CLUSTAL format seed alignment for MF_00789

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

YCCT_SALTY       --MKTGALATFLALCLPVTVFATTLRLSNEVDLLVLDGKK--VSSSLLRGAESIELENGP
YCCT_ECOLI       --MKTGIVTTLIALCLPVSVFATTLRLSTDVDLLVLDGKK--VSSSLLRGADSIELDNGP
Y1442_YERPE      --MKLGLVAGMLAVCFSFSSVAMTLKLTPEIDLLVVDGKN--MSGSLLKGADSLELNSGM
Y1681_HAEIN      -MKLRAVVLGLATLCTSTATFAGMVSTSSNLEFLAIDGQK--ASKSLGKAK-TFTVDDTQ
Y395_PASMU       -MKFRFAALASVALLTSTVSVAGVVTSSSNIDFLAIDGQK--PSKSLLKEKRSFNVSDTL
Y237_VIBVU       ---MKKMMILSALALFSSSLFAANLTLQKEITPQIVNGEG--VTLQEVHNGNRIELKPG-
Y948_VIBVY       ---MKKMMILSALALFSSSLFAANLTLQKEITPQIVNGEG--VTLQEVHNGNRIELKPG-
Y761_VIBPA       --MKKTTTLLGICAILSAPAFAAQLTLQKELVPRVINGEF--VYPEWISDNNSIELKDG-
Y4960_VIBVU      MNIIKPLTCILAMSISGLATAAVTLHVPDDVTLFVANGQKAKLSGSLFASSKTIELPNG-
Y5446_VIBVY      MNIIKPLTCILAMSISGLATAAVTLHVPDDVTLFVANGQKAKLSGSLFASSKTIELPNG-
Y5584_VIBPA      MKLIKPLTCALALAMSGMAFADVTVSVPDDVSVLAANGEKAKLSGGFFASEKALTLPDG-
Y2826_VIBCH      MKPMQRLTCLLALCFAASASAKVTMEIPDTIDLLVVNGSSPKLSGGFFDATKKLELEDG-
Y1853_VIBCH      MKLNPLILGLLLSFSAGHSLADVVLKVPENIDLLSVNMQKPKSEGGLF-GDKTIMLKDG-
Y2115_VIBVU      ----MLRVLGLAGMLMSFNIHAAMISPVSGVKILFANGTE-------VDEPLEPMEVDAK
Y2327_VIBVY      ----MLRVLGLAGMLMSFNIHAAMISPVSGVKILFANGTE-------VDEPLEPMEVDAK
Y1009_VIBPA      MRLKTWIVAFFLGLFGTTVNADTTHKTDVSVTLSTAQGVQVLFVNGVSTDELSTPYTLID
Y1013_PHOPR      MKKCVLLTSLAIMTFATIGVQAATLSTSKNIELLVVDGKK--VESSYWSPTESVELADGK
Y984_VIBVY       -MRYIGKWMMLGALVSSSVFADVKVNIHRDVAPLVVNGEK---VGFFISKKSVLDFDNGL
Y2789_PHOPR      MKKILLAFTLPLVLASQTAMADVTLKVPGNFEILAAQHLE------IKKATKIVALPEGD
Y1816_SHEON      -MKSLLPISSLLVLLGSASVSAADLNIPMSFEYLALDGKK--VESSVFNHKSSLELAPGT
                                               .     :                       

