CLUSTAL format seed alignment for MF_00795

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

E1T5A1_BURSG          -----------------------MSVLLEVIATTVADARLAAQAGADRLELVTAMS-EGG
B2JKE6_PARP8          --------------------MRNERVLLEVIATTVADAKAAARGGADRLELITAMG-EGG
D3E5B9_GEOS4          -------------------------MLLEIIATCVDDAITAEKNGADRLELITAIT-EGG
B1YEC8_EXIS2          --------------------------MLEIIAATVEEATAAERAGADRLELVSALS-EGG
F4LQY7_TEPAE          --------------------------MIEVIATCVDDAIAIEKYGGQRVELSSALS-EMG
Q8Y896_LISMO          --------------------------MLEVIVQNPRDAYLAEKYGANRMEVVSAIS-EGG
D1B8G5_THEAS          -------------------------MFVEVIAVSPWEAELVEACGGDRVEFVLDLS-CGG
F8I114_WEIKK          -------------------------MLKEIAAGDLVTARIAVEKGVDRIELNQQLE-LGG
C5RBC7_WEIPA          -------------------------MEKEIALADIPTMKAAISAGVNRVELNANLE-LGG
Q03AR7_LACP3          -------------------------MLKEIAVENYTSIPKAIAAGADRIELNDNLA-VGG
Q38VP1_LACSS          ------------------------MLIKEVCVENFTEIPAAIRNGAKRIELNDNLA-VGG
CUTC_ENTFA            -------------------------MIKEFCAENFTKIPQAIQKGANRIELCDNLA-VGG
Q8DYB9_STRA5          ------------------------MILREFCAENLTDLTRLDKAIISRVELCDNLA-VGG
Q9CE53_LACLA          ------------------------MIIRELCLENFTKIPQALQAGVERIELCDNLA-VGG
Q49YD8_STAS1          -------------------------MIKEAVVETIQQVEQAVANGANRIELCDNLS-VGG
CUTC_TREDE            ----------------------MKNIKIEICAGSFEDAVLAEKAGASRIELNSSLF-LGG
D1AXC4_STRM9          -------------------------MNIEICAGNIEDIIITEKLNISRIELNQGLS-IGG
CUTC_DICDI            --------------------MSEQDIKFEVCVDSLSSCIEAINGGASRLELCSSLF-SGG
CUTC_BACTN            ----------------------MKKYQFEVCANSVESCLAAQAGGADRVELCAGIP-EGG
CUTC_PORGI            -----------------------MAMQLEICANSAASCRQAELGGATRVELCAGIP-EGG
CUTC_XANCP            -------------------------MGLEVAADSVGSALAAQDGGAIRVELCGGLD-GGG
CUTC_XYLFA            MSFDVYVIRVFGKSRGSREAGMSVSAGLEVAAGSVASALAAQEGGAMRVELCHGLG-GGG
CUTC_CHRVO            -----------------------MDKILEICAGSLASCIAAQEGGAQRVELCDNLG-EGG
CUTC_PHOLL            ------------------------MTKLEICCFSVGCALIAQQAGADRIELCASPA-EGG
CUTC_PROMH            ------------------------MAKLEICCFGAECALIAERSGADRIELCTSPS-EGG
CUTC_YERPE            ------------------------MTKLEVCCYSVDCAQIAEKAGADRVELCCGQS-EGG
CUTC_PECAS            ------------------------MTKLEVCCYSVDCAITAAQSGADRIELCAGQR-EGG
CUTC_ECOLI            ------------------------MALLEICCYSMECALTAQQNGADRVELCAAPK-EGG
CUTC_SALTY            ------------------------MALLEICCYSMECALTAQRNGADRIELCAAPK-EGG
