CLUSTAL format seed alignment for MF_00766

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

C1A9G1_GEMAT          -----------------MGRAKGWFR--------ARRWWQQIALVMLCIVLAP------I
B8GSJ2_THISH          ----------------------------------MRRFLFIIALLPVAYYLLC------V
C0QH40_DESAH          -----MELTIIRFKRRTPGEMKRINR-------IRTWIWKTIVKMILCLFCFT------I
J9R138_RIEAN          -------------------------------------MFKLIKRILFLIILIN------I
W0E853_MARPU          -------------------------------------------------MLGS------A
D4Z2E5_SPHJU          --------------MMNAKSAAPRRR---------SRWIGIFLKIVGGFVALS------L
MTGA_CAUVC            --------------------MGRFVR---------RLLRNLLLALFLVLVAGP------V
L1QRN1_BREDI          -----MRTATRAWPRSDRACAEAWLRQDDGMTRAKGRRRRPILTLLLILALFP------L
MTGA_BACTN            ---------------------MHRPL-------PIKKILRYARNLLIFFFAST------I
U3GJM0_BELBD          ------------------------MK-------IFKKVFLILAKLVMWFFIIS------I
MTGA_PSEAE            ---------------------------------MLRSLFRRLFKYLLWFMAAS------V
MTGA_XYLFT            ------------MYQWIQRDSDVHQR---------WIWCRRLLIVSLVSALMS------V
MTGA_XANAC            ----------MGTDAWDGKQAAPPRR--------ARRWLRWLMAAPLLFAAAS------V
MTGA_VIBPA            ---------------------------------MLKRLKSFLFKMVLILLIAP------I
MTGA_SHEDO            --------------------MTVRRRG------FMAWTWFITWRFLLVVVLLL------L
MTGA_SHEON            ------------------------MR-------GVKRVFTWLAKLVLGLFFAS------I
MTGA_SHEAM            ---------MSEKDLGGGKKAGFIAR-------TWRGFWRWSARLLVAFLILS------L
G4T1S5_META2          -----------------------------------------------------------M
MTGA_PASMU            -----------MSKLKKTKHPFPCFS-------IWQQFKRKLYRTFALFLVLF------L
MTGA_PHOLL            -----------------------MRN-------PFQFLWYWLKKIAISVIILW------I
MTGA_ECOLI            -------------------MSKSRLT-------VFSFVRRFLLRLMVVLAVFW------G
S5YF36_PARAH          MSHHAELLDDNDPQPRDPQPRRPALML------LLRRPMRWLKWFALRCFALM------L
A0A2D7D523_9RHOB      ---------------------------------MIKKSKKIFLSVCMLSFVVL------F
MTGA_JANSC            ----------MAKRARKSKKNVSRARL------LAQAMRRWLLRGMFGLGALM------L
I3TH38_TISMK          -------------------------------------------MVLTILAVWA-------
E3I5T3_RHOVT          -----MTDLAPKTFERLAEVTRPHNRG------WRGRALRIVLIALGVFLLAP------Y
B1LVH7_METRJ          --------------------------------------MGALLLLPAVGFVLA------L
MTGA_BRADU            -----------------------------------MRIVKILLVALAVVVLAP------Y
A0A1E4FIP6_9RHIZ      --------------------MARRAK-------YPWRLLRIPLLALTVLAAIP------L
G4RG64_PELHB          --------------------------------------MAVPLMLAAALVAIP------L
E6YJ92_BARC7          ---------------------------------MAMRVMHYVISLFVFLFLCP------I
A0A072R6K1_BARBA      ----------MVLSFVKKRQDDSQKR-------WCCKVRTFVVYPLLCLLFLP------I
MTGA_RHILO            ---------------MATRSRGVNRR-------SLRRWVRRGLVVAAVLALIP------T
MTGA_BRUME            ---------------------------------MWGSRIAVALRILVVLAILP------V
Q1Q9J3_PSYCK          --------------------MTSFGK-------FIKRLLLALMVLVVAFHVLV------A
X0QFZ7_9GAMM          --------------------MASFGT-------FIKRLLLAIMLLVVAFHILV------V
MTGA_ACIAD            -----------------------MKR-------FIVRAVLILVSFVLLIQLWI------F
B3PB53_CELJU          ----------MKIRNPIDSLVMSSRTGKRQFFHTIKRLLWWAFLLLLAYQLWI------F
MTGA_BORBR            -------------MPKPTARRLNWFR-------VITAVIMAVLCIAILYQLWM------F
MTGA_NEIMA            ----------------------------------MFRIIKWLIALPVGIFIFF--NAYVY
A2SKR6_METPP          ------------------------MK-------RLVRWLVLLALSAIALQGVF------V
A4SVC5_POLAQ          ------------------------MR-------WLSYPIKCLCCAFLAMQLFF------A
B1XT59_POLNS          ------------------------MR-------WLAYPVKCLLAGFVAMQIFF------A
MTGA_RALSO            -----------------------MMR-------WLGYVIGCFAAGVVALNLYF------F
