CLUSTAL format seed alignment for MF_00787

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CBID_NOSS1      ---------------------------------------------MRSGYTLPVFACAGA
CBID_SYNY3      ---------------------------------------MSQSISAQSGYTLPVFACASA
CBID_THEEB      -----------------------------------------------MGYTLPVFATAAA
CBID_GLOVI      --------------------------------------------MSRTGYTLPVFAAAAA
CBID_PROMM      -------------------------------------------------MTLPVWVAAAA
CBID_SYNPX      ---------------------------------------------------MPVWVASAA
CBID_PROMA      ----------------------------------------------MRGFTLPVWVVAAA
CBID_PROMP      ---------------------------------------------MKKGFSLPLWVTGAA
CBID_AGRFC      --------------------------------------METDGKTLRRGWTTGTCAAAAT
CBID_METC4      --------------------------------------MNSETGALRRGWTTGTCASAAA
CBID_BRUME      -----------------------------MNDETTPANKNPEKAELRCGWTTGACATAAT
CBID_BRUSU      -----------------------------MNDETTPANKNPEKAELRCGWTTGACATAAT
CBID_RHORT      ------------------------------------MDEADEGRSLRRGWTTGACATAAL
CBID_PSEPK      ----------------------------------MREETREQPAPLRSGLTTGSCATATS
CBID_PSESM      ----------------------------------MREETAEQPAPLRSGLTTGSCATATS
CBID_PSEAE      ----------------------------------MREETPEQPAPLRSGYTTGSCATATS
CBID_GEOSL      ----------------------------------------MSGRELRHGYTTGACAAAAA
CBID_THET2      --------------------------------MSHPYPPPRDKKGSRIGFTTGANAAAAA
CBID_LEPIC      ----------------------------------------MTGKKLKEGFTTGACSAAAA
CBID_LEPIN      ----------------------------------------MTGKKLKEGFTTGACSAAAA
CBID_BACME      -----------------------------------MKEVPKEPKKLREGYTTGACATAAT
CBID_DESVH      -----------------MESRADHAVPADEGHGATEPPRGRDRAALREGFTTGTAMTAGA
CBID_CHRVO      ----------------------------MNPVRQPYDLAAPAPNGMRRGRTTGSCATAAV
CBID_RALSO      ---------------------------MQPSARRPFDLATPAPNGLRRGRTTGTCATAAV
CBID_CLOAB      ---------------------------------MLEMYVNCDGKKLRCGYTTGSCAAGAA
CBID_CLOTE      ---------------------------------MLDMYVMVDGKKLRCGYTTGSCATAAA
CBID_CLOPE      ---------------------------------MFDMYIESGGKKLRCGYTTGSCAAAAA
CBID_TREDE      --------------------------------MKLDLYIDKDGQKLRCGYTTGSCAAAAA
CBID_LISIN      ----------------------------------MEDFIYYNGKKYRKGYTTGTCAAAAA
CBID_LISMO      ----------------------------------MEDFIYYNGKKYRKGYTTGTCAAAAA
CBID_SALTI      -----------------------------MSELSFDAPVWRHGKALRKGYTTGSCATAAA
CBID_SALTY      -----------------------------MSELSFDAPVWHHGKALRKGYTTGSCATAAA
CBID_PHOLL      -----------------------------MSDTMQLDSIWHNGKQYRKGYTTGSCATAAA
CBID_FUSNN      ----------------------------------------MEEKELKNGYTTGTCATAAV
CBID_METJA      -------------------------------------MIYDFRKKSKFGYTTGSCAAAGA
CBID_METMP      ------------------------------------MGKIDFRLEKTFGYTTGACAAAGA
CBID_METTH      -----------------------------------------MNDERVFGITTGTAATAAA
CBID_SACS2      ---------------------------------------MIINSLKRFGITTGAAASAAA
CBID_SULTO      ----------------------------------------MLSTLKRFGITTGATAAASA
CBID_PYRAE      -----------------------------------------MNPFLKYGITTGLAAAAAA
CBID_THEAC      ---------------------------------MTQS-----NPFQQYGITSGLAAAAAA
CBID_THEVO      --------------------------------MMYASDGSGVNPFQQYGITTGLTAAAAA
CBID_METAC      ---MIDPVNNFKIPEEWIARSGLPREELEKNVASGMIVILSDGSVLKRGYTTGTTASAAA
CBID_METMA      ---MIDPVNNFKIPEEWIALTGLPREELEKNVASGMVVVLSDGSVLKRGYTTGTTASAAA
CBID_ARCFU      --MLIDPIELYRYPEKWIK-----DRDAEKKVRSGLYILTEDG-YLRRGITTGTTASAAA
CBID_METKA      MNDLLDPIRGIPVDLELVRRELDVDLPTARYLVRTGLITTDGARVLRRGPTTGTCATAAA
                                                                         .  

