CLUSTAL format seed alignment for MF_00792

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PEBA_SYNPX      ----MFDPFLEELQTGIQAR-GGISVEVPAGLEHNQSQKGS--STIQSWLWQVPGFRRWR
PEBA_SYNPY      ----MFDSFLNELHSDITKR-GGSPLPLPEGLEECRSSKSS--SVIQSWLWDVPGFRRWR
PEBA_PROMM      ----MFDPLLEKLHSSIRIQ-GGETAAVPDGLRECRNEKKN--SWIRSWLWQVPGFRRWR
PEBA_PROMA      MNKLMLQDLHNNLKRRIISH-GGKPIEVENGMSERFSHKQD--TVIKSWLWDVPGFRRWR
PEBA_PROMP      ----MFESLKNFVKTNIEDL-DGKELEISKEFKEHHNKDSK--YIIKNWIFESQQYRKWR
PEBA_GLOVI      ----MYRPFLEHLQQKLQSSFDLQSLTIPAGLDYRISERGRESTTIRSWCYTCSELRKIR
PEBA_NOSP7      ----MYKPFLEFLEKELFQRFDLQSRVIPPGLEFKVSDRGRNPATIRSWCYQSQELRKIR
                    *   : : :.  :    .     :   :    .        *:.* :     *: *

PEBA_SYNPX      VTRLDAGDSLQVLNSVAYPDFDLDHPLMGVDLLWFGARQKLVAVLDFQPLVQDKDYLDRH
PEBA_SYNPY      VTRLDAGDSLQVFNSVAYPDYNYDHPLMGVDLLWFGARQKLVAVLDFQPLVQDKDYLDRY
PEBA_PROMM      VSRLDAGESLQVLNSVAYPNYNIDQPLMGLDLLWFGKRQKLVAILDFQPLIQDQSYLERH
PEBA_PROMA      VTRMDAGDKLQVLNSVAYPAYTNDKPILGIDILWFGLKRKLVAVLDFQPLVQEERYFCRY
PEBA_PROMP      ITKLDGGDKLQVFNTVAYPNFKSEFPILGADILWFGTSQKLLAIFDYQPLIQEKKYLQKY
PEBA_GLOVI      YTYIDGGEHAQVFNSVIYPAHRYDLPLLGIDLLAFG-KKKNLIVLDFQPLFRDKAYLARY
PEBA_NOSP7      YTYIDAGESAQIFNSVVYPSHNYDLPLLGIDFLSFG-KVKNLIVLDFQPLFQDEDYQNKY
                 : :*.*:  *::*:* ** .  : *::* *:* **   * : ::*:***.::: *  ::

PEBA_SYNPX      FDGLKDLNARFPDLNGEETMRSFDPNQYFSSWLLFCRGGSEEADRSLPKAFSAFLKAYWG
PEBA_SYNPY      FSGLKELNQRFPDLNGEETMRSFDPNQYFSSWLLFCRGGAEQADLSLPKAFSAFLKAYWD
PEBA_PROMM      FQGLKTLQNRFPELSGEETMRLFDPNQYFSPWLLFCRGGAEKATNSLPEAFNAFLHCYWE
PEBA_PROMA      YKDLQILKNRFVDFNSQKTMKIYDSNKYFSPWVLLYNGSFDDLQCSLAKILDEFLHAYWQ
PEBA_PROMP      CSSLDFIKNQYSVFDNHKMKNIYDSKKYFSPWVMICRGNKLNLDRDLNNIFCSFVSNYLT
PEBA_GLOVI      IEPMRILRERYGDVAQDVEMKFYDANQYFSKYLLFARTDAETVAGRVFTAYCDYLDLYWQ
PEBA_NOSP7      IAPLKYLHNKYPDLAQNLEMKFYDANQYFSKYLLFAKTDAETVSTRVFEAFQDYLNLYWQ
                   :  :. ::  .  .   . :*.::*** :::: . .       :      ::  *  

PEBA_SYNPX      LHDEASKEPSSISPGDVERLQNAYDVYSAERDPAHGLFTSHFGKEWSDRFLHEFLFPASQ
PEBA_SYNPY      LHDNAKSIPSTIPPEEVKNLQDKYDIYSAERDPAHGLFTSHFGKDWSNRFLHEFLFPASS
PEBA_PROMM      LHQQNSDKASLIPAAEVKQLQIAYDIYSAERDPAHGLFTSHFGKAWSDRFLHEFLFPAST
PEBA_PROMA      VDNNNSREYIKIIPSKVEQLHINYDIYSAERDPAHGLFKSYFGQTWADQFVREFLFPHSH
PEBA_PROMP      INKLHQNN-QFLDLEQIKNNQIDYDKYSAEKDPADKLFKTFFGETWTENFINNFLFTLNH
PEBA_GLOVI      LLASAAPLGDAQDIRRIVKAQKDYDQYSADRDPASGLFSSYFGHEWAERFLYEFLFEDAV
PEBA_NOSP7      MLADAQALHDPEDIQRIVKAQKDYDQYSADRDPASGLFSSYFGHEWAERFLHEFLFEDAV
                :               : . :  ** ***::***  **.:.**. *::.*: :***    

PEBA_SYNPX      PA--------------
PEBA_SYNPY      SHK-------------
PEBA_PROMM      KADSSPPADADDDLPR
PEBA_PROMA      LTAD------------
PEBA_PROMP      NPLK------------
PEBA_GLOVI      PLAVGQPGR-------
PEBA_NOSP7      PLAVSASKR-------