MTGA_BURA4            ---------MAAVSGTRRTRAVSPTR-------WIVYAGSVFAGAWLATQLFY------L
MTGA_CHRVO            -----------------------MSR-------ILFKILAALVAAFLLYNLWV------L
MTGA_NITEU            -----------MKLAQARRPATSKPRLIST---WLLRPLLLLLTAALLYQSWF------L
Q30YD3_DESAG          ---------MGDAGVTVRRVLKTFVL-------AALVVLPVMAADVLRFAFWP-------
Q3B1G0_PELLD          -----------------------------------MKFLRNIAILLFCLFVVDIVRYFVI
Q2LUM1_SYNAS          -------------MRWIDKTMIKKVI-------LIVLAVMFIGILFNMGMYFF------Y
Q2IJ97_ANADE          ---------------------MPAAR-------SRRRVPRSLLYAAAAAAISL------V
L7UQ52_MYXSD          ---------------MAPPRRKAWRF-------KVLLAGVVLLLGFGVYEYVT------L
Q1D1N0_MYXXD          MASRPPSVRASSPRTQKTKQLPAGARRAVRKD-SSPGWGRWMFGGWLLFVVWLSVEYVRL
F8CHR5_MYXFH          MASRPPSARAASPRTRKTKQLPASARRVGAESSSGPGWGRWLFGGWLLLVLWLSVEYARL
                                                                                  

C1A9G1_GEMAT          PCILLLGV-VNP-------PITMVMLGRVTDRLLSGERPVWPAHDPVSRAEFSPYLRRAV
B8GSJ2_THISH          VALAYLRY-LPP-------PVTGVQTQRVIEQVWSGEP-VIRDYRWRPASQISPHLPRAV
C0QH40_DESAH          VQVLALKY-INP-------PFTPDVAWEWAEAIIKNTPDKRPRYVWKDIKAVSPHLRRAV
J9R138_RIEAN          LTLIGGRF-FNP-------IITITQIEGLVKF-------HKLDRDYIPFSEMGNNVKKAV
W0E853_MARPU          LLVGALRW-VDP-------PASAFMLQHAYNLWRLDQSPPYYHHCWVPWSELPPPLRLAA
D4Z2E5_SPHJU          LMVVIYRF-VPP-------PVTWTMLLDP----------NGITKDWMSLDRMDPDMARAA
MTGA_CAUVC            VAVILYRF-IPP-------PVTPLMVIRAVEG-------RGLDHRWRPMDKISPALPRVL
L1QRN1_BREDI          AGVAVHRF-LPP-------LATILMVKQAAAG-------HGMDYRWRSLDRISPRLVEAV
MTGA_BACTN            LAVIVYRF-MPV-------YVTPLMVIRSVQQLASGDK-PTWKHTWVSFDKISPHLPMAV
U3GJM0_BELBD          GLTVVYKF-VPV-------PVTPLMLIRVWEQSLDDKKEVRLYKNWESIDNISKHLPQAV
MTGA_PSEAE            VLVAVLRW-VPP-------PGTMVMVERKVGSWVDGQP-IDLQRDWRSWEQLPDSLKVAV
MTGA_XYLFT            LQVIVFRF-VDP-------PLSMTMVGRYLEAWSDRQWNFRLHYVWCDLEQIAPSVPISL
MTGA_XANAC            LQVLILRV-VDP-------PISSMMAGRYLEAWGEGDWSFSLHRQWRDYDKIAASLPISV
MTGA_VIBPA            VLVGVVKY-VDP-------PIWGWKLSRIVAP--PKNYPDSSQHEWVSLTRISKNMQLAV
MTGA_SHEDO            VLLLVLRF-VPP-------PTTSFMLQSA----------YPVSQHWVSIDELPSHLPLAV
MTGA_SHEON            LSVVLLRF-IDP-------PMWSWRIERALFP---PAPITEVRHQWRSLEQISPELQLAV
MTGA_SHEAM            VLVATVSV-INP-------PTWAWRIDRALFP---PKEDIQVRHQWVPLDKIAAHMQLAV
G4T1S5_META2          LSVVLLRH-IPV-------PVSVFMLYRHAEYFQQHRSFKIIDYRWVKNEQISRYAISAV
MTGA_PASMU            SSVVLFRF-VPV-------PFSAYMLQQKIGYLFEGNLSSTIHYQWVPLEQISQSMQLAV
MTGA_PHOLL            VSVVAFSF-LPV-------PFSMVMVERQISAWLSVNFSYVSHSDWVGQGQISPNIALAV
MTGA_ECOLI            GGIALFSV-APV-------PFSAVMVERQVSAWLHGNFRYVAHSDWVSMDQISPWMGLAV
S5YF36_PARAH          ALVFLFAF-VNP-------PTTWTILTETRAH-------PGTPHTWTPISEISPNMLRAV
A0A2D7D523_9RHOB      FIVLLFRF-IPI-------PTTPYMVLE-----------RPISYTWISLDKVSXNVPLAI
MTGA_JANSC            VWIVAYAV-VPV-------PTTIYMQQERARL-------GGIERDWVPMDQIAPVLARSV
I3TH38_TISMK          AMLVAYRW-IDP-------PATPLMLIRLVEE-------GRLDYRPRDLDQIARALPNSA
E3I5T3_RHOVT          VLTLVYAV-VNP-------PLSALMARQALLG-------RPVAHDWRDLDEISPNLIAQV
B1LVH7_METRJ          TLALVYSA-VMP-------PST-LMLGRWLTL-------QPVSRDPVPLSAIAPALPQAV
MTGA_BRADU            VIAPFYR--TGH-------PVSTLMAWRSLRG-------APMQREWIDLAAMSPYLPRSV
A0A1E4FIP6_9RHIZ      VLTPVYL--VAQ-------PVSVPMLVRGMTG-------QPVIRYWRDIDTISDRLKAAI
G4RG64_PELHB          VLVPLYR--VVP-------PVSTLMIGRYVTG-------QPVTRIWRDLDEISDRLKTSV
E6YJ92_BARC7          VLLLIYRLDFVH-------PVSILMIRDWVSN-------KRYERKWVTLSDIAFSVSSGV
A0A072R6K1_BARBA      ILLLIYRLTFVH-------PVSTLMMRDILTR-------DSYQREWVALADVSFAGPAGI
MTGA_RHILO            MLTFLYLPSFVH-------PVSTLMLKDLATF-------SGYDRRWVSIDDVAPVLAHSV
MTGA_BRUME            FLLLVYSLPFVR-------PVSTLMVKDYALL-------QGVNRQWVDIENIAPVLVNSV
Q1Q9J3_PSYCK          GLLLIWKT-QPI-------NNSMFMLTHRIMG-------GDVSQTWVEYDAIAKSAKQAA
