CLUSTAL format seed alignment for MF_00784

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

AGRB_STAAM       -------MNYFDNKIDQFATYLQ-KRNNLDHIQFLQVRLGMQIIVGNFFKILVTYSISIF
AGRB_STAAU       -------MNYFDNKIDQFATYLQ-KRNNLDHIQFLQVRLGMQVLAKNIGKLIVMYTIAYI
AGRB_STAES       -------MKIIDKKIEQFAQYLQ-RKNNLDHIQFLKIRLGMQVLAINIEKSIVVYGLAII
AGRB_STALU       -------MKAIDKKIERFARYLQ-RQNNLDHIQFLKIRLGLQVALGNFFKTIVTYGVALL
AGRB_STAIN       -------MLLIDNGIEKMALKLQ-QRQNLSHIEFLKVRLGMQVVVINTFKAIVTYGLALL
AGRB_LISIN       MSNFTAKVPLSERMADVLISK---DRWKDDEEGYLKVKYGLEIILINVMKFAIVYGIALV
AGRB_LISMO       MSNFTAKVPLSERMADVLISK---DRWKDDEEGYLKVKYGLEIILINVMKFALVYGIALV
AGRB_CLOAB       ---MKGKSSVMEKLAEVVSLKLN-KHLKMEGIELIKLKLGVEIIFINISKLAILFLVSYY
AGRB_LACPL       -MEKPEQKLLLYKLSDRLFAAIQ-KNLQLERRQALLVKLGIDTVLNVIPKLIITIILALL
AGRB2_CLOPE      ---------MIENISKLIAEKVS-SELNYDNERKEIIQYGTYALIQTLISIISVLILGLV
AGRB1_CLOPE      ----------MRKFLKSAIEYLA-KDLDLDKELLEQIQYVVIVLTFEFIKCISVILIAGI
FSRB_ENTFA       --------MLIDWILKNIMDMDQ-EDQS---GKTQWTKYYLTVYFSGLFNLLMILILSVL
AGRB_ALKHC       ---------MLERLALTLAHQVK-ALNAEETESVEVLTFGFTIILHYLFTLLLVLAVGLL
AGRB_CLOBE       ---------MIKYLSTNISLYFQENNSCLSKKDVLKIQYTLEAILSDLSKFIIIFLVFLF
                                                                  .      :   

AGRB_STAAM       LSVFLFTLVTHLSYMLIRYNAHGAHAKSSILCYIQSILTFVFVPYFLINID-------IN
AGRB_STAAU       LNIFLFTLITNLTFYLIRRHAHGAHAPSSFWCYVESIILFILLPLVIVNFH-------IN
AGRB_STAES       FHTFFYTLLTHLSYFLIRRHAHGTHANSSLLCHIQNIIFFIIFPYLIIKLD-------IN
AGRB_STALU       FHTFLYTLITHLTYFFVRRFAHGAHARSSLLCHIQNLVLFVALPWSIVHFQ-------VS
AGRB_STAIN       LNIFLYTLIVHLTFLTLRTYSHGAHAKTSMLCHVQNIVAFVMLPWLIVQYD-------IS
AGRB_LISIN       TGLLLQTVTVHLSYLWLRRYSFGLHATKTLNCTLISLTMFVLAPFIFQNIP-------SN
AGRB_LISMO       TGLLLQTVTVHLSYLWLRRYSFGLHATKTLNCTLISLLMFVLAPFVFQNIP-------SN
AGRB_CLOAB       FGLIKETIIMLAAFGFLRSNAFGLHAKNSIVCTVMSLLMFVLGAYLSKYLL-------FN
AGRB_LACPL       LHELVPVLVFMGSFLVLRGFAYGRHLESDLLCTILTAVTFVGVPYLIQFTDG------IP
AGRB2_CLOPE      FNIALEALIFLFTASILRKYSGGAHSESSNVCTLLGIIISICIGFLIKSSFFAKMNFELV
AGRB1_CLOPE      LGYFKESLIVILSMCFIKPFIGGYHEDSQLKCFIATLIITTSIIMLVTFNK-------LN
FSRB_ENTFA       FGTLSETFIVYVVLIFLRPVAGGWHAKTKWLCRLESIVIYVAIPFVLKNSS-----VSLP
AGRB_ALKHC       HGEIWLFLQIALSFTFMRVLTGGAHLDHSIGCTLLSVLFITAISWVPFANN---------
AGRB_CLOBE       IKEIPLFLFSFIILNSTRPLLGGIHCKTYYGCLTCSILYFMIILLFTRLFPE------LN
                        .         :    * *      *                            

