CLUSTAL format seed alignment for MF_00779

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

HUTP_BACCR      MLLQGTHRIGRMAMLLALADE-NESPVLSIPK-GWKYCTGKVGSMNSQKVVAAMETAAKS
HUTP_BACAN      MLLQGTHRIGRMAMLLALADE-NESPVLSIPK-GWKYCTGKVGSMNSQKVVAAMETAAKS
HUTP_BACHD      MSKHKSHRIGQLAILLAVSEEPGIVEASILSS-DYQSCIGRVGSMESNKIVAAIETAAKK
HUTP_BACSU      MTLHKERRIGRLSVLLLLNEAEESTQVEELERDGWKVCLGKVGSMDAHKVVAAIETASKK
                *  :  :***::::** : :      .  :   .:: * *:****:::*:***:***:*.

HUTP_BACCR      NQVIETDVYRETHALYHAIMEALYGVTRGQIQLADVLRTVGLRFAIVRGTPYDGKKEGEW
HUTP_BACAN      NQVIETDVYRETHALYHAIMEALYGVTRGQIQLADVLRTVGLRFAIVRGTPYDGKKEGEW
HUTP_BACHD      NGFIREGVYREAHALYHAIIEALHGVTRGQVQLGSFQRTVGLRFAIVRGKPYKEEAEGEW
HUTP_BACSU      SGVIQSEGYRESHALYHATMEALHGVTRGEMLLGSLLRTVGLRFAVLRGNPYESEAEGDW
                . .*.   ***:****** :***:*****:: *... ********::**.**. : **:*

HUTP_BACCR      VAVALYGTIGAPVKGSEHEAIGLGINHI
HUTP_BACAN      VAVALYGTIGAPVKGSEHEAIGLGINHI
HUTP_BACHD      IAVALYGTIGAPIKGQEHETIGLGINHI
HUTP_BACSU      IAVSLYGTIGAPIKGLEHETFGVGINHI
                :**:********:** ***::*:*****