVY       --------MARKNQK-----A-PWEPEE--EYILVSKSEMKRDMDALQKLGEELVELKPS
Y2677_VIBPA      --------MARKNQK-----A-PWEPEE--EIIWVSKSEMKRDMEELQKLGEELVGLKPA
Y2536_VIBCH      --------MARKNQK-----A-PWEEEE--EIIWVSRTELKNDMLALQKLGEELVELKPS
Y4079_SHEON      --------MKIVGDS----EHFKQPYDSNDE--YVSKTEDKRDCEAAQKVGMELVSLSKT
Y4360_BORBR      --------MSSHSQE-----PVGEENFDDSEYDRPSKSQVKREMHALLDLGKELVELSPE
Y3887_BORPA      --------MSSHSQE-----PVGEENFDDSEYDRPSKSQVKREMHALLDLGKELVELSPE
Y2965_BORPE      --------MSSHSQE-----PVGEENFDDSEYDRPNKSQVKREMHALLDLGKELVELSPE
Y1049_NEIMA      -----------------------MFEQEDE---WISKTQMKKQMNGLQDLGMELTKLSND
Y840_NEIMB       -----------------------MFEQEDE---WISKTQMKKQMNDLQDLGMALTKLSND
Y3198_CHRVO      ---------------------MTDYQNDDDG--FVSKSQRKRDMDALQDLGRELVDLSKD
Y944_RALSO       MSRASRHNPSYLQPV-----VRTDIGDEDDPGTPKSKSQRKREVTALQDLGTALEALPKD
Y2194_NITEU      ---------MTVSDH-----PQTVSQPDPESESRPSKTRLKQEMHALQALGERLVELEPA
Y941_PSEPK       ---------------------MVDSNDD-AFDGEKSKTQIKRELHALVELGERLTTLKAD
Y4464_PSESM      ---------------------MVDSYDD-SLDGEKSKTQVKRELHALVDLGERLTTLKAD
Y4473_PSEAE      ---------------------MAEFHDDDSQFEEKSKSQIKRELHALQDLGERLTTLQPQ
Y2766_XANAC      ---------------------MRGRDEETGEFRGASRSQQRREALEIFDLGEKLVALTPA
Y2605_XANCP      ---------------------MRGRDEDTGEFRGASRSQQRREALEIFDLGEKLVALTPA
Y1130_XYLFA      ---------------------MRGCNKETGEFLGPSRSQQRRTALEVLVLSEKLAALTPA
Y419_XYLFT       ---------------------MRGCNKETGEFLGPSRSQQRRTALEVLVLSEKLAALTPA
                                            .       .::. :.       :.  :  *   

YJGA_ECOLI       ALDKIPLDADLRAAIELAQRIK--MEGRRRQLQLIGKMLR---QRDVEPIRQALDKLKNR
YJGA_ECOL6       ALDKIPLDADLRAAIELAQRIK--MEGRRRQLQLIGKMLR---QRDVEPIRQALDKLKNR
YJGA_SHIFL       ALYKIPLDADLRPAIELAQRIK--MEGRRRQLQLIGKMLR---QRDVEPIRQALDKLKNR
YJGA_SALTI       ALDKIPLDADLRDAIELAQRIK--MEGRRRQLQLIGKMLR---QRDVEPIRQALDKLKNR
YJGA_SALTY       ALDKIPLDADLRDAIELAQRIK--MEGRRRQLQLIGKMLR---QRDVEPIRQALDKLKNR
Y3691_YERPE      ALERIPLDEDLLAAIELAQKIK--KEGRRRQLQLIGKMLR---ARDVEPIQTALDKLKNR
Y4061_PHOLL      ALERVPLDEDLLAAIELAQKIK--REGRRRQLQFIGKLLR---TRDVEPITIALDKLKNR
Y1151_HAEIN      NLAKIPLDESLLDAIELAQRLQ--KEARRRQLQYIGKLFR---GIDVEPIREALDKIENK
Y119_PASMU       KLEKIPLEEKLLEAIELAQRLQ--KEARRRQLQYIGKLLR---NIDVEPIQDALEKLENK
Y1362_HAEDU      NLEKIPLDEDLKYAIRQAQSFK--LEARRRQIQFIGKLLR---NRDSAPIQDALDKVKNR
Y700_VIBVU       VLAKFPISEELLDAIKDAQRFK--NEARRRQLQYIGKVMR---QEDPEPIQAALDKIRNK
Y440_VIBVY       VLAKFPISEELLDAIKDAQRFK--NEARRRQLQYIGKVMR---QEDPEPIQAALDKIRNK
Y2677_VIBPA      VLEKFPLSEDLREAIADAQRFK--NEARRRQLQRIGKLMR---YEDPEPIQAALDKVRNK
Y2536_VIBCH      ALAKFPLPEDLAEAIKDAQRFK--NEARRRQLQYIGKLMR---HIDPEPLQAALDKLRNK
Y4079_SHEON      QLDKIELDEHLYDSIQQAHKIKPKTEAYRRHMQYIGKLMR---NVDIEPIKASLAVVLNK
Y4360_BORBR      RLRQLPLEERLYEAIREAQRTTG-REGRRRQIHFVGKLMR---SAPAEAIRAQLDTWRNG