AGRB_STAAM       FTYLLALSIIGLISVVIYAPAATKKQP-IPIKLVKRKKYLSIIMYLLVLILSLIIH----
AGRB_STAAU       FLIMIILTVISLGVISVYAPAATKKKP-IPVRLIKRKKYYAIIVSLTLFIITLIIK----
AGRB_STAES       YFVLLSMALVGLIITILYAPAATKKQP-IPRRLVKRKKILSIFLYCTIVVISLVTK----
AGRB_STALU       WTFMIFVAFIAFIIIICYAPSATKKQP-ILPHLRKKKKRNAILISICFLVLMLFVS----
AGRB_STAIN       FQFLLILSLLSALIVIKYAPAATKKRP-IAPKKVKGLKIKSIIVFVLLMTIACIVP----
AGRB_LISIN       NWIVLGTFAFILLNMFLFAPADTESLPLIGEEHRKKLKRKAMIGTLILTGIALLIPF---
AGRB_LISMO       NWIVLGTFGFILLNMFLFAPADTESLPLIGEEHRKTLKRKAMIGTLILTGIALLIPF---
AGRB_CLOAB       NYMVLASFIIVNLLLFRYAPGDTEAHPLVGAKLRDKLKKQAVLMGMLLMAITLIIPD---
AGRB_LACPL       ELFRFILCLLLTVPIGMFSPAVTRKNPIKSQSLKRALKHKAIITSLVFSFLQFLVS----
AGRB2_CLOPE      VFIGIVIFVFGYFIVFKFAPVDTKNKPIKTEKKKKRMKKGSLKILTIYLFIEVLSIILYY
AGRB1_CLOPE      LFSIVILNLFSIFSIYNKAPVIDSRFPLTKEHLIKKNKILSVTNSSILFLITLIFFKI--
FSRB_ENTFA       FIYKILLMCLLVVLFYWYAPQGTAIEPVQPSD-LNVLKKQSLIRVCLLILCSLFVK----
AGRB_ALKHC       -YAWILYGISGGLLIWKYAPYYEAHQVVHTEHWERRKKRIAYILIVLFIILAMLMS----
AGRB_CLOBE       TNFYIVFFILSLAITFIFAPCPNEKRPVKNKATLKILSLISLTFWIILFYLSPLQT----
                     .             :*                 .  :            .      

AGRB_STAAM       -------PFYAQFMLLGILVESITLLPIFFPKED--------------------------
AGRB_STAAU       -------EPFAQFIQLGIIIEAITLLPIFFIKEDLK------------------------
AGRB_STAES       -------EPVNKLILFGVILESLTLLPIFFPKEDINHGKHF-------------------
AGRB_STALU       -------EPYMQLIALGMCIEAITLLPIFFSKEET-------------------------
AGRB_STAIN       -------PPYNRFVVYGVLLQSFTLLPIFSIKEEV-------------------------
AGRB_LISIN       -------AEMKTLIMVGSLFQVISINPLTYKLLKRRYRNYEKYE----------------
AGRB_LISMO       -------AEMKTLIMVGSLFQVISINPLTYKLLKRRYRNYEKYE----------------
AGRB_CLOAB       -------ELIKTCISLSSYFEIISILPITYKVLGRRYKNYYEFERTIKQS----------
AGRB_LACPL       -------NNLGTIIVVSLLLVFTLIVPLKGGKSDEAENV---------------------
AGRB2_CLOPE      NSGWSLAKPVMLSIIFGVAWQCMTLTYIGNILLKTIDSFTNKLL----------------
AGRB1_CLOPE      -------SWISQTITWTLLIQTLLLFNKYKREDS--------------------------
FSRB_ENTFA       -------EKIASVILYGLVIQGLMILPVTKNLIEGSVFMKFGKKIIKNVIEKRVAKVSDG
AGRB_ALKHC       ----------TQGLVLGVLLQGVLLTPIGLKVTRQLNRFILKGGETNEENS---------
AGRB_CLOBE       ----------RNCILISIFLQIIQVIIINTKGVIFNAKNNKTFFNRTT------------
                              :          :                                   

AGRB_STAAM       -------------------------------
AGRB_STAAU       -------------------------------
AGRB_STAES       -------------------------------
AGRB_STALU       -------------------------------
AGRB_STAIN       -------------------------------
AGRB_LISIN       -------------------------------
AGRB_LISMO       -------------------------------
AGRB_CLOAB       -------------------------------
AGRB_LACPL       -------------------------------
AGRB2_CLOPE      -------------------------------
AGRB1_CLOPE      -------------------------------
FSRB_ENTFA       VGTKPRLNQNSPNIFGQWMGQTEKPKKNIEK
AGRB_ALKHC       -------------------------------
AGRB_CLOBE       -------------------------------