CBID_NOSS1      IAALHWLRQRQSIQVALVDLIEPAQ-----IAEVPIEQVAGLSA----NMALAITRSDPG
CBID_SYNY3      IAAVETLLTSNCPDSVTLELLEPAR-----TAEIAIEQGALLGH----HRALAITRSEPG
CBID_THEEB      VAALRCLTEGACPQQVTLALLRPNR-----CETLPIAQGACLDA----QQALAITYSEPS
CBID_GLOVI      RAALLHLIEKVPCASVQLDLL--GE-----QAAIPIEQVARLDA----ETALGVTRSDPG
CBID_PROMM      RAATEALLGRPFSASQLLELPDRDE-----PLAVSVTSAAVLAGG---EQALAISHCDPG
CBID_SYNPX      RAALRALLGHPFEPNQQVVQPDGGE-----PLLVPVRSAARLSD----DQALAISRCDPG
CBID_PROMA      KAAVKVLIGESWQSHEVIELLNNEE-----SIVVPIRSASILDNG---EKALGITNCDPG
CBID_PROMP      KSAIKKLIGLPFEDYELIKIPKEKN-----LIKIKVHSAGLINEE---SQALGISFVDSG
CBID_AGRFC      KAACAALLTGEFPYPVDVELPSGA------RPAFSLATEEKGEN-----FARAGVVKDAG
CBID_METC4      RAAFEALLGIEPEDPVPVTLPSGA------RPTFALARLDRGSG-----FVRAGIVKDAG
CBID_BRUME      KAALTALITGEFPDPVGIILPKGE------VPYFQLAYEGLGEG-----YAMAGIVKDAG
CBID_BRUSU      KAALTALITGEFPDPVGIILPKGE------VPYFQLAYEGLGEG-----YAMAGIVKDAG
CBID_RHORT      KAALEALVDRPFPDPVALTLPRGE------RPAFALATRETGPG-----WARAGVIKDAG
CBID_PSEPK      LAAAKLLLTGQRNDAVDITLPKGK------VVQMRLEFCRLIGE-----CAEAGTLKDAG
CBID_PSESM      LAAARLLLSGQISDAVEIVLPKGK------QVQMRLEFCRRVDN-----FAEAGTLKDAG
CBID_PSEAE      LAAARLLLGGTISDAVQIVLPKGQ------QVLMRLEFCRAWEN-----GAEAGTLKDAG
CBID_GEOSL      AGAARMLRRQELADEAEIVLPRGE------RVAFRLHGQEFTET-----WATCHVVKDAG
CBID_THET2      KAAALALLG-EAPEVVDIWLPAGW------RQPFRVFRLERKGD-----GVLVGMIKDAG
CBID_LEPIC      KAATRLLLKGKPILEIETTLPNKR------QVLFTVKRCQLEGE-----VATCSVVKDAG
CBID_LEPIN      KAATRLLLKGKPILEIETTLPNKR------QVLFTVKRCQLEGE-----IATCSVVKDAG
CBID_BACME      RAALLTLISGEVQDESTIYLPVGR------FATFHLEECEYRTS-----SAVASIIKDAG
CBID_DESVH      VAALRHVFGLPFLPVLSVPLPPQEGVGVPGRLGVPVAEVLTEGD-----GATGVVIKDGG
CBID_CHRVO      KAALMLLLDGVDADEVFISLPDPD----FYLAVPVESVAWLDEN-----TVRAEVLKYAG
CBID_RALSO      KAALLRLVRGETVDAVEVSLPDPD----YCLEVPIARIEPLASG-----AVRADVLKYAG
CBID_CLOAB      KAATYMLYNEEILDLIKIDTPKGI------ELMLPIENIKKGDG-----FVECSIIKDGG
CBID_CLOTE      KAATIMLYNKEKLKTIDIDTPKGV------RLHLDIEKINIGEN-----YVECCIIKDGG
CBID_CLOPE      KAATYMLFNKKDISVIEIDTPKNI------KLNLEIQDIQVEKN-----SISCSIVKDGG
CBID_TREDE      KAAALILGG-ETMTSVKIDTPAGL------VLDLPVEHCRSYKNKDGTAIGEAAVQKDAG
CBID_LISIN      KACVEMIENQEEVSAVKVTTTGGT------ILEIPVAYQQFSEK-----KATAAVQKDGG
CBID_LISMO      KACVEMILTQEEVSAVQVTTTGGT------ILEIPVAYQKFSKD-----KATAAVQKDGG
CBID_SALTI      KVAELMVLRQHLIHQVSIVTPSGV------TLCLNVESPHIEGQ-----QAIAAIRKDGG
CBID_SALTY      KVAALMVLRQHLIHQVSIVTPSGV------TLCLNVESPHIEGQ-----QAIAAIRKDGG
CBID_PHOLL      KVAALMVLRQQVIDHVSIVTPSGV------TLRLNVEQPLIEGQ-----QATAAIRKDGG
CBID_FUSNN      KVALEALIYGKKATEVDITTLNYT------NLKIPVQKLRVRNN-----FASCAIQKYAG
CBID_METJA      YSALYYLKFGKKLSYVEIENLNGD------KLIIPIEKIEK-CGNKA----KAVVIKDAG
CBID_METMP      FSALYFLKNNEKLRFVEILNLKGD------SLIIPIKNIEK-QKNTA----ISTVEKFSG
CBID_METTH      LASLLCLK-GCEASKVRVRTPSG-------ILEVDVEYVERISGDTA----RACVIKRPY
CBID_SACS2      KAAVIGLLNKEKRSTVVIPTPIGL------RLEIPVEKVEIDSE-----ISCAEVKKFSG
CBID_SULTO      KASVIYLFRNETPKSVTIPTPIGL------RLEIPVDDYERRGE-----EYCATVTKFSG
CBID_PYRAE      KAAALYSKGI-VPKSVTVPTPIGL------RVEVFVERVFQRGE-----IYCAEVRKFSG
CBID_THEAC      KASVLAAMGT-ISDYVGVPTPIGL------RIEVKVEMMKQIDAR----SGIAAVRKFSG
CBID_THEVO      KACTLTVLKG-VQNRVVVPTPIGI------RIEVKVVESVRIDES----SGYASAEKFSG
CBID_METAC      KAAVLSLKKT--VDSVSVPTPVGL--------RAYLEVSKSSPG------RAVVKKIPND
CBID_METMA      KAAVLSLKKK--IDSVSVPTPVGL--------RAHLEVSESSPG------RAVVKKILND
CBID_ARCFU      VAAIASLKEK--VEKVKVSTPAGV--------DVEVEV-EAEKG------FARVRKFSGD
CBID_METKA      KAAAIRLLEGRTVRTVRVRLPVGT------VIGVRISRVGGDPS------EARVRKPGSD
                  .                                                         