N2A031_9FIRM          --------MCTLKFVKEKEGIGCPSCYWNVVWTVWNPHWLQKKGGADRLELCAALV-IGG
CUTC_VIBCH            -----------------------MKYQVEVCIDNIESLHNAIAGGATRIELCSSLA-LGG
CUTC_VIBPA            -----------------------MVTHLEVCIDNIESLHYAIAGGATRIELCSSLA-LGG
CUTC_RHIME            ----------------------MSRISLEVCVDDPDGLEAAVAGGADRIELCSALG-AGG
Q2KCX7_RHIEC          -----------------------MTILLEVCVDSADGLAAAIEGGAGRIELCSALE-LGG
CUTC_CAUVC            --------------------MSAHRVLLEVCVDTPAGLAAAIAGGADRVELCSALA-LQG
CUTC_AGRFC            --------------------MKEVPMILEICVDDVAGLEAAVRGGADRIELCAALS-GGG
G8PV40_PSEUV          -------------------------MKLEVCVDSIAGLNAAVAGGADRIELCSCLA-MGG
CUTC_DROME            ----------------MIREMSNHDIKLEVCVDSIRSAFAAEEGGASRIELCSALG-EGG
CUTC_CAEEL            ----------------MTETESQKQIKLEICIDNLESAENAVAGGADRLEVCSALQ-LGG
F2ICU8_FLUTR          -------------------------MKVEICVGTLEAARIVSKLPIDRIETCIALE-QGG
A0A1D9MM36_9ACTO      ------------------MKTNQAGIALEVCVDDLAGAYAAADAGANRIEYCEDLN-VGG
A4XCW1_SALTO          ------------------------MTTVEICVSDVPTALVAEAAGADRLELCADLG-QGG
L0DMK4_SINAD          -----------------------MNVAVEICVQGIESALAAYAGGADRIELCEDLA-VGG
C1A229_RHOE4          ------------------------MTVLELAVQDVRGARIARSVGATRVELCAALGPTGG
A0JVM6_ARTS2          -------------------------MQLEIAVVDIAGVAIAADEAADRIELCTRLD-LGG
Q15ZM9_PSEA6          ------------------MIDIEICLPCDDLAHVAQQIRAAHRGKAARVELCSHME-HQG
B8NCH8_ASPFN          -MEQIQPDSPSRNSTNNGSSKDAASPLLEIACFNEESAIIAAKSGADRIELCQDYA-SGG
                                                  :                  *:*         *

E1T5A1_BURSG          LTPSIGLIEAVVEA--VSI---PVNVIVR-PHSRSFVYDADDHAVMVRDVRAVKAAGAN-
B2JKE6_PARP8          LTPSIGMIEAVAAA--VPI---PVNVIVR-PHSHSFVYDADDFAVILRDVRAARAAGAN-
D3E5B9_GEOS4          LTPGIGLVEEVVKA--VRI---PVHVMVR-PHSRSFVYNALDIATMVAEVKAIRKAGAA-
B1YEC8_EXIS2          LTPSYGLIRQVLSS--VEI---PVHVLVR-PHSKSFVYSKADQETIITDIDLIRELGAA-
F4LQY7_TEPAE          ITSSYALIKNVLDK--VKI---PVHVLIR-PHSKSFIYSDNDMQVMKEDIEIAKKLGAN-
Q8Y896_LISMO          LTPSYGAIKEIVRA--SKL---PAMMMIR-PHSFSFVYDEAAKIVMERDIELAKEVGVQ-
D1B8G5_THEAS          LTPSVPEVAAAVRG--VSI---PVNVMIR-PRPGGFQYSPGEMDQMRRSAQAMAEVGAR-
F8I114_WEIKK          LTPSRITWQAVLKL--GRP----VVVMVR-PRGGDFNYSNDEVIEMERTLIALKNDGIK-
C5RBC7_WEIPA          LTPDPKTVAMAVQL--AEKSQVDLVVMIR-PRSGDFNYTYSEIEMMRQSILTFKSLGVK-
Q03AR7_LACP3          TTVSKGVMAESTKY--VHEHGRSLITMIR-PRGGNFVYNDVELKIMEADLFEAQALGVD-
Q38VP1_LACSS          TTVSRGVMAESVRY--AHEHDVPVMVMIR-PRGGNFVYNDQELKIMEADIFSAQELGAD-
CUTC_ENTFA            TTPSTGVIEEVLAY--AGEHSVPVMTIIR-PRGGNFVYNDIELKIMHTDLIEAKKLGTD-