X0QFZ7_9GAMM          GLLLIWKT-QPI-------NNSMFMLTHRLTG-------GTVTQTWAEYDAIAKSAKQAA
MTGA_ACIAD            CSLAWWRT-HPV-------ETTMFMRLDYWSD-----SSKPIQQQWRDYDEISDNFKKAV
B3PB53_CELJU          AHVVAWKW-INP-------SQSSFMALRLAEL-REQNPQAQLQHQWVDYTRMSVHLKRAV
MTGA_BORBR            SLVVWYAY-RDP-------GSSAIMRQELARLR-ERDPEAELKYQWVPYDRISNTLKQAV
MTGA_NEIMA            GNIITYRA-VAP-------HRTAFMSMRMKQFEQEGRD-VALDYRWMPYKRISTNLKKAL
A2SKR6_METPP          LRIAMMRF-VDP-------ESTTFQRSEIWRLA-TERHEVLWSQRWQPYERIAATLKRAV
A4SVC5_POLAQ          IQIALWTT-LDP-------STTAFQRAERWRLC-GLHWSCPVYSTWTPYTQISNNLKRAV
B1XT59_POLNS          LQIALWIG-LDP-------SNTAFQRAERWRLC-SWHWNCSVQSRWVPYDKISNNLKRAV
MTGA_RALSO            AAIASWQV-FNP-------ASSAFMRAERMRLCGANLVTCGIDHRWVPYDQISRNLKRAV
MTGA_BURA4            VQIALWSF-INP-------GSTAFMRTDAWWLS-RDKPPAQVQHQWVPYDQISRNLKRAL
MTGA_CHRVO            GHIIYWRD-HNP-------GASSFMNEQLARLQ-QDDPEAELRHKWVPYDKISPNLKRAL
MTGA_NITEU            LHIVYWRS-YSP-------TTSAFMQDRLKIM-RQQNPAASLQHQWVDYEQISSHLKRAV
Q30YD3_DESAG          -DVAVLKK-ENP-------AATEYMRFRESLA-----ERPVPKLRWVPLGQISPWLVRAV
Q3B1G0_PELLD          PDVEGLAR-KTP-------ETTAFMRYRVEAWRRAGYSGRKTDRKVVPLSAISKNVVKAV
Q2LUM1_SYNAS          PDVKKLKK-ENP-------DKTAFMKYREDERKERG-KNIRFRQHWVRLSRISPYVIKAV
Q2IJ97_ANADE          GLALLWVALPDPAPLARDNPRTTALIEQRRAEAKEKRRAFRPRQAWVPLDRVSRPMVQAV
L7UQ52_MYXSD          PEATAFER-ENP-------KSTALMDKRAEEAREAGKK-VRRRQHWVSLGAVSKTAVASV
Q1D1N0_MYXXD          PDVRALQT-QNP-------RTTALITQRAEEALAEGKK-PRVRQAWVPLEAVAPHALDAV
F8CHR5_MYXFH          PDVKRLLT-QNP-------RTTALITQRAEEALAAGKQ-PRARQAWVPLNAVAPHAVEAV
                                                                         .        

C1A9G1_GEMAT          LASEDDRFYLHRGIDFVELEKALERR-----------------RQGGR------------
B8GSJ2_THISH          VAAEDARFFLHRGFDWEELHKARETA-----------------RDEGQ-S----------
C0QH40_DESAH          IAAEDQRFLSHNGFDVTEIKNAVSNL-----------------IRHGK------------
J9R138_RIEAN          IASEDQNFYTHNGFDFKAIERAMKHN-----------------EK-GK-S----------
W0E853_MARPU          ISGEDQRFPTHLGFDLIEIRHALAAH-----------------RR-GG-A----------
D4Z2E5_SPHJU          IAAEDSRFCSHHGFDAVAIAQAMRHN-----------------AS-GG-R----------
MTGA_CAUVC            IAAEDAKFCEHRGFDFEALQKAYENN-----------------ES-GR-K----------
L1QRN1_BREDI          IAAEDARFCQHHGFDVEAIQKALEAN--------------ERAEQRGSGK----------
MTGA_BACTN            IASEDNRFAEHNGFDFIEIEKAMKEN-----------------EK-RK-R----------
U3GJM0_BELBD          VAAEDQKFMNHNGFDLEAMKKAWEGN-----------------KQ-GK-R----------
MTGA_PSEAE            IAGEDQHFAEHHGFDLPAIQQALAHN-----------------ER-GG-S----------
MTGA_XYLFT            VAAEDQRFPFHHGFDFDAIKKALGRH-----------------SR-GG-H----------
MTGA_XANAC            VAAEDQQFPMHHGFDLQAIEKARDHN-----------------AR-GG-R----------
MTGA_VIBPA            IATEDQKFPHHYGVDFESLFDVISEA-----------------GD-HG-P----------
MTGA_SHEDO            VASEDQLFPKHFGIDFTSITKALNQY-----------------DD-GQ-G----------
MTGA_SHEON            IAAEDQKFAGHSGFDLDAISSAIEYN-----------------QK-GK-K----------
MTGA_SHEAM            IAAEDQRFTLHNGVDFAAIKTAIADR-----------------DP-GE-P----------
G4T1S5_META2          IASEDQRFFSHHGFDFNEIQNAVDQY-----------------LK-GG-K----------
MTGA_PASMU            IASEDQRFATHYGFDWDAIQSALQHN-----------------QR-GK-R----------
MTGA_PHOLL            IAAEDQKFPQHWGFDFDAIESVLERN-----------------QNHSG-R----------
MTGA_ECOLI            IAAEDQKFPEHWGFDVASIEKALAHN-----------------ERNEN-R----------
S5YF36_PARAH          VAAEDANFCSHWGFDMQEIRKVVA----------------------SG-S----------
A0A2D7D523_9RHOB      VAAEDAXFCNHWGFDMKAIRLAIEQ---------------------GG------------
MTGA_JANSC            VAAEDANFCLHWGFDMTAIRDAIA----------------------DG-A----------
I3TH38_TISMK          IAAEDNNFCSHFAVDWNAVGEAIDEW-----------------RD-GR-P----------