CBID_NOSS1      DNLDLTKNTPIWAVVEWGK----------TGGEQVTIKGGEGIGKQVN------ADNQAA
CBID_SYNY3      NNLDLTRHTPVWAEVEFTP----------GEG-KLIIQGGEGIGKQLD------REGQAA
CBID_THEEB      DALDLTRYTPIWAWVRWQDP---------VTAPKIQIEGGFGVGRDR-------ATGKAA
CBID_GLOVI      DNLDLTRHTPVWAWVHLEV----------GTGEVLRLEAGEGLGRTA--------AGEAA
CBID_PROMM      SGLDLTRGLEIWVCVQWQELVDDELN--VHSEAWLNLLAGKGVGTLG-------SGGEAC
CBID_SYNPX      PGLDLTRDLEIWVRVAWTPSADQG----------LVLMPGEGVGRIG-------AGGDAC
CBID_PROMA      ECLDLTRGLEIWVCLRYIENQQIISSDGLELEPWLKIIPGYGVGKFD-------LTNDIS
CBID_PROMP      LDLDLTQNLEIWTIASLEKTYKTSNR----PLDRINIIPGYGVGIDQ-------KTSKIC
CBID_AGRFC      DDPDVTHGALIESTVRRGEPGSG-----------ITFRAGKGVGIITRPGLPLPP-GEPA
CBID_METC4      DDPDVTHGALVLATLRFGAPATG-----------IVFRAGPGVGIVTKPGLPLPP-GEPA
CBID_BRUME      DDPDVTHGATIISTVYPAPPGTG-----------IIFRAGEGVGTVTREGLAIPPPGEAA
CBID_BRUSU      DDPDVTHGATIISTVYPAPPGTG-----------IIFRAGEGVGTVTREGLAIPP-GEAA
CBID_RHORT      DDPDVTHGALIEATARLLPKGSG-----------LIFRAGSGVGTVTKPGLPLAV-GEPA
CBID_PSEPK      DDPDVTHGALVYSQVRLLV-EPG-----------IGFVAGSGVGTVTRPGLVLAV-GEPA
CBID_PSESM      DDPDVTHGALVFARVRQEA-APG-----------VRFVAGAGVGSVTRPGLVLAV-GEPA
CBID_PSEAE      DDPDVTHGALVFARVRLSA-EPG-----------VRFHAGPGVGTVTRPGLTLAV-GEPA
CBID_GEOSL      DDPDVTNGAEIHATVRREALNRPGART------MVFVTGGRGVGTITKPGLAVPV-GEPA
CBID_THET2      DDPDVTHGAEIQAFVRFASEDR--------------LEGGEGVGVVTKPGLGVPV-GEPA
CBID_LEPIC      DDPDCTHGAELTARVRLTKENE------------IKLKGGDGVAVVTKAGLGLEI-GQSA
CBID_LEPIN      DDPDCTHGAELTARVRLTKENE------------IKLKGGDGVAVVTKAGLGLEI-GQSA
CBID_BACME      DDPDATHGALIISEVSWCNGVD------------IIIDGGVGVGRVTKPGLPVPV-GEAA
CBID_DESVH      DDPDATHGARIETHVRLLPDATA----------TLLLEGGTGVGRVTLPGLPVAV-GEVA
CBID_CHRVO      DDPDNTDGATIFAEVKLNSSGAL------------RFLAAPGVGMVTQPGLRIPP-GEPA
CBID_RALSO      DDPDNTDGATIFAEVSVNHAGEV------------RFMAAPGVGTVTQPGLRVPP-GEPA
CBID_CLOAB      DDPDITNGIEIWARAEVKKE------------GYTLK-GGIGVGIVKSEGLYVEK-GDYA
CBID_CLOTE      DDPDATHGMEIWARAEKKDD------------GYTLK-GGKGVGVVMGEGLYVAK-GEPA
CBID_CLOPE      DDIDATSGLEIFAKAEEVEE------------GFELC-GGEGVGVVTKEGLFVEK-GQPA
CBID_TREDE      DDPDSTDGIYIYARVSYRND------------GKVLIDGGEGIGRITKKGLFGEV-GEAA
CBID_LISIN      DDIDATHGMWIFVDVELTDS------------PEVTLDGGVGIGRATQKGISVEV-GEAA
CBID_LISMO      DDIDATHGMWIFVDIDLTDN------------AEVVLDGGVGIGRATQKGISVAV-GEAA
CBID_SALTI      DDVDATHGMLIFARVTLNDS------------GEITLTGGEGIGTVTRKGVGLPL-GSAA
CBID_SALTY      DDVDATHGMLIFARVTLNDS------------GEITLTGGEGIGTVTRKGIGLPL-GSAA
CBID_PHOLL      DDVDATHGMLIFARVTLCDH------------GEIHLRGGEGVGTVTRKGVGLPV-GSSA
CBID_FUSNN      DDPDVTNGISICAKVQLVKELPKVDRG--AYYDNCVIIGGRGVGFVTKKGLQIAV-GKSA
CBID_METJA      GDIDITNGIEIITEVELKKGKKD-----------VIIKGGEGVGIVTKNGLQVKK-GEPA
CBID_METMP      EDIDITNGMDIKIEVTLEKLDNNSSKS-----SSVKIIGGDGVGIVTKSGLQVNP-GEYA
CBID_METTH      PDPDVTVNLEIISTVQITGTPEI------------MIRGGEGVGIVTKPGLQVPP-GEAA
CBID_SACS2      DNPDILDGLVIRCCAKLN---ENNE---------IVIIGERGVGKVTRSGLKATM-GEMA
CBID_SULTO      DNPDVLNGLKIVSCSTKC---DSG----------IFIEGGNGIGVVTKPGLKVEV-GEKA
CBID_PYRAE      DNPDVLNGVIIRACVRPL---NNG----------VVIKGGEGVGIVTRPGLPVPP-GEHA
CBID_THEAC      DNPDTLNGALFESRAVIR---DDG---------LINIFAGEGIGVAVSDGLPVRR-GDPA
CBID_THEVO      DNPDQLNGITIRCHCKVVKKQENGRS-------KITISGNAGIGVVEKDGLGIRP-GEKA
CBID_METAC      HESDVTRGLEFVGEAREAEG--------------ISILGGKGIGIVKRDGLQVPK-GKPA
CBID_METMA      HESDITRGLEFVGEAREAEG--------------IHVLGGKGIGVVRRDGLQVPK-GKPA
CBID_ARCFU      HEFDVTNGIIFEAEVCETSG--------------IFFG----------RGVGVKA-GEKA
CBID_METKA      DHVDVTTGVTIAARVEETGSEG------------VEIRAGRGVGETPS--------GKPA
                   *      .                                             .. .