YCCT_SALTY       -HQLVFRVEKTIRLPGNEER-LYISPPLVISFDTQLISQVNFQLPRLENEREASH-FNAA
YCCT_ECOLI       -HQLVFRVEKTIHLSNSEER-LYISPPLVVSFNTQLINQVNFRLPRLENEREANH-FDAA
Y1442_YERPE      -HQILFKVIKP--LPTDPLV-LYSSPPLIVVFNAHNTRSVAIKLPVINTLRDGHQ-FSKN
Y1681_HAEIN      -NHQVVVRLNEIVGSGSNQS-LFESNPVIVTFQGN-AEDLVISAPVIRNLDSGDK-FNQM
Y395_PASMU       -PHQVVVRVAEIIRTGSDRS-LYESDPIVVTFQGT-TDDIIISAPRLETERDANA-FKKS
Y237_VIBVU       -HNQIAVTIGQIVFEDGKRR-KFDSQPLLLEFVAKPEQALTLKYGKFRTIDDAKK-FENN
Y948_VIBVY       -HNQIAVTIGQIVFEDGKRR-KFDSQPLLLEFVAKPEQALTLEYGKFRTIDDAKK-FENN
Y761_VIBPA       -ENQLAVTVGQIVFEDGKRR-KFDSQPLLLEFDAEKDAELSLTYKTFRTIEEAKA-FELD
Y4960_VIBVU      -ENQIVFQYEPYFSQGNDRI-GVESNVIIAKFSAN-DTDLNFELPKYRDHRVAEQ-EIKQ
Y5446_VIBVY      -ENQIVFQYEPYFSQGNDRI-GVESNVIIAKFSAN-DTDLNFELPKYRDHRVAEQ-EIKQ
Y5584_VIBPA      -VNQVVFRYAPYFNQGNDRL-SVESDVIVARFDTA-NAELTIEVPKYRNMRDAEE-NIKD
Y2826_VIBCH      -EQQIVFRYSPYFSQGNDRI-IIDSEVVIATFDAA-NQELRFDMPKYRDAPQATK-AIKT
Y1853_VIBCH      -TNQIVFRYIPTFDDGDDVK-KVYSDTIIAKFESE-NATLHFKIPSYRNIKEANE-KIQT
Y2115_VIBVU      -SAQLVVRYAAELGSGSNQK-VFDSAPFVITIDNLSEDIKLYPPKVFSYEQANRE-FNTS
Y2327_VIBVY      -SAQLVVRYAAELGSGSNQK-VFDSAPFVITIDNLSEDIKLYPPKVFSYEQANRE-FNTS
Y1009_VIBPA      GSNQVVIKVNKAIGRGDKRT-QVYSAPYILGFSSG-AGELYIDAPSFRDKRQADKLFEKD
Y1013_PHOPR      --HQIVVRFDGEVKNGSKNT-IYTTRPYLFDLNVA-DKDAKIVLPTLTTLSQTTAYFDRG
Y984_VIBVY       --NQLVVRVEKLIDNNQGEKEKFNSKPVIITFKAS-DRELDLFVDSVISRSKDAEEFELN
Y2789_PHOPR      QQVLVRFDSPTNPHSTGQSMGYVSSQPILIRFSANDGEVVKLVAPRVDTQQDVKR-FAKN
Y1816_SHEON      -HKVAIRYHEMVEDDFSDSQTFVKSSPFIVTLEVDGDHQYYLQAAEGKVVKKPKV-FAQN
                                         :   :  :                            

YCCT_SALTY       PRLALLDGDAMPIPVKLDILA-ITSTAKVVDYEIETERYNKSAKRASLPQFATMMADDST
YCCT_ECOLI       PRLELLDGDATPIPVKLDILA-ITSTAKTIDYEVEVERYNKSAKRASLPQFATMMADDST
Y1442_YERPE      PLYQLIGDNGHPLSVRHDVLR-QDHLNNSTTLETVMAAYNVGKYNASVPAFAAIPPSPVS
Y1681_HAEIN      PNITVKTKSGNAISAKVDVLK-QEGLFPSGNVLNDLAEYNASGAAASVSKFAATTVASSV
Y395_PASMU       PKITVKTVSGVEIATKQEYLK-QEGFLPGINLIENLSEYNASGAPAAVARLASTTMPAAI
Y237_VIBVU       PTVHLTDAQGNPVAFTMVQLY-KGGLQGFRDYEREVADYNAQKAQKADSAP---------
Y948_VIBVY       PTVHLTDAQGNPVAFTMVQLY-KGGLQGFRDYEREVADYNAQKAQKADSAP---------
Y761_VIBPA       PKVVLKDKNGKEVDFSMVQLR-KGGLQGFRDYEREVADYNNAVNKQATKSS---------
Y4960_VIBVU      MQWQLVDEQGAAVTKSEDKLV-KSGMQIGRDYAREAADYNQTGGIAAIGTA-------VS
Y5446_VIBVY      MQWQLVDEQGAAVTKSEDKLV-KSGMQIGRDYAREAADYNQTGGIAAIGTA-------VS
Y5584_VIBPA      LDWKLVDGSGKAVAVDQDKLI-KPGMQIGRDYVREIEDYNRAGGTAAVAFAGAATMQPVT
Y2826_VIBCH      MQWQLLDQQGKAVELRQDRLI-KEGMQIGRNFEFETAEYNKKGGVAALTSS---------
Y1853_VIBCH      MEWQLVDEKGQSVALVEDKLL-NPGVQWGRNYSQEATEYNQNGGVAAIGYL-----KVVT
Y2115_VIBVU      PKWRIEGVSGKEISYSQEKLKGNEGFMPYYGMEALIAKHNEERGIVFSAGV-------VK
Y2327_VIBVY      PKWRIEGVSGKEISYSQEKLKGNDGFMPYYGMEALIAKHNEERGIVFSAGV-------VK
Y1009_VIBPA      TMDWKVSINDKSIDYSQYKMPGKKGAFPYSNLDEQLAEYNELNGVYFSNGK---------
Y1013_PHOPR      ADWALEYTDGSKEVLKTVELK-GDGFGSFSNMEKLVAKYNSKHGIVFEQGY-------AV
Y984_VIBVY       PFFILKDKNGDPIQIMKQEIL-PNGGGITRDYETEVYRYNKKNNIIIASEKLSQSIAEQP
Y2789_PHOPR      PSFELTDTAGKSVSFESEKLV-VSGSPLMANYNDILAVQVAASTKQTLPQP--------A
Y1816_SHEON      PQVVLTRADKGQVNYQVTNTNIEEESFVSRLFSGNQAVDVSGTAATATGVAVAATPAPTS
                                                                             