E3I5T3_RHOVT          IVSEDGRFCQHHGVDWQALDKAVDAV-----------------KA-GK-P----------
B1LVH7_METRJ          IASEDQRFCLDHGVDFGAIRDVVEDE--------------------DS-P----------
MTGA_BRADU            VAAEDAHFCKHHGIDWGALREAIDDA-----------------KEDGT-A----------
A0A1E4FIP6_9RHIZ      ILSEDGQFCRHWGVDVAALRDEVENY-----------------LA-GR-E----------
G4RG64_PELHB          VLSEDGQFCTHHGVDIGALQAEIDNF-----------------LA-GR-E----------
E6YJ92_BARC7          IMSEDGQFCRHSGVDWAMLIDILKTD--------------------SK-P----------
A0A072R6K1_BARBA      VVSEDGNFCRHYGVDWSVLMTILRDK--------------------TR-P----------
MTGA_RHILO            IMSEDGQFCFHRGVDLGELRGVVDDA-----------------LA-GE-A----------
MTGA_BRUME            MMAEDGQFCSHGGVDWHQLGLVLDDA-----------------GD-GG-P----------
Q1Q9J3_PSYCK          IVSEDSTFSQHNGFDMKGIKAAQKKN-----------------EATGK-M----------
X0QFZ7_9GAMM          IVSEDSTFSQHSGFDFKGIKAAQKKN-----------------EETGK-M----------
MTGA_ACIAD            VAAEDGKFVHHHGFDWEGIQYALEKN-----------------EKSGE-V----------
B3PB53_CELJU          VAAEDDRFMDHWGLDTRGIELALKKN-----------------QRRGR-S----------
MTGA_BORBR            VASEDANFTEHDGVEWDAIRKAWEYN--------------QRQAERGRTK----------
MTGA_NEIMA            IASEDARFAGHGGFDWGGIQNAIRRN-----------------RNSGK-V----------
A2SKR6_METPP          IASEDASFTDHGGVDWEAIEKAWERNQRAEARAEKLQAQLESQQQRRA-ANARSAPPRPA
A4SVC5_POLAQ          LVSEDDIFFQHKGVRVEDMQKAWEKN----------QQKTQAGAKAKV-A----------
B1XT59_POLNS          LVSEDDIFFQHSGVRVEGMQKAWQKNQ------QHYQQKTQSGSKSKT-A----------
MTGA_RALSO            IASEDADFVSHSGWEVDAMLDAWEKN-----------------KRRGH-V----------
MTGA_BURA4            IASEDSTFATNNGYDVDAILQAWEKN-----------------KARGR-I----------
MTGA_CHRVO            IASEDARFVDHEGFDWDGIEAAFEKN-----------------LKKGK-I----------
MTGA_NITEU            IAAEDARFLQHQGFDYKAIETAWKKN-----------------LKQRK-W----------
Q30YD3_DESAG          TIAEDDRFWDHEGFDTEGMRQAFLRN-----------------LREGR-L----------
Q3B1G0_PELLD          LIAEDDKFWQHDGFDYDAMEHALEKN-----------------LKERK-I----------
Q2LUM1_SYNAS          IISEDDKFWHHEGFDYEALQQAFEED-----------------IRERK-F----------
Q2IJ97_ANADE          LLSEDANFYGHEGIDWEATREAAAHD-----------------LEKRS-F----------
L7UQ52_MYXSD          LVSEDAGFYGHEGLDTTEVRRALEEA-----------------WEKGK-L----------
Q1D1N0_MYXXD          LSSEDARFYKHEGVDWIEVENALEQS-----------------VRKAR-L----------
F8CHR5_MYXFH          LTSEDARFYKHEGVDWIEVENALEQS-----------------VRKAR-L----------
                         **  *    .                                               

C1A9G1_GEMAT          ----LRGASTLTQQVVKNVFLWNGR-SFIRKGFEAYLALCMDFLLSKERILDLYLNLAEW
B8GSJ2_THISH          ----MRGASTLTQQLIKNLFFTTHR-NPVRKVYEWALTPVAEFILGKDRILELYVNVVEF
C0QH40_DESAH          ----LRGASTISMQTARSVFLLSSR-SVFRKLAEAYYTVLIELFWDKRRIFEMYLNTVDW
J9R138_RIEAN          ----IQGGSTISQQTAKNIFLWNGR-SWIRKGLEAVYTFIIEKIWSKDIILERYLNSIEM
W0E853_MARPU          ----LRGASTITQQTAKNLFLWPGQ-GWGRKAIEAWFTLLLEVLWSKERILEVYLNIIQF
D4Z2E5_SPHJU          ----IRGGSTISQQTAKNVFLFQGG-GFVRKGLEAWFTLLIEAIWGKRRIMEVYLNVAET
MTGA_CAUVC            ----IRGGSTISQQTAKNVFLWPGR-SYVRKGLEAWFTVLIETFWGKKRIMEVYMNSIEY
L1QRN1_BREDI          ----VRGGSTISQQTAKNVFLWPGR-DWVRKGLEVGYTGLIEIGWGKRRIMEMYLNVAEW
MTGA_BACTN            ----KRGASTISQQTAKNVFLWPQS-SWVRKGFEVYFTFLIELFWSKERIMEVYLNSIEM
U3GJM0_BELBD          ----IKGASTISQQTAKNVFLWPGR-NLVRKGLEAYFTILIEFIWGKERIMEVYLNVIEM
MTGA_PSEAE            ----IRGASTLSQQVAKNVFLWSGR-SWLRKGLEAWFTLLIETLWTKQRILEVYLNSAEW
MTGA_XYLFT            ----LRGASTISQQVAKNLFLWSGR-SFVRKGLEGWYTFWIELFWPKRRILEIYANIAEF
MTGA_XANAC            ----VRGASTISQQVAKNVFLWQGR-SWVRKGLEAWYTVLIELFWPKQRILEMYLNVAEF
MTGA_VIBPA            ----SRGASTITQQAAKNVFLFPSH-SYVRKAYELYFALLMELMWSKERILEVYLNVVEF
MTGA_SHEDO            ----LRGASTITQQTAKNLLLWPGR-NLVRKGLEAMLAVSLEAVWGKKRILEVYLNVAEF