CBID_NOSS1      IYSYAQRLLQANLTRLLAPE---ESIIVTIILPEGRSLAVRTSNSAFGVVEGLSLLGTTG
CBID_SYNY3      IYSYAQRLLRHHLQPYISGD---QTLMVSLILPLGRTLATRTSNAAFGVVEGLSLLGTSG
CBID_THEEB      IYRYARLLLTTNLLLYCPKE---RAIAVTIVLPQGRDLAERTSNAAFGIVEGLSLLGTTG
CBID_GLOVI      IYRYARQLMEANVAPLVPTG---RTATVRFILPEGRALALRTSNAAFGILEGLALLGTSG
CBID_PROMM      VSRFARELLSRNLYPLVPSG---RGLQLEVVLPRGRDLAARTSNAAFGVVDGLALIGTQA
CBID_SYNPX      LSTYARQLLECTLLPLLPPG---QGLEVEPVLPRGRSLAERTSNAAFGVVDGLALIGTQA
CBID_PROMA      ISEFARQLLIVNLKPYRKEG---YSLNLEIIFPSGQELAEKTSNHAFGVVDGLALIGTQA
CBID_PROMP      ISDFAQKLLVENLLNIIPEG---YTLNLEIVFPNGKFLAERTSNKSFGIVEGLSIIGTSA
CBID_AGRFC      INPVPRRMIETAIREVA---GENADFEVEISVRDGEKLAEKTLNGRLGILGGISILGTTG
CBID_METC4      INAMPRRMIRTALTEVAEANGVTCDLVVEVGIEDGERIAERTMNRRLGIIGGLSILGTTG
CBID_BRUME      INPVPRRMMTEICEAICAEYGLPADLVITISVPGGEEIAQKTWNPRLGIIGGISILGTTG
CBID_BRUSU      INPVPRRMMTEICEAICAEYGLPADLVITISVPGGEEIAQKTWNPRLGIIGGISILGTTG
CBID_RHORT      INPVPRAMMTEVATAAGL-----ADLEISIAVAQGASIALRTWNPRLGILGGLSILGTTG
CBID_PSEPK      INPVPRRMISEHLQHLADACGYLGGFEVTVNVQGGEQLALKTMNPRLGILGGLSILGTSG
CBID_PSESM      INPVPRRMMTEHLLRLAEELGYSGGFEVTIGVEGGEALALKTMNPRLGILGGLSILGTSG
CBID_PSEAE      INPVPRQMIERHLAQLAAERGYAGGFEVAIGVEGGAELALKTMNPRLGILGGLSILGTSG
CBID_GEOSL      INPVPMRMITEAVKAEFSVVCLPQILTVTVSIPNGEELAKKTLNARLGIVGGLSILGTTG
CBID_THET2      INPVPRRMIWEAVRE-----VTERPLAVTIAIPGGEELAKKTLNPRLGILGGLSVLGTTG
CBID_LEPIC      INPIPRKNIKEMILEELQGSS-FNGAEVEISVPGGQEMAKKTMNERLGLIGGISILGTTG
CBID_LEPIN      INPIPRKNIKEMILEELQGSS-FNGAEVEISVPGGQEMAKKTMNERLGLIGGISILGTTG
CBID_BACME      INPVPRKMLKETAQQLLAEYNIQKGVKVVISVPEGEEMAKKTLNARLGILGGISILGTRG
CBID_DESVH      VNPGPRAQLEFAVREVCAAQGYGGGVRVTVRVPEGEAIARHTLNGRLGIVGGISILGTRG
CBID_CHRVO      INPVPRQMMRMAVDEVLAG-RPDPGIDLAIGCVDGDKIAKRTFNPMLGIVGGISILGTSG
CBID_RALSO      INPVPRQMMRMAVDEVLAG-GANPGFDLAIGCVDGERIARRTFNPMLGIVGGISILGTSG
CBID_CLOAB      INPVPRLMIEKEVKKVLPKD---NGVLITVFVPKGEEIAKKTFNPRLNIVGGISILGTTG
CBID_CLOTE      INPVPRTMIESEVKSVLPKD---RGVEITIFAPEGKKVAKKTFNPRLNIIGGISILGTSG
CBID_CLOPE      INPVPREMIKKEVLSVLPKD---KGVRITIFVPRGREIAKKTFNPRLGIVNGISILGTTG
CBID_TREDE      INPVPRQMIEKEVLKVSKK-----GFNVEIFSPQGAEIGKKTFNKNIGVEGGISIIGTKG
CBID_LISIN      INPAPRKNILATVRESLGEN---RGATILVYAPEGEERAKRTMNSNLGIIGGISILGTTG
CBID_LISMO      INPAPRKNILATVRESLGEN---RGAKILVYAPEGEERAKRTMNSNLGIIGGISILGTTG
CBID_SALTI      INRTPRHTIESAVREAIGPA---RGADVEIFAPEGEVRAQKTYNSRLGILGGISIIGTTG
CBID_SALTY      INRTPRHTIESAVREAIGPA---RGADVEIFAPEGEARAQKTYNSRLGILGGISIIGTTG
CBID_PHOLL      INRTPRQTIEAAVREAIGPL---RGAEVEIFAPEGEERAKKTYNGRLGILGGISIIGTTG
CBID_FUSNN      INPGPQKMITSVVNEILDGSD--EKVIITIYVPEGRAKALKTYNPKMGVIGGISVLGTTG
CBID_METJA      INPKPREMIRNNLLKLLNDD---EVVEVTISIPKGKELAKKTLNPKLGIVGGLSILGTTG
CBID_METMP      INPKPREMIENNLKSLLEND---ECVTAKISVPNGDEIAKKTLNPKLGIIGGISILGTTG
CBID_METTH      INPVPRRMIEENLREHLRDD---EGAVVTVSVPGGERIASRTMNPRLGIIGGISILGTTG
CBID_SACS2      ISPTVREMIINAIREVTD-----KGIQITIEVPNGETIAEKTLNKMVGIVGGISILGTTG
CBID_SULTO      INPIARQMIIDAINEVTT-----DGVKVRIEVPDGEKIAELTMNKDVGVINGISILGTTG
CBID_PYRAE      INPVPRRMIEEAVREVL------EGAEVLVEVPDGKLLAEKTMNPRLGIVGGISILGTTG
CBID_THEAC      INPVARMMIENAVREVSGS----AGFDVYISVPGGEDLARDTMNPRVGISGGISILGTTG
CBID_THEVO      ISQGARKMIEDAVREAAGG----YDVELSISVPNGEEFAKLTMNEKVGVFGGISVLGTTG
CBID_METAC      INPKPMEQIRAAVQEAVEELG-LKGAEVTILIPEGERIGKETLNSRIGVEGGISVLGSTG
CBID_METMA      INPKPMEQIRAAVKEAVEELG-LQGAEVTISIPEGERIGKETLNSRIGVEGGISVLGSTG
CBID_ARCFU      VSRSAKLQILENFIKASREFN-FSGG-VRISVPDGEEVAKKTGNEKVGIKGGISILGTTG
CBID_METKA      ISEAVREQIVDNLRYLVDSYG--VGLRVTIEVPDGEEIARKTLAHRHGIEGGISILGTKG
                :       :                         *   .  *     .:  *::::*: .