Y3887_BORPA      RLRQLPLEERLYEAIREAQRTTG-REGRRRQIHFVGKLMR---SAPAEAIRAQLDTWRNG
Y2965_BORPE      RLRQLPLEERLYEAIREAQRTTG-REGRRRQIHFVGKLMR---SAPAEAIRAQLDTWRNG
Y1049_NEIMA      TLKKIGLDEDLYEAVVTYKKITS-NGALKRQAQFIGRLMR---DTDPAPIEAFLAKLRGD
Y840_NEIMB       TLKKIGLDADLYEAVTAYKKITS-NGALKRQAQFIGRLMR---DTDPAPIEAFLAKLRGD
Y3198_CHRVO      TLKKMQLPEDLLTAVLDYKRFTA-NGALRRQMQYIGKLMR---DVDPEPIREYLKVLKGE
Y944_RALSO       RLAKVPLPETLADALREARRITS-HEGKRRQMQYIGKLMRALTDDDIEAIRRVLATFVGA
Y2194_NITEU      RIAELDLPEKLAEALLEARKITS-HGARRRHLQFIGKLMR---AVDPLPVQEKLDAWQHT
Y941_PSEPK       TLARLPLTDELRKALAEASKHTA-HGARKRHMSFVGKLMRVQD---LDAIHALLEQMDSS
Y4464_PSESM      VLAKLPLTDALRKALAEAPKHTA-NIARKRHILFIGKLMRDQD---QEAILVLLDQLDAS
Y4473_PSEAE      LLERLPLTDPLRKALLEAPKHKA-HIARKRHIQYIGKLMRDQD---VDAIVALIDQVDSS
Y2766_XANAC      QLAKLPVPESLIPHIEESKRITS-HIAHKRQLAFLAKHMRREDEQTLAAIRDALDANSDT
Y2605_XANCP      QLAKLPVPESLIPHIEESKRITS-HIAHKRQLAFLAKHMRREDDETLDAIRDALDANSDT
Y1130_XYLFA      QLAKLPIPERLLPHITETKRITS-HIARKRQLAFLAKQMRREDDTTLETIREKLDASGIQ
Y419_XYLFT       QLAKLPIPERLLPHITETKRITS-HIARKRQLAFLAKQMRREDDTTLEAIREKLNASGIQ
                  : .. :   *   :           . :*:   :.: :*        .:   :      

YJGA_ECOLI       HNQQVVLFHKLENLRDRLIDQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPP--
YJGA_ECOL6       HNQQVVLFHKLENLRDRLIEQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPP--
YJGA_SHIFL       HNQQVVLFHKLENLRDRLIDQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPP--
YJGA_SALTI       HNQQVVLFHKLEHLRDRLIVEGDDAVAEVLTLWPHADRQQLRSLIRNAKKEKEGNKPP--
YJGA_SALTY       HNQQVVLFHKLEHLRDRLIVEGDDAVAEVLTLWPHADRQQLRSLIRNAKKEKEGNKPP--
Y3691_YERPE      HNQQISLFHKLETLRDRLIAEGDEAIPTVLELYPDADRQQLRSLVRNAQKEQAANKPP--
Y4061_PHOLL      HNQQITLLHKLEELRDKLIDGNDDVIDEVVALFPQTDRQQLRTLIRNAKKEKAANKPP--
Y1151_HAEIN      HNQQQAMLHKIEKVRDELVEKGDVALTDLLNDYPNGDRQQLRNLIRSAQKELEQNKPS--
Y119_PASMU       HQQQQAMLHKLEMLRDTLIDN-PEAITQFLEQHPDADRQHLRNLVRAAQKEKAQNKPP--
Y1362_HAEDU      HNQQQALLHKLELIRDQLINMGDASLNQLLSEYPQLDRQHLRNLIRMAQKEKQINKPA--
Y700_VIBVU       HSQNTAVLHKLETLRERIVEQGDSAIDDVVALYPDADRQRLRQLARMATKEKQANKPP--
Y440_VIBVY       HSQNTAVLHKLETLRERIVEQGDSAIDDVVALYPDADRQRLRQLARMATKEKQANKPP--
Y2677_VIBPA      HSQATAALHKLEMLRDRVVEEGDKAIDDVMELYPEADRQRLRQLARQAAKEKKAGKPA--
Y2536_VIBCH      HSQTTALLHKLEQLRDRIVAEGDSAIEVAMEQYPEADRQRLRLLARQASKEKAGNKPP--
Y4079_SHEON      NSNETAKLQMFEKMRERLLTQGDGEIQTVVEHYPQLDRQKLRTLVRQATKELAKGPES--
Y4360_BORBR      SREETAAMHRLEALRERLLKD-DDALTAVLQRNPDADIQHLRALIRAARKEAAANAALSQ
Y3887_BORPA      SREETAAMHRLEALRERLLKD-DDALTAVLQRNPDADIQHLRALIRAARKEAAANAALSQ
Y2965_BORPE      SREETAAMHRLEALRERLLTD-DDALTAVLQRNPDADIQHLRALIRAARKEAAANAALSQ
Y1049_NEIMA      DAAHNAFLQRVEQARVRLLAD-DGALTQFMSDFPHADAGKLRTLIRNTKKEQEQNKPP--