MTGA_SHEON            ----VRGASTLSQQAAKNLFMWSSR-SFIRKGIEAWFTLLMELIWDKARILEVYLNIVEF
MTGA_SHEAM            ----LRGASTLTQQTAKNLFLWSSR-SFVRKGLEAWFALLLDTLSGKRRTLELYLNIVEF
G4T1S5_META2          ----LRGASTISQQVAKNLFLTPSK-SFWRKGFEFWFTGLVEMFWHKDRILEVYLNIAEF
MTGA_PASMU            ----IRGGSTISQQTAKNLYLWHGQ-SWLRKAIEMPTTLVLETLWSKKRILEVYLNIAEF
MTGA_PHOLL            ----LRGASTISQQTAKNLFLWDGR-SWLRKGLEAGMTFAIELGWSKSRILTVYLNIAEF
MTGA_ECOLI            ----IRGASTISQQTAKNLFLWDGR-SWVRKGLEAGLTLGIETVWSKKRILTVYLNIAEF
S5YF36_PARAH          ----SRGASTLTQQTAKNVYLWQGR-SWPRKFLETAYTPMLNFVWSKRRIVEVYLNVAEF
A0A2D7D523_9RHOB      ----NRGASTISQQVVKNLFLWHER-SWIRKFFEAILTPAXEXAWSKKRILEVYINIAEF
MTGA_JANSC            ----ARGGSTISQQTVKNAFLWHGR-SWVRKALEAAITPVMELVWPKRRVLEVYLNVAEF
I3TH38_TISMK          ----LRGASTITMQTARNLFLWPGG-GFLRKALEVPLAFAIETLWPKWRIIELYVNVAEM
E3I5T3_RHOVT          ----KGGGSTITMQTAKNLFLWSDP-AWLRKPLEIPLASFMDAVLGKRRVMEIYLNIVEW
B1LVH7_METRJ          ----SRGASTIAMQTVKNVFLWPGR-SYIRKAIEIPLALALDTLWGKRRMMEIYLNVAEW
MTGA_BRADU            ----FRGASTITQQVAKNLFLWQGR-DFIRKALEFPLALWIDFVLPKPRILEIYLNIAEL
A0A1E4FIP6_9RHIZ      ----TRGASTISMQVARNLFLWNQQ-SAVRKALEVPLAAYIDLIMPKRRIMEIYLNIAEW
G4RG64_PELHB          ----TRGASTITMQVARNLFLTNSR-SAIRKAIEVPLAIYIDLVLPKQRIMEIYLNIAEW
E6YJ92_BARC7          ----FRGGSTINMQMIKNLFLWSNR-SYIRKIIEIPYSIIADLILSKKRIIEIYLNIAEW
A0A072R6K1_BARBA      ----WRGGSTITMQVVKNLFLWSHR-SYVRKGFEIFYSLIADFLLSKKRIMEIYINIAEW
MTGA_RHILO            ----TRGASTITMQTVKNLFLWSRPLGSVRKVVELPLAVFFDAVMSKRRIMEIYLNIAEW
MTGA_BRUME            ----SRGASTITMQMVKNLFLWNGR-SYLRKGLEFPLALIADAVLSRKRIMEIYLNIAEW
Q1Q9J3_PSYCK          ----SAGGSTITQQLAKNLFLTSHR-SYTRKAEEAVLTIMIETLWDKQRILTAYLNVAEF
X0QFZ7_9GAMM          ----SAGGSTITQQLAKNLFLTSHR-SYVRKAEEAVITVMIETLWDKQRIMTAYLNVAEF
MTGA_ACIAD            ----VNGGSTISQQLAKNLFLYNQR-SLIRKGQEAIATWMMERMWSKQRILEVYMNSVQF
B3PB53_CELJU          ----VAGGSSITQQLAKNLFLSPTR-SYVRKAQEVVIALMLELVWDKRRILEVYLNMVEW
MTGA_BORBR            ----MRGGSTITQQLAKNLFLSGSR-SYLRKGQELVLAYMIEHVMPKERILELYLNVAEW
MTGA_NEIMA            ----KAGGSTISQQLAKNLFLNESR-SYIRKGEEAAITAMMEAVTDKDRIFELYLNSIEW
A2SKR6_METPP          PVAKIVGGSTISQQLAKNLFLSGER-SLARKGQEFVITFMLEALLDKERILAIYLNNVEW
A4SVC5_POLAQ          ----LRGGSTITQQLAKNLFLSSEQ-NYFRKGQELIITGFLELILSKQRLFEIYLNSVEW
B1XT59_POLNS          ----LRGGSTVTQQLAKNLFLSSEQ-NYLRKGQELIITGLLELTLSKQKLYEIYLNSVEW
MTGA_RALSO            ----VAGGSTITQQLAKNLFLSGER-HYLRKGEELVITWMLEFWLDKERILEIYLNSVEW
MTGA_BURA4            ----VAGGSTITQQLARNLFLSREK-SYIRKGQELIITWMLETVLDKERIFEIYLNSVEW
MTGA_CHRVO            ----VAGGSTISQQLAKNLFLSSGK-TPWRKLEEALITVMLETVLDKRRIYEIYLNVIEW
MTGA_NITEU            ----AAGGSTISQQLAKNLFLSTEK-TVWRKSRETLITLMLEEFLTKRRILEIYLNIIEW
Q30YD3_DESAG          ----AAGGSSISQQLAKNLYLSPDR-TLSRKLKEALLTWRLEATLSKRRILEIYLNVIEW
Q3B1G0_PELLD          ----AMGGSTVSQQLAKNLYLSPSK-NPVRKIKEAILTWRIERSLSKSRILELYLNSAEW
Q2LUM1_SYNAS          ----KVGGSTISQQLVKNLYLSPSK-NPIRKIKEAILTWRIERTLSKKRIIEIYLNVAEW
Q2IJ97_ANADE          ----ARGASTITQQLAKNLWLGTEK-SLWRKLKEALLAVKLERELPKRRILALYLNVVEL
L7UQ52_MYXSD          ----GRGASTITQQLAKNLWLSTDR-SLFRKAKELVLARRLEDALTKKRILTLYLNVIEW
Q1D1N0_MYXXD          ----GRGASTLTQQLAKNLYLSTDR-SLLRKGKELLLARQLETHLSKQHILTLYVNVVEW
F8CHR5_MYXFH          ----GRGASTLTQQLAKNLYLSTDR-SLLRKGKELLLARQLETHLSKQHILTLYVNVVEW
                            *.*::  *  ..  :        **  *   :   :    .      * *  : 

C1A9G1_GEMAT          GP-NAFGAEAGARYQFGKSARNLTREEAARMAAILPAPRRWPAKGRVA------SQRVGT
B8GSJ2_THISH          GP-GIYGAEAAARHHYGITAADLSRQQAMGLAAVLPAPLTRRPQAMGWYT--------EI
C0QH40_DESAH          GT-NVTGAEAAAQKYYSKSARHLTSNQAALMTAILPNPHKWSVKHPTQYL----KMRQRQ
J9R138_RIEAN          GQ-GVFGVEAASQYYFNKPAKDLTKSEAAWIAAVLPNPKKYDPKNPTPYL----NRKHKW
W0E853_MARPU          SP-STYGAGAASVRYFGHPARTLTLEESALLIGVLPAPGHYRLDRPSERL----RRRADW
D4Z2E5_SPHJU          GI-GTYGAQAGAIRYFRHGAQRLTRAEAARLAAVLPLPKKRAAIDPHGFT----RRYGNS