CBID_NOSS1      ISQPLSSPDQLDAFRSELQHKASLYE---SLVFCIGENG----LDLARKIGINAEKLVKT
CBID_SYNY3      IAQPLSAPEQLAEFQQHLTSAAQQHQ---CLVFCLGENG----LDLARQWGVPLDQMVKT
CBID_THEEB      IAQPLTAPEQLDRYREDLAEKAAQSS---TLVFCIGENG----LQVAQQLQIPPSRCVKT
CBID_GLOVI      LSQPLSAADHLESFRAALRERAERER---RLVFCIGAGG----LQAAGRLGLDQGATVQT
CBID_PROMM      DVQVSASPDQLQQTIEQLRRQSAASDFCGAMTLVIGENG----LDLARQLGLAAQPLLKI
CBID_SYNPX      EVQQSAAPEQLEQVLRELRALVADPGFGGSVALVIGENG----LDLARRAGLS--PLLKV
CBID_PROMA      DVQESASPKKLQSTIHALRSRCAESSFTGSLIFVIGENG----LDLALQYGIDSSKIIKT
CBID_PROMP      ETFASASPDQLQNAKAQLK-QIIANKVCDTIIFVIGENG----LNLATSSNIKF-PIIKV
CBID_AGRFC      VVIPFSCSAWIHSIWRGIDVARATGC--THVLGATGNTSEKAGQAVYD---LPETALIDM
CBID_METC4      VVVPYSCAAWIASIHRGIDVARAEGL--THLAGATGATSEAAIRNLYG---LPEQALIDM
CBID_BRUME      VVHPFSCSAWIHSIHRGIDVARAAGQ--KHVLGATGSTSEDAAQALYN---LPDFAILDM
CBID_BRUSU      VVHPFSCSAWIHSIHRGIDVARAAGQ--KHVLGATGSTSEDAAQALYN---LPDFAILDM
CBID_RHORT      VVVPYSCSAWIHSIRRGVDVARATGR--AHVVGTTGATSERAALDHLG---LDAEAVIDM
CBID_PSEPK      IVRPFSCAAYIASIHQGIDVAHTNGY--THIAACTGNASEDTMRRVYG---LPEIALIEM
CBID_PSESM      IVRPFSCAAYIASIHQGIDVATTNGY--RHIAACTGNASEDTMRRVYN---IPDIALIEM
CBID_PSEAE      IVRPFSCSAYIASIHQGIDVARANGV--RHIAACTGNASEDAMRRRYA---LPEIALIEM
CBID_GEOSL      IVRPISAKAWTDTLDAAIDVALACGC--RTLVLSTGRTSELVVQGALAGEHLREEACVMM
CBID_THET2      VVKPYSTSAFRMSVVQAVGVARANGL--LEIAATTGGKSERFAQRLLP--HLPEMAFIEM
CBID_LEPIC      IVKPYSTAAFKASVIQAIQMAKEYGI--DTIVLTTGGKSEKFAMDLLP--NLNELSFIQV
CBID_LEPIN      IVKPYSTAAFKASVIQAIQMAKEYGI--DTIVLTTGGKSEKFAMDLLP--NLNELSFIQV
CBID_BACME      IVVPFSTAAYKASIVQAISVAKASNC--EHVVITTGGRSEKYGMKQFP--ELPEEAFIQM
CBID_DESVH      TVRPYSHEAWKAAIAQELSVARALGH--RRACLSTGRRSETLLMRRYP--DLPEQAFVQA
CBID_CHRVO      IVEPMSQAAWIASIEVYVRVALGELP--PAIAFTPGKIGRGYAADTLG---LEKKQVVQI
CBID_RALSO      IVEPMSLAAWMASIEVYVRVALGDAP--EAIAFTPGKIGRAYAAHPLA---LSKKQVVQI
CBID_CLOAB      IVVPMSEEALQQSIKLEMNQKIKSGI--KNFTFLFGNMGEDKAKEMG---IDPKG-FVIM
CBID_CLOTE      IVMPMSEESLKQSVELEIRQKIANGH--KDLILVFGNIGERKGMEMG---LDQSK-MVSI
CBID_CLOPE      IVYPMSEEALKESIRIEIRQKAVNN---KDLVFVFGNMGERFLRERG---YKKDN-IVVI
CBID_TREDE      IVYPMSEDAIKKTIYLEIDGILQNSEK-KEILLVPGNYGEGLKEKLNT--IIDLP-TVKI
CBID_LISIN      IVTPMSDEGWKKSLSMELEMKRNQGL--DQIILVPGNYGDDFVQNTLG--FASDN-IVSM
CBID_LISMO      IVTPMSDEGWKKSLSMELEMKRNQGL--DQIILVPGNYGDDFVQNTLG--FSSGN-IVSM
CBID_SALTI      IVTPMSEESWKRSLSLELEIKRASGL--TRVILVPGNHGERFVREQMG--VDTQA-VVTM
CBID_SALTY      IVTPMSEESWKRSLSLELEIKRASGL--TRVILVPGNHGERFVREQMG--VDTQA-VVTM
CBID_PHOLL      IVTPMSEESWKRSLAIELEMKRSAGA--EKVILVPGNHGERFVREQLG--LDGQL-VVTM
CBID_FUSNN      IVKAMSEDALKKSMFAELKVMREDKNR-DWIIFAFGNYGERHCQKIG---LDTEQ-LIII
CBID_METJA      IVRPMSNEAYMNSLAPQIDVALANGY--KRLIFVPGNIGTKYAKQLLN--ANDDE-IIEV
CBID_METMP      IVRPMSNDAYKESLAPQIDVALAYNF--ENLIFVPGNIGTKHAKILLN--AKEDQ-IIEV
CBID_METTH      IARPMSTEAYRESLACQIDIATARGF--RELVFVPGNIGERFAREYFE--SIEDERIIQM
CBID_SACS2      IETPVSDDDYLEHIRCELNVIRQS--Y-DYVVIAPGNSAAKYAAELF---DSNC--IIKV
CBID_SULTO      IEYPISDDEYLEHIKSEICVVKALG-K-KKLILAPGNTSFEFARKRY---GDN---VVKI
CBID_PYRAE      IEAPVSADEFLGHIEAELSALRER--R-DIAILAQGNTSYKAAQAVF---GDV---VVKI
CBID_THEAC      IEEPVSGPDYEAHIEYLLQTGRCV--S-TVAVMCPGNTAMRFAESYL---RLHPASFILT
CBID_THEVO      IEEPVSTEEYELHLKYIVAAGRCV--S-KIIVLCPGNTALKFAKKYF---ALPDKAFVLI
CBID_METAC      FVEPWND--------HLGEMRGDLIRCTDKVVLTTGRIGMKYSHMLFP---------DYT
CBID_METMA      FVEPWND--------HLGETRGDLIRCTDKVVLTTGRIGMRYSHMLFP---------EYT
CBID_ARCFU      FVEPWCK--------KLVETKLKIAMQYHRIAITTGRKAWLYARKKFP---------EYQ
CBID_METKA      LVDPNSEEAIEGSIRSDLRYVERVPCL--VTGYRTMDRARRLGIPSRDIVNCHGRYDLAL
                                                      .                     