YCCT_SALTY       LLSDVS--------ELDTVPPQ--------------------SQTLTEQRLKYWFRLADP
YCCT_ECOLI       LLSGVS--------ELDAIPPQ--------------------SQVLTEQRLKYWFKLADP
Y1442_YERPE      AVPGTTIPVAGVNTPHKTASLQ--------------------GENVTEQMLQYWFLQANP
Y1681_HAEIN      AVAPAGNAKAN----KGKVVVQ--------------------GENVAEQQLQYWFQQADK
Y395_PASMU       P----GFGKAQ----KGKITVQ--------------------GENVAEQMLQYWYQQADK
Y237_VIBVU       --------LVNHDPKAMD--------------------------------LKTAFKEMTR
Y948_VIBVY       --------LVNHDPKAMD--------------------------------LKTAFKEMTR
Y761_VIBPA       --------IAQSPAVTKT--------------------------------LKESFNELSR
Y4960_VIBVU      VATIKTEPVANVETKVKA------------------------GDNTAEEMLHFWYDKADE
Y5446_VIBVY      VATIKTEPVADVETKVKA------------------------GDNTAEEMLHFWYDKADE
Y5584_VIBPA      LPAKIPEDMKQARATAVK------------------------ADSTAEEMLHFWYQKADA
Y2826_VIBCH      ---MAVQPIAQQEISNAT------------------------AMAAAEEMLHFWYNKADA
Y1853_VIBCH      NEAQLSENTTQVIMSEASQPLEVV------------------GSSNNLTQLQLWYSKASK
Y2115_VIBVU      AEVVTTDKMVEKPATTKN--------------------------ADALVQLQHWYKQAST
Y2327_VIBVY      AEVVTTDKMVEKPATTKN--------------------------ADALVQLQHWYKQAST
Y1009_VIBPA      -RVELSELQATGTAKETH------------------------RVNSPLTKAKIAYLEMTD
Y1013_PHOPR      DLQEVAVKVDEQGKVQIT--------------------------GDSLTQLKMWYTKASA
Y984_VIBVY       IVEMEKGVEMVQYWYEKASNEDKKQFASLAFENRKSEIAKQNTKSQELDMLVYWFNQTSE
Y2789_PHOPR      VITASSQSVSTVDINQLT-------------------------PAQADQLMKDLYQNADK
Y1816_SHEON      AQVAVSATATTSPTDASKA-----------------------TGANPQQMLQYWWLQADE
                                                                       :     

YCCT_SALTY       QTRHHFLQWAEKQPPS
YCCT_ECOLI       QTRNTFLQWAEKQPSS
Y1442_YERPE      ETQKRFLIWAKKQPIH
Y1681_HAEIN      ETQTRFLNWAKSHK--
Y395_PASMU       ETQQRFLSWAKGQK--
Y237_VIBVU       QEQQAFMQWAMQNLK-
Y948_VIBVY       QEQQAFMQWAMQNLK-
Y761_VIBPA       EEQQEFMQWAMRNLK-
Y4960_VIBVU      ATKARFKAYINQ----
Y5446_VIBVY      ATKARFKAYINQ----
Y5584_VIBPA      ETKARFKAYINQQ---
Y2826_VIBCH      ETKARFKAFVNQQ---
Y1853_VIBCH      EERKAFKKWMVDQE--
Y2115_VIBVU      EERKAFRKWMVDQE--
Y2327_VIBVY      EERKAFRKWMVDQE--
Y1009_VIBPA      EERQLFMKWVSQQ---
Y1013_PHOPR      KEKKAFKIWAAEHDFN
Y984_VIBVY       NGRKNIINWIMNN---
Y2789_PHOPR      KSRKEFIRWALGL---
Y1816_SHEON      KTRKEFMSWAISQL--
                   :  :  :