MTGA_CAUVC            GS-GIYGAEAAAQRYFGVSAAKLTQAQSARLAAILPSPLKWKVIKPGKYV----AKRTKK
L1QRN1_BREDI          AP-GVYGAEAASRHWFDKSADKLTAAEAARLAAILPSPRRYKAADSGPYV----RRRAAR
MTGA_BACTN            GK-GIYGAQATAKYKFNTTAAKLSSGQCALIAATLPNPIRFNSAKPSAYL----LKRQKQ
U3GJM0_BELBD          GE-GIYGAEAAADVFFKKSAGNLSRNEAALIAATLPNPRRWTPSRPTGYI----YGRQAW
MTGA_PSEAE            GP-GVFGAQAAARYHFGLDAERLSRTQASQLAAVLPSPLKWSAARPGPYV----RQRAAW
MTGA_XYLFT            GD-GVYGVQAAARRYLGKGAADLDESDAAQLAAVLPSPRHYNIQHPGPYI----RWRSSW
MTGA_XANAC            GD-GVYGAQAAAQQFWSKDAAGLSPSESARLAAVLPSPRRYDARRPGAFV----QRRAGW
MTGA_VIBPA            GP-GIYGAEAAAQNYFGVSAKQLSKWQAARLAVVLPNPYRIKVYPQSDYT----ARRTRW
MTGA_SHEDO            GK-GIYGVEAASRHYFNKSARYLSINEAARLAVLLPSPRSRSPHHLTPYL----HQRVAW
MTGA_SHEON            GP-GIYGAEAASKHYFGKSAAKLTRYEASLLAAALPNPWRYKVSPPSSYV----EQRSAW
MTGA_SHEAM            GP-GIYGVEAASRYYFNKGAGKLSTREAALLAALLPNPWSYRINPPTAYM----NRRADW
G4T1S5_META2          GD-HLFGIESASQRYFGIPASQLSASQAALLAATLPNPHLYRANKPTPYL----LKRKAW
MTGA_PASMU            GP-NIFGVEAASQHYFRKPAKQLSNAEAALLAAVLPNPIIFKVNKPSAYV----KKRQQH
MTGA_PHOLL            GD-GIFGVEEASKHYFHKSASKLTASEAALLAAVLPNPHRYKVNSPSAYV----LQRQQW
MTGA_ECOLI            GD-GVFGVEAAAQRYFHKPASKLTRSEAALLAAVLPNPLRFKVSSPSGYV----RSRQAW
S5YF36_PARAH          GP-GVFGIAAAAKYHFKTTPDKLTMRQAAALASILPAPKTRKPDPNSP------RSRQII
A0A2D7D523_9RHOB      DQ-GVFGIEEASQQLFGLPASQLSLSEASLLAAVLPNPKKRSVKNPSLFI----QRRALA
MTGA_JANSC            AP-GVFGAEAGAQHHFGVSAADLTARQASLMAAVLPNPQRRDAGSPSDLV----NRRARS
I3TH38_TISMK          GP-GIYGAEAAAQAHFGKPAAALTAREAALLAAVLPNPRRWSASEPTRYI----QRRAGV
E3I5T3_RHOVT          AP-GVYGAQAAARHHFKTSAEDLTMQQAAQLAAALPNPKRRNAGKPGPRV----AALANR
B1LVH7_METRJ          GD-GIYGAQAASRHWFGKDASRLTRNEAALLAAVLPNPITRSAGRPSPGV----RRRAAR
MTGA_BRADU            GPQGQFGVEAASAYAFGKSAASLSPREAALLASILPNPVKRSARTPGPGV----RRLAGT
A0A1E4FIP6_9RHIZ      GPSGQFGVGAGAQHAFGREPQNLDWHTASLLAVTLPNPLLRDPARPNAGL----LRVAGI
G4RG64_PELHB          GPDGQFGVEAGAQAAFGTSAESFTWRRAALMTVTLPNPHVRRPGNPTNGL----LAVAGI
E6YJ92_BARC7          GP-GIYGIEAAAFYYFQKSARHLTLQQAAALVASLPNPYWRNPCQPTDNF----ITLTRL
A0A072R6K1_BARBA      GP-GIYGIEAAAFYYFKRSARALTVQQVAALVASLPNPYARNPHQPTDHF----LALSRM
MTGA_RHILO            GP-GIYGIEAAAQHHFGIPAKQLSRRQAALLAVTLPNPIARNPAKPGPGL----RRLANL
MTGA_BRUME            GP-GIYGIEAAARHYFKRSAAKLTARQAALLAVTLPNPALRNPAKPTRNM----QRIARI
Q1Q9J3_PSYCK          GN-GIYGVEAAAQYYFDKSAANLNRDQSALLIAMLTNPKYYESHQSDKRL----RNKQRI
X0QFZ7_9GAMM          GN-GIYGIDAAAHHYFDKSAANLNRDESALLIAMLTNPKYYEDNQGDKRL----RNKQRI
MTGA_ACIAD            GD-HLYGVEAASHYYFHRSAQNLTRDQAAFLAALLPNPKYYQENRNDPRF----KFKKRF
B3PB53_CELJU          GN-GIFGAEAAARHYYGTAAADLGPAQAVRMAVMLPNPRTYQKAMPAWVM-----KHAAR
MTGA_BORBR            GV-GVFGAEAAARHYYNTSAARLGAGQAARLAAMLPNPRYYDRHRNTGYL----NSRTAT
MTGA_NEIMA            HY-GVFGAEAASRYFYQIPAAKLTKQQAAKLTARVPAPLYYADHPKSKRL----RNKTNI
A2SKR6_METPP          GE-GVFGAQAASRHYFRVDAGQLSAMQAARLAVMLPAPKRFEKRPGSAYV----SGRAAT
A4SVC5_POLAQ          GE-GIFGVGAASRHYYNTSPTVLDREQAAALASALPAPKCFDKQQYCRRGSINYSSRQEF
B1XT59_POLNS          GE-GIFGVGAASQYYYAISPAALDRDQAAALASALPAPKCFDKQQYCRCGSINYSTRQEF
MTGA_RALSO            GE-GVFGAEAAAQHYFKRPASQLTVGQAARLAAALPAPKCFDKKRYCANVHISFTRKATV
MTGA_BURA4            GR-GVYGAEAAARYYYRIPASRLGAWQSARLAVMLPKPRWFDAHRGSAYQ----AQRAAV
MTGA_CHRVO            GN-GVFGAEAASRYYFRTGASRLSSSQAAKLAAMVPNPRYYDEHRNAPGL----ARKTRI
MTGA_NITEU            GD-GIFGIEAAARHYFGISAASLTPAQAAWLASIIPNPRFYDTRRTLPKL----LNKSRI
Q30YD3_DESAG          GD-GIYGINAASRHFFGVEPAALSPAQSARLASVLPAPRRYSPVSDSGYV----TAKSRV
Q3B1G0_PELLD          GD-GIFGIEAAARHYYGTSAGRLNARQASRLAAVLPNPIRWSPTGSSRYV----RKRSAI
Q2LUM1_SYNAS          GE-GIFGIEAAARHYFGKAASALSAREAAKLAAVLPNPRRYHPLGSSKFV----RNRSER
Q2IJ97_ANADE          GD-GVFGVEAGARARFGTSAAALTPAQAAVLASMLPAPRRVDLSSPSTWL----KRRSRR