CBID_NOSS1      ANWLGPMLVEADALG------VKEILLFGYHGKLMKLAGGIFHTHHHLADGRREVLATHC
CBID_SYNY3      ANWLGSLFVAAAAVG------VQEILLLGYHGKLIKLAGGIFHTHHHLADGRLEILTAQA
CBID_THEEB      ANWLGPMLVAAAHYE------VQQLLLLGYHGKLIKLAAGIFHTHHHLADARQEILTAFC
CBID_GLOVI      GNWIGALLVEAGMLG------IESVLLLGYQGKLVKLAAGIFNTSSHVADGRLETIAAGA
CBID_PROMM      GNWLGPVIVAAAEAG------VEQLLLLGYHGKLVKLAGGIFHTHHHLADGRLEVLAAMA
CBID_SYNPX      GNWLGPVLVAAAEAG------VKDLLLLGYHGKLIKLAGGIFHTHHHLADGRLEVLTALG
CBID_PROMA      GNWLGPLLVAAAQEK------VQQLLIFGYHGKLIKLAGGVFHTHHHLADNRLETLIAFA
CBID_PROMP      GNWIGPLLVDAAIQK------IKTVILFGYHGKLIKLAGGIFHTHNHLADARIEILVYLA
CBID_AGRFC      GDFIGGMLKYLRSHP------VERVTIAGGVAKMTKLAQGMLDVHSKKGLADLEALAVLA
CBID_METC4      GDFVGGMLKYIRGHP------VARVTIAGGFAKMTKLAQGRLDLHSKREAIDFRWLAELY
CBID_BRUME      GDFAGGVLKYLREHP------IDRLTIAGGFAKLTKLAQGALDLHSSRSQVDKGFLWQIA
CBID_BRUSU      GDFAGGVLKYLREHP------IDRLTIAGGFAKLTKLAQGALDLHSSRSQVDKGFLWQIA
CBID_RHORT      GDFVGGLLKYLRDHP------IPHLTIAGGFAKLSKLADGALDLHSKRAQVDIPALARRL
CBID_PSEPK      GDFVGAVLKHLRKVP------VPRLTLCGGFGKISKLAAGHMDLHSRHSSIDLPQLAGWA
CBID_PSESM      GDFVGAVLKHLRKVP------VDKLSLCGGFGKISKLAAGHMDLHSRHSSIDLPQLALWA
CBID_PSEAE      GDFAGAVLKHLRRAP------VEKLSLCGGFGKISKLAGGHLDLHSRHSSIDLPQLAGWA
CBID_GEOSL      GDHVGYALRACARKG------AEQAVLAGQFAKLLKIACGHEQTHVSSSELDLRLLAEWI
CBID_THET2      GDFVGDVLRAARKVG------VEVVRVVGMIGKISKMADGKTMTHAAGGEVNLSLLLSLL
CBID_LEPIC      GDFIGTGIKTSVKES------IRHTIIVGMIGKLSKMADGVMMTHRGGSSVNTTMLSTIA
CBID_LEPIN      GDFIGTGIKTSVKES------IRHTIIVGMIGKLSKMADGVMMTHRGGSSVNTTMLSTIA
CBID_BACME      GDFVGFTLKQCKKQG------MKKVSLVGMMGKFSKVAQGVMMVHSKSAPIDFNFLAKAA
CBID_DESVH      ADFVAFALGAAAERG------FEALAWGCFFGKLVKLAQGLPHTHARTAPLDLPLLAQWC
CBID_CHRVO      ANFVGDSLDFAESVLIEQGRILDTLWVLGHPGKIAKLLDGVWDTHSGKSGMAMDAVAGVA
CBID_RALSO      ANFIGASLDYAQTALEEDRHRLGTLWVLGHPGKLAKVLDGVWDTHSSKSGMAMGSVAAVA
CBID_CLOAB      SNYVGFALNCCRENN------IKKILMVGHIGKMCKIAAGCFNTHSRVCGVRLEILALEL
CBID_CLOTE      SNYVGFALDCCRGNG------VKDITLVGHIGKMCKIAAGCFNTHSRVADVRLEVLALEL
CBID_CLOPE      SNYVGFSIECALAQG------IKDLTIVGHIGKLSKIAFGCFNTHSRVSDVRLEVIALEL
CBID_TREDE      SNYIGDSLSYAYSKG------FKTMTLLGHIGKFAKLSIGIFNTHNRTADTRMEAFVYYL
CBID_LISIN      SNFVGYMLKETQRLA------FKKVLMVGHFGKLVKVSAGIFTTYSKDADARAEILVANL
CBID_LISMO      SNFVGYMLKETQRLA------FKKVLMVGHFGKLVKVSAGIFTTYSKDADARAEILVANL
CBID_SALTI      SNFVGYMIEEAVRLG------FCQIVLVGHPGKLIKIAAGIFHTHSHIADARMETLVAHL
CBID_SALTY      SNFVGYMIEEAVRLG------FCQIVLVGHPGKLIKIAAGIFHTHSHIADARMETLVAHL
CBID_PHOLL      SNFVGYMLQEAVRLG------FRHIMLVGHPGKLVKVAAGIFHTHSHIADGRMETLIAYL
CBID_FUSNN      SNFVGFMIEAAVKLE------FKKIIMLGHIAKAIKVAGGIFNTHSRVADGRMETMAACA
CBID_METJA      SNFWGFMLDKAKEKG------VEEILIFGHAGKIIKLAGGIYNTHSKVADCRNEILAAYS
CBID_METMP      SNFWDYMLDKAKEKG------VKDITVFGHAGKIVKLAGGIFDTHSRVADARNEILCAYT
CBID_METTH      ANFPGYMLEEADGRG------VERIILMGHAGKLIKLSAGIFQTRSSDADARREIMAAHA
CBID_SACS2      GDRIGDSIKLASNL-------FKKVILAGLPAKLLKVYAGIFNTHYSQGDARLESLTHAS
CBID_SULTO      GDRVGDSIRLAIEQG------FTHIVLVSLPGKITKVASGLMNTHSKYGDARIETLTHAA
CBID_PYRAE      GDMVGYAVEKAAALG------YKAAYLFTMPGKLAKLALGAYNTHSAQCDGRVEAVLYAL
CBID_THEAC      GDRIGSAIEMAIEKG------YREIVVFGLPGKLVKMAAGVMNTHSRIADARFETIAAYA
CBID_THEVO      GDKVGAAVSASIESA------YDHVVIFGLPGKLVKIAAGIYNTHSKVADGRMETLAAVA
CBID_METAC      VVMVGSRISEGLDNAS------GDIIICGLPGLVLKWGNPKMLEGSGYATV------VEM
CBID_METMA      VVMVGSRISEGLDYAS------GDIIICGLPGLVLKWGNPEMLEGSGYATV------VEM
CBID_ARCFU      PFVFGVHIDEALKHP-------GEKIIVGFPGLLKIWAGS--------------------
CBID_METKA      EAVKTGVPADGEVKR------FDAVLIFGMPGKLLKLAAGAYNTHAKVADARRESLVTRL
                                               .                            

