CLUSTAL format seed alignment for MF_00793

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PEBB_GLOVI      ----------------MTLYEPFLERAQQVLTRRLELAPYPIPVGFERKEALV----RGE
PEBB_NOSP7      ---------MNSERSDVTLYQPFLDYAIAYMRSRLDLEPYPIPTGFESNSAVVGKGKNQE
PEBB_SYNPX      MSIDLRASSLDPVQIPGWRWQPFLDEASAALKP-FNPSPYPIAETFLQKEGSTGSKAKPV
PEBB_SYNPY      -MTNQRFKSTDPVNIEGWSWQPFLEDAIKRLEG-LNVEPYPVPDRFLQREDQTGSKSKSI
PEBB_PROMM      -MKPSRLSSLDPVKMPEWRWAPFLSHAINAFIP-LKPEPYPVAPEFLQREGKTGSKSQPI
PEBB_PROMA      -MIIKRDNSLSKIDLRDWIWTPFFNDLVDKLSV-FEIEPYPVSHDFLSKESITGSRRNPV
PEBB_PROMP      -----MLIQNTIFYSQEWRWAKFIKFLISQLDN-YHCVEHKIASDFSYKESSYGSKKSKK
                                   :  *:.     :    .   : :.  *  ..          

PEBB_GLOVI      AVVTTSTAWQSPKLRQIRAAHVQGGGALQVLNFVISPRLEYDLPFFGADLVTLPGGHLIA
PEBB_NOSP7      EVVTTSYAFQTAKLRQIRAAHVQGGNSLQVLNFVIFPHLNYDLPFFGADLVTLPGGHLIA
PEBB_SYNPX      PVTTATWACSTDKLRQVRCACVEAGMAASVLNFVINPSCRFDLPFFGADLVTLPNGHLLA
PEBB_SYNPY      PVTTATWACKTEKFRQVRAACVSAGSAASVLNFVINPKSTYDLPFFGGDLVTLPAGHLLA
PEBB_PROMM      RVTTCTWACRTKKFRQVRAACVEAGRSASVLNFVINPYHTFDLPFFGADLVTLPSGHLLA
PEBB_PROMA      HVTTLTWAAKFEKIKQVRLACIKGGESLSVFNLLIHPLNDYDLPFFGADFVTLPNGHLLA
PEBB_PROMP      NINLFTWGATHQKRINFARAVCINSPNYSVLNFLIIPKTSYNIPFLGVDFVSLPTSHLLV
                 :   : .    *  :.  *    .   .*:*::* *   :::**:* *:*:** .**:.

PEBB_GLOVI      LDMQPLFRDDPAYQAKYTEPIVPLFEAHRAHLEWGGDFPEEARPFFSPAFLWTR----PK
PEBB_NOSP7      LDMQPLFRDDSAYQAKYTEPILPIFHAHQQHLSWGGDFPEEAQPFFSPAFLWTR----PQ
PEBB_SYNPX      LDLQPVDKADPDHTQPVWERLMPLFERWQAELPDGGPIPEEAQPYFSPAFLWTRIPLGEE
PEBB_SYNPY      LDLQPAIKTDEVHTTHVWDRLIPIFERWRDQLPYGGPIPEEAQPFFSPGFLWTRLPLGEE
PEBB_PROMM      LDLQPAITSDERHTKQVWERLMPIFEHWRVHLPEGGPIPEEAKPYFSPGFLWTRLPLSIE
PEBB_PROMA      LDLQPALKLDNIHTENVWPRLIPLHDHWQSLLPSGGEIPKEAEPYFSPGFLWSRLPLSKE
PEBB_PROMP      LDFQPSLKVENQFNSELLEQIIKLKKSCHSSLPVAEKMSEDVAKFFSPGLIWSRLAKHQD
                **:**    :  .       :: : .  :  *  .  :.::.  :***.::*:*     .

PEBB_GLOVI      ETGTVETRVFAAFVDYLNAYLDFVERAEPVTHPEGLAAVERAQLRYLHYRAEKDPARGMF
PEBB_NOSP7      ETAVVETQVFAAFKDYLKAYLDFVEQAEAVTDSQNLVAIKQAQLRYLRYRAEKDPARGMF
PEBB_SYNPX      GDELIERVIRPAFIDYLQLYLNLVAEAEPVSD-DRAELLLSGQKRYTAYRAEKDPARGML
PEBB_SYNPY      GDELIQSIVRPAFNDYLDLYLELAASAERVTD-ERSEVLLQGQRKYTDYRAEKDPARGML
PEBB_PROMM      GNQLIDEVIMPAFKDYLNLYLDLVEMAEEVSP-QRAFKLLEGQKRYLSYRAKKDPARAML
PEBB_PROMA      SDNIISEILRPAFGEYLSLYIELLHIAKPLKK-ERALKILEGQKAYINYRSTKDPARAML
PEBB_PROMP      SDNLIENQLYDSFKEYLNLYLKTLFESEEVGH-GLQQELINGQNDYLNYRRDNDPARPML
                    :.  :  :* :**. *:.    :: :        :  .*  *  **  :**** *:

PEBB_GLOVI      RRFYGPEWTEEYIHGFLFDLERRREAVHR
PEBB_NOSP7      KRFYGAEWTEEYIHGFLFDLERKLTVVK-
PEBB_SYNPX      TRFYGSEWTESYIHGVLFDLEDAA-----
PEBB_SYNPY      TRFHGSEWTEAYIHTVLFDL---------
PEBB_PROMM      ARFHGHQWTESYIHNVLFDL---------
PEBB_PROMA      CRFYGKEWTEDYIHKVLFNI---------
PEBB_PROMP      SSLFGKDFTESLINKVLFSTNKVL-----
                  :.* ::**  *: .**.