L7UQ52_MYXSD          GN-GVYGIEAGAREHFGVSASQLSIGQGAILAAMLPAPRKRSPSSGSRAL----WKRAHW
Q1D1N0_MYXXD          GE-GVYGIEAAAREHFGTSARALSVAQGAMLAGMLPAPRRWLPAQKPETL----RIRAGA
F8CHR5_MYXFH          GE-GVYGIEAAAREHFGTSAGALSVAQGAMLAAMLPAPRRWLPAQKPETL----RTRAAV
                            *    :       .  :       :   :. *                      

C1A9G1_GEMAT          ILARMQYPAPKVAPEVTSRSPAPRRRPAPPR-----------------------------
B8GSJ2_THISH          IEERMQQLGW--------------------------------------------------
C0QH40_DESAH          IMKNMPQMPLL-------------------------------------------------
J9R138_RIEAN          IMRQMNFISLK-------------------------------------------------
W0E853_MARPU          IIDQSSRLGGERYLGRL-------------------------------------------
D4Z2E5_SPHJU          IATRIGIVQRDGLDSCLK------------------------------------------
MTGA_CAUVC            IGKATGAVRRDGLADCVA------------------------------------------
L1QRN1_BREDI          IQAAMGTVRQQGLDACVDRR----------------------------------------
MTGA_BACTN            ILRLMNLVPKFPPVEKKAVDKKDTRKKKKK------------------------------
U3GJM0_BELBD          ILRNMNNLEPVGFGK---------------------------------------------
MTGA_PSEAE            IRQQMWQLGGDDYLLRLER-----------------------------------------
MTGA_XYLFT            IQRQAKQLGGSAYLDMH-------------------------------------------
MTGA_XANAC            IQRQARQLGGPAYLQAP-------------------------------------------
MTGA_VIBPA            AMNQMSNLGSVQL-----------------------------------------------
MTGA_SHEDO            GEKQMRQLGSGYLKTILN------------------------------------------
MTGA_SHEON            IRKQMRQLGEVTLKKVNEAQ----------------------------------------
MTGA_SHEAM            IARQMRQLGMATLKDLD-------------------------------------------
G4T1S5_META2          IMKQMENLNYRHRQHSS-------------------------------------------
MTGA_PASMU            IQRQMGLLGKQHLSQLD-------------------------------------------
MTGA_PHOLL            ILRQMRLLGGGSYLEKNGLMKDD-------------------------------------
MTGA_ECOLI            ILRQMYQLGGEPFMQQHQLD----------------------------------------
S5YF36_PARAH          SGAETIAADGRDGCLHLN------------------------------------------
A0A2D7D523_9RHOB      ISDGASTILKDERSQCFTD-----------------------------------------
MTGA_JANSC            IADGAALIRADGRADCFAN-----------------------------------------
I3TH38_TISMK          ITRRVGQLGPATACAAPPA-----------------------------------------
E3I5T3_RHOVT          LRVRAARESDNSFCVLEEEAPAEDEASQE-------------------------------
B1LVH7_METRJ          IQAMMGQIDGLTGCLRR-------------------------------------------
MTGA_BRADU            YVARA-QASTLATCWRENR-----------------------------------------
A0A1E4FIP6_9RHIZ      VEGRAREYGQRAACVGRDGKLAL-------------------------------------
G4RG64_PELHB          VEGRAQRFSSHADCLFDGAPAL--------------------------------------
E6YJ92_BARC7          IEKRIRFSRAYTRCIH--------------------------------------------
A0A072R6K1_BARBA      IEQRIIFSGAYTHCLR--------------------------------------------
MTGA_RHILO            IERRAGRSGAYVGCLE--------------------------------------------
MTGA_BRUME            VAGRAMRSGPYVTCVK--------------------------------------------
Q1Q9J3_PSYCK          IKKRMKNAVLPQSA----------------------------------------------
X0QFZ7_9GAMM          IKKNA-------------------------------------------------------
MTGA_ACIAD            TLKYMRYSEIP-------------------------------------------------
B3PB53_CELJU          VQARMHHSRIP-------------------------------------------------
MTGA_BORBR            LTRRMRMVEIP-------------------------------------------------
MTGA_NEIMA            VLRRMGSAELPESDTD--------------------------------------------
A2SKR6_METPP          IVSRMSAVELP-------------------------------------------------