CBID_NOSS1      ALAGLSKQDIEIVFHSPTAEAALKHLKALDISTGNDWVNQVYSAIAETIDSRCQEYMQSH
CBID_SYNY3      VQAGLPYPLVQELGQAPTTEAGLKLLRHWQTEQNCPWVSKIYQAMADTVDRRSEEYVYKV
CBID_THEEB      ALAGLDLEMLHQVWQAPTVEAALKFLERMVPHV----LPEILSHIAHRIDQRATAYIHAH
CBID_GLOVI      VAAGADIETVRTVLEAPTADAACALLAAAGWAE------KIYAALAERVSGRSVEYVRKY
CBID_PROMM      VREGLPLDLIRQLGQADSMEAALKMLEAQDPELV----RKLWYRLAVTVEHRSAAYLARY
CBID_SYNPX      LDVGLSLEELRHLRAAASVEDAFQRL---NPETA----MDLGRLLAATVEQRSQAYIARY
CBID_PROMA      VKERIPLSLIKEFEEAVSIEAALSILENKDISTA----KKLWKRLAVEIEKRSIDYVKRY
CBID_PROMP      VKEEVPLEIIQKLSQSNTVEDALLVLESFSLSMA----DKLWNKLSDTIEKRSTEYINRY
CBID_AGRFC      AEAGGDDNLAVAIRQANMVAHAFQLA--E--------SVGIDLGAVVAEKAWVTAAAALK
CBID_METC4      CSIGGKAESGMSVRTANTALEVLQMA--Q--------AEHVPIAPAIARSACRVAAGALA
CBID_BRUME      ERAGAPADMKERILLANTAMEVLELT--Q--------SIGIDIAGPIALEARQTALKTLR
CBID_BRUSU      ERAGAPADMKERILLANTAMEVLELT--Q--------SIGIDIAGPIALEARQTALKTLR
CBID_RHORT      AALGATQAVVSEAERANTALEVLTLA--Q--------AAGLPLATAIAFEAATVARAVLG
CBID_PSEPK      ADIGADEALQAAISGANTSQQALALA--H--------AAGIALGDAVCAHALAFARSVVP
CBID_PSESM      AQVGADAALQQQILHANTSQQALAMC--A--------AAGVPLGDEVCRHALAFARSVVP
CBID_PSEAE      AALGASTALQDSMRAANTSQQALAQA--H--------AEGVALGDAVCAHALRFARGIVP
CBID_GEOSL      AATPAASHLASLVEGANTARQVLEAS-----------GNDPALMELVCSRAREAARLLAP
CBID_THET2      KEAGASPKALKEAEGAATARRFLEIALEE--------GLELFFVNLVRLAQEKLQAYIGE
CBID_LEPIC      RSIGVPEEIAIEIQNANTARHVLEIC--K--------VSGYKIITTKICEIVAEKCSKHA
CBID_LEPIN      RSIGVPEEIAIEIQNANTARHVLEIC--K--------VSGYKIITTKICEIVAEKCSKHA
CBID_BACME      SESGASAELVEEIKGANTASQVGDLM--T--------QSGHHQFFEKLCEYCCLSALKEV
CBID_DESVH      REAGVDEARVEAVAGANTAGQALDII-TP--------DAACHTALDAVTRRAKAHAERFA
CBID_CHRVO      ADLGYPSELVAQIKQANTVENVVQIMN-S--------QPDTRGYWMEIERRTAARMATKV
CBID_RALSO      AELGVAAALVEQIKTANTVENVIQILQ-H--------QPGAQAFWTEIEQRIAARMQPRV
CBID_CLOAB      ALMGADTNFIEKIYREKTTEGAVKIIGKE--------YKDIYRRIGVKIMKKIKDFTYGE
CBID_CLOTE      ALMGYDIDLVKDVYNQKTTEGAVKFLGEG--------YDELYKRIAEKIAKRIEIYSYGE
CBID_CLOPE      TLMGYDLELVQKVLDQKTSEGAVRLLGED--------FPMLYERIGEKVLNRLDIYAYGE
CBID_TREDE      AMHGADKKTIETVNAFLTAEEAFNYLVENK-------IEMILKAMERGAEERIKKYLKDD
CBID_LISIN      ALLGAPLSLLQEVEKCNTTEAAGELIEAAG-------FTQVYEVIAQKIKARSERFLKFT
CBID_LISMO      ALLGAPLSLLQAVEKCNTTEAAGELIEEAG-------FTQVYEVIAQKIKARSERFLKFT
CBID_SALTI      ALLGAPLELLTLVGDCDTTEAAMEHIEAYG-------FGHIYNHLARRICLRVMQMLRFT
CBID_SALTY      ALLGAPLELLTLVSDCDTTEAAMEHIEAYG-------FGHIYNHLARRICLRVMQMLRFT
CBID_PHOLL      ALMGASQELLLEVSHCDTTEAAMELIAEHG-------LQAVYDRIAERICERMSEMLRFA
CBID_FUSNN      FLVDEKPEIIRKILASNTIEEACDYIEKK----------EIYHLIANRVAFKMQEYARAD
CBID_METJA      SLFIDDKEAIKKILYSNTTEEVIKILEEK----------GVLNDVFNFIAKRVVERLSER
CBID_METMP      SLITQDVEMLQKILQSNTTEDIVEILTEK----------GILTEVFEKVSKRVVERLSLR
CBID_METTH      ALMGASRDTVTRIFNDGTVEEMISELEGE----------GLTGRVFNSIADAIRERFNER
CBID_SACS2      VLAGLPYGTLTKISNALSVEEAFTYMTK----------EQRRKVMNIVAEKILSRIKSF-
CBID_SULTO      VLAKLDIEKINKIANSATVTEAITYLLP----------EERKTLFSIVAKRVLQRLRKIV
CBID_PYRAE      VKLRAPYEVLLEVSNAASVGEALAKAG-----------DYAGGVIAIMARRAKEYLERF-
CBID_THEAC      ALNGADRDTISKILSSNTVESAFAVLRSI---------GLLDSVAGAIASRIVERLRSPV
CBID_THEVO      AMYGISKGAVKRIMESSNTGEAISIIEQE---------GIVAEVLNTIASRISNRLKADF
CBID_METAC      LEKAPEHERLKEAFEMAVEKG---------------------------------------
CBID_METMA      LEKAPQHERLKEAFEMAVEKG---------------------------------------