Y840_NEIMB       DAAHNAFLQRVEQARVRLLAD-DGALTQFMSDFPHADAGKLRTLIRNTKKEQEQNKPP--
Y3198_CHRVO      SSEHIAWQHLLERWREKLMAD-DKALSDFLAAFPEGDPQQLRTLMRNARKELQDNKPP--
Y944_RALSO       SKAETARLHAIERWRDRLLAD-DGAITEFIAAHPDTDVQALRTLVRNARKEAQLGKPP--
Y2194_NITEU      GMRHTAWLHQLERWRDRLISD-ETAVTEFVQTYPHTDVRQLRTLLRNIEKEKLAGKPP--
Y941_PSEPK       TRQYNERFHSLERWRDRLIDGNDEDLERFVNEYPDTDRQQLRSLVRHAQHEKARNKPP--
Y4464_PSESM      TRQYNERFHNLERWRDRLIAGDDADLEKFVIEYPDADRQQLRSLIRQAQHEVARNKPP--
Y4473_PSEAE      TRQYNERFHALERWRDQLIAGGDAALDAFVGEFPECDRQHLRGLVRHAQHEAAHNKPP--
Y2766_XANAC      ARREVAAIHRVERWRERLLAEGDVALAELLEAYPAADRQQLRQLVRNAIHERAKNKPP--
Y2605_XANCP      ARREVAAIHRVERWRERLLAEGDVALAELLEAYPAADRQQLRQLVRNAIHERAKNKPP--
Y1130_XYLFA      AQREVATLHRTEQWRKRLLEEGDSALTELLNQYPQADCGKLRQLLRNTKTEQARNKPP--
Y419_XYLFT       AQREVATLHRTEQWRKRLLEEGDSALTELLNQYPQADCGKLRQLLRNSKTEQARNKAP--
                         :  *  *  ::      :   :   *  *   ** * *    *   .     

YJGA_ECOLI       ------KSARQIFQYLRELAENEG-------------------
YJGA_ECOL6       ------KSARQIFQYLRELAENEG-------------------
YJGA_SHIFL       ------KSARQIFQYLRELAENEG-------------------
YJGA_SALTI       ------KSARQIFQYLRELAENEG-------------------
YJGA_SALTY       ------KSARQIFQYLRELAENEG-------------------
Y3691_YERPE      ------KSFRQIFSYLRELAEKKQ-------------------
Y4061_PHOLL      ------KSYRQIFQYLKDMAESA--------------------
Y1151_HAEIN      ------KAYREIYQMLKVLMLED--------------------
Y119_PASMU       ------KAYREIFQYLKDFMLED--------------------
Y1362_HAEDU      ------KNYHEILQYLKSELIV---------------------
Y700_VIBVU       ------KAYREIFQILKQ--LNDDAVSDSIENELKQ-------
Y440_VIBVY       ------KAYREIFQILKQ--LNDDAVSDSIENELKQ-------
Y2677_VIBPA      ------KSYREIFQILKA--LNEEEI-----------------
Y2536_VIBCH      ------KSSREIFQLLKEAMLAKQEIEEESEDDLDSAE-----
Y4079_SHEON      ------KSSKELFKYLRSEIQD---------------------
Y4360_BORBR      GQEPQRKQYRALFQALKNLSA----------------------
Y3887_BORPA      GQEPQRKQYRALFQALKNLSA----------------------
Y2965_BORPE      GQEPQRKQYRALFQALKNLSA----------------------
Y1049_NEIMA      ------KNFRALFQELKTVMESQG-----------GTGEA---
Y840_NEIMB       ------KNFRALFQELKTVMEN-------------GDAEI---
Y3198_CHRVO      ------KAYRQLFQEIKALIPEPGKPRLWQK----DEDEE---
Y944_RALSO       ------KSSRELFQAVKQALAGHDQAGEDAEPSNLEDDQA---
Y2194_NITEU      ------HNFRALFQLLRQIIPEIPG------------------
Y941_PSEPK       ------AAARKVFKYIRDLDELQ------RGLR----------
Y4464_PSESM      ------ATSRKIFKYIRELDELQ------RGLR----------
Y4473_PSEAE      ------AAARKVFKYIRELDETK------RGLR----------
Y2766_XANAC      ------RAYRELFQVLRDLSQEQGLESGDSELEDGESASEDDE
Y2605_XANCP      ------RAYRELFQVLRDLSQKPGLESGDAGLEDEESASENDE
Y1130_XYLFA      ------QAFRELYQVLHGLIITQ---NSDNQH-----------
Y419_XYLFT       ------QAFRELYQVLHGLIITQ---NSDNQHQTPQ-------
                          : : . ::