A4SVC5_POLAQ          ILENMDRVALAPYPKSGK------------------------------------------
B1XT59_POLNS          ILENMDRVALAPNPKK--------------------------------------------
MTGA_RALSO            IANRMGSATLPD------------------------------------------------
MTGA_BURA4            IARRMGAAELPQSQ----------------------------------------------
MTGA_CHRVO            IQRRMAYVELP-------------------------------------------------
MTGA_NITEU            ILSRLPAAKIP-------------------------------------------------
Q30YD3_DESAG          ILRRMQRRSWR-------------------------------------------------
Q3B1G0_PELLD          IYRIMQKRGIVAPSYGGRVPLPVDTTATAAASDTITIGVPRELIDGVFMDSGEGGN----
Q2LUM1_SYNAS          IYRIMVRRGVIIPEYEAVMKEPEEILPGESDSSEILPSPPNSEEQQNEEIEGPTSEEKMD
Q2IJ97_ANADE          LLDRMRAAGRLTAEQHLSASAELERILAGPVPRDDREEPPDVVDDVPVAAAPRAEPVPAG
L7UQ52_MYXSD          IVDQLESVGRISGAEASDARGDIDRLLGRAPAASAEAAEDDGGDDT--------------
Q1D1N0_MYXXD          IIGRLQREGRITATQAREAQAELSRFFGETSVPGSVVEAISRLSSES-------------
F8CHR5_MYXFH          IITRMERERRISAAQARDAQDELARFFGATPPPDSVVEAISRLASES-------------
                                                                                  

C1A9G1_GEMAT          --------------------------
B8GSJ2_THISH          --------------------------
C0QH40_DESAH          --------------------------
J9R138_RIEAN          --------------------------
W0E853_MARPU          --------------------------
D4Z2E5_SPHJU          --------------------------
MTGA_CAUVC            --------------------------
L1QRN1_BREDI          --------------------------
MTGA_BACTN            --------------------------
U3GJM0_BELBD          --------------------------
MTGA_PSEAE            --------------------------
MTGA_XYLFT            --------------------------
MTGA_XANAC            --------------------------
MTGA_VIBPA            --------------------------
MTGA_SHEDO            --------------------------
MTGA_SHEON            --------------------------
MTGA_SHEAM            --------------------------
G4T1S5_META2          --------------------------
MTGA_PASMU            --------------------------
MTGA_PHOLL            --------------------------
MTGA_ECOLI            --------------------------
S5YF36_PARAH          --------------------------
A0A2D7D523_9RHOB      --------------------------
MTGA_JANSC            --------------------------
I3TH38_TISMK          --------------------------
E3I5T3_RHOVT          --------------------------
B1LVH7_METRJ          --------------------------
MTGA_BRADU            --------------------------
A0A1E4FIP6_9RHIZ      --------------------------
G4RG64_PELHB          --------------------------
E6YJ92_BARC7          --------------------------
A0A072R6K1_BARBA      --------------------------
MTGA_RHILO            --------------------------
MTGA_BRUME            --------------------------
Q1Q9J3_PSYCK          --------------------------
X0QFZ7_9GAMM          --------------------------
MTGA_ACIAD            --------------------------
B3PB53_CELJU          --------------------------
MTGA_BORBR            --------------------------
MTGA_NEIMA            --------------------------
A2SKR6_METPP          --------------------------
A4SVC5_POLAQ          --------------------------
B1XT59_POLNS          --------------------------
MTGA_RALSO            --------------------------
MTGA_BURA4            --------------------------
MTGA_CHRVO            --------------------------
MTGA_NITEU            --------------------------
Q30YD3_DESAG          --------------------------
Q3B1G0_PELLD          --------------------------
Q2LUM1_SYNAS          QGVGEGDVSISAEDGEASDKTRKQAQ
Q2IJ97_ANADE          AAAAPEPAAVEAPAPGEPR-------
L7UQ52_MYXSD          --------------------------
Q1D1N0_MYXXD          --------------------------
F8CHR5_MYXFH          --------------------------