CBID_ARCFU      --RDRIEERARE------------------------------------------------
CBID_METKA      VEIGRPDLAVEAARHEGLISEFLRSLDPDV-------RRELFERVCELVEERVSSDHDLE
                                                                            

CBID_NOSS1      SSRGTA-ATICGSILFDRDRKIIVKSKTACNLMGNLC-------------
CBID_SYNY3      SQH----QLKVGSLLFDGDRQPVAISTQGQAMADKLGMTIPET-------
CBID_THEEB      CAAPIGRSLQVGCALFGRDRQIVATSGAGNIILREISIR-----------
CBID_GLOVI      TER----TMAVATMLLDRQGRVIARDRAAAEWLAEP--------------
CBID_PROMM      GSW----SIAIGAALFDRQRRLRWAGPQGSQQLAVLGVTPEDSPISLSLP
CBID_SYNPX      GDW----SLRIAAVLFDRSRTLRWRGPMAEERFFTLQD------------
CBID_PROMA      ETS----SIEIGAVMFDRARKIRWAGNYALKQINSFGLKLEDY-------
CBID_PROMP      TKT----DMKVGAIIFDRNRKIRWSGNNSKDYISAFKGF-----------
CBID_AGRFC      TPA-----IALDILVFDRQGALKGRTTSTPSHQPAPSSFGDRNRRT----
CBID_METC4      RAD-----IALDVAIFDRDGCLIASERC----------------------
CBID_BRUME      GAP-----VEVEIIVTDRKGNILARV------------------------
CBID_BRUSU      GAP-----VEVEIIVTDRKGNILARV------------------------
CBID_RHORT      EAP-----VRVSVLVVDRGGRVVGEGG-----------------------
CBID_PSEPK      -AQ-----VHVEVFAIDRQGGIVGQAGVQ---------------------
CBID_PSESM      -AT-----VEVEVFAIDRQGGVVGQAGVALSKEHT---------------
CBID_PSEAE      -TE-----VALEVFAIDRQGNLVGQACEERR-------------------
CBID_GEOSL      SLR-----IKVLLAGYD---------STVLYFG-----------------
CBID_THET2      RPF-----VSVALTDFDEGRCLAAWPDREVYRG-----------------
CBID_LEPIC      GTN-----IMISCYMVDFDGKLLGKCENFSPNVGLNL-------------
CBID_LEPIN      GTN-----IMISCYMVDFDGKLLGKCENFSPNVGLNL-------------
CBID_BACME      GDG-----IDVDTSLYTLKGDFLGQAVQHGN-------------------
CBID_DESVH      GPG-----VGVTIHLFHLNGTELTSA------------------------
CBID_CHRVO      PSV-----RQVAVRLFSMDGTPLGEAA-----------------------
CBID_RALSO      PRA-----DRVAVRLFAMDGTPLGAAGQEAGA------------------
CBID_CLOAB      -VN-----ADIVLY--SMEKGILWDSREVI--------------------
CBID_CLOTE      -IS-----PKILMF--SMEKILFSE-------------------------
CBID_CLOPE      -AN-----FNILMYYGSKEMKLLYESKNSNLFD-----------------
CBID_TREDE      SLS-----IRVLIY--SMKYGLIE--------------------------
CBID_LISIN      KPS-----VEIDVVTFSTERGLLAATKDIEVLREEWR-------------
CBID_LISMO      KPS-----VEIDVVTFSTERGLLAATKDIDVLREEWR-------------
CBID_SALTI      KTP-----PVCDAILFSFDNHILGSNRPVDEIAKELQC------------
CBID_SALTY      KTP-----PVCDAILFSFDNHILGSNRPVDEIAKELQC------------
CBID_PHOLL      VNP-----PRCDAIMFSFDNQILGTSRPLNDILEAMR-------------
CBID_FUSNN      IEV-----SAAIFSFKGETIGESDNYQRMVGECGAIK-------------
CBID_METJA      WKG-----IKFSCIIINMKGEVLGSYIWNKK-------------------
CBID_METMP      WEK-----INFSCIIIDMKGNILGKSD-----------------------
CBID_METTH      F-S-----FDTDVLIFSLDGRILNSNFKTKRNHRFTEVF-----------
CBID_SACS2      NDN-----INFCVIIFDYDGESLSRVGC----------------------
CBID_SULTO      KND-----VKLGVVIISEEGEVLAEEGEL---------------------
CBID_PYRAE      --K-----IPVEIYVVNDKGEVLFSTT-----------------------
CBID_THEAC      WQ--------IRRILLRHDRFRRQAIRVSPVAGHIETGE-----------
CBID_THEVO      SRS-----VGFSVVIIDHDGKIIGSHLDGHIKEVLKYGK-----------
CBID_METAC      --------KGARIVVIDRDGSVLMDSKSGK--------------------
CBID_METMA      --------KGARIVVIDRDGSVLMDSKSES--------------------
CBID_ARCFU      --------EGVRVVVIEDDMDSWVWDVQGTDH------------------
CBID_METKA      CGCALYFRADDSEEVVEGEGWKRLVRGYDDDLIGRPKG------------