Q8DYB9_STRA5          TTPSYGVIKEANQY--LHEKGISVAVMIR-PRGGNFVYNDLELRIMEEDILRAVELESD-
Q9CE53_LACLA          TTPSYGVIEEAAKY--VAESKTTLAVMIR-PRGGNFVYNSHELKIIETDTLKAVEAGAQ-
Q49YD8_STAS1          TTPSFGMVEIATEI--CKANHVEIAVMIR-PRGGHFVYNLYDFEIMQRDIKSLKQLNVD-
CUTC_TREDE            LTPSLGTLKLVKK-----ETHLEVMAMVR-PRAAGFFYSSYEYKTMLEDAKLFIDNGAD-
D1AXC4_STRM9          LTPSHALVKQALK-----ISTKDIVVMIR-PREGDFTYTENEYMVMKEDAKYLLKLPIK-
CUTC_DICDI            LTPSYGLMKTLKEYIENHEISIDIFVMIR-PRSGDFLYNQDEITIMKHDIELVKQISNQC
CUTC_BACTN            TTPSYGEISTARDM----LTTTRLHVIIR-PRGGDFLYSPIEVRTMLKDIEMARQLGAD-
CUTC_PORGI            TTPSAGEMAVARSL----IAIP-IHVIIR-PRAGDFVYSSEEIEAMCYDIRVVRSLGME-
CUTC_XANCP            LTPSFGTLAVVRER----LQIP-LYVLIR-PRVGDFVFDAAEVEVMRRDVEQCVRLGCD-
CUTC_XYLFA            LTPSYGMLAVVRER----LHIP-LYVLIR-PRGGDFVFSEEEMEVMCCDVECCVRLGCD-
CUTC_CHRVO            TTPSYGALAMARGR----LNIA-LHAIIR-PRGGDFLYSALEFDAMAHDVEVCRSLGLD-
CUTC_PHOLL            LTPSFGTLKQAIEQ----LTIP-VYPIVR-PRGGDFCYSHSDFEVMKNDVAQIRDMGFM-
CUTC_PROMH            VTPSYGILKQVIDL----VRIP-VHPIIR-PRGGDFCYSQADFAAMKNDISMIRDMGFS-
CUTC_YERPE            VTPSVGALMQARET----VTIP-VHPIVR-PRGGDFCYSSNDFTIMKNDIARIRDLGFA-
CUTC_PECAS            LTPSYGALRGAREK----IAIP-VHPIVR-PRGGDFCYNATEFAAIKYDIEQVREMGFP-
CUTC_ECOLI            LTPSLGVLKSVRQR----VTIP-VHPIIR-PRGGDFCYSDGEFAAILEDVRTVRELGFP-
CUTC_SALTY            LTPSFGVLRSVREH----ITIP-VHPIIR-PRGGDFYYTDGEFAAMLEDIRLVRELGFP-
N2A031_9FIRM          ISPGIALFEQVKSI----CDLP-VRVLLR-PRFGDFLYTDYEFQIIKREVELFGKAGAE-
CUTC_VIBCH            LTPSAGLMYSAGRV----SPIP-AYAMIR-PREGDFFYHDDELSIMAQDIRTAHQANLQ-
CUTC_VIBPA            LTPSYGFMQQAAKQ----SSVP-VYAMIR-PRQGDFFYNEEELDMMRWDIEAAHQSGLD-
CUTC_RHIME            LTPSPGLMAVAAP-----PPVP-VYAMIR-PRAGDFIYHRADLEVMRRDIDAARHAGLA-
Q2KCX7_RHIEC          LTPQPSLMRIAAR-----APIP-VYAMIR-PHAGPFIFGNTDEEAMLLDIDAARAAGLA-
CUTC_CAUVC            LTPAPGLMAQAAS-----APIP-VYPMIR-PRHGDFCYDARDLDAMRRDIDAVRGYGLP-
CUTC_AGRFC            VTPSAGFMQRAAT-----YGLP-VSVMIR-PRAGDFVFTHDEADVMKRDIDAARAAGLS-
G8PV40_PSEUV          LTPSVGLMELAAQ-----APIP-VYAMIR-PRGGNFIFSPQEVDQMKREIDAVRNTNLA-
CUTC_DROME            LTPSIGTLKTIK-E----TLTMPIYCMLRPRRGTDFVYSDEEMCALLTDMDLLRENGAD-
CUTC_CAEEL            LTPSVGFVSILSYK----YPDIPLYCMIR-QRAGDFVYNEDEMAANMEDVEWLKKAGAT-
F2ICU8_FLUTR          LTPSKAMVSWIQNT-----FDLEQHALIR-VRAGGFVYNYDEIVVMRDQILELKDAGIK-
A0A1D9MM36_9ACTO      TTPALAEVALL-SR---TLVNADLQIMVR-PRGGDFVHSQREIDLICTEIEAFRHLTPTH
A4XCW1_SALTO          TTPSLGTVEVA-LR---TLRAVDVRIMIR-PRGGDFRVSEIERQVMLADIAAIRELPNPH
L0DMK4_SINAD          VTPSLGTVAVA-CR---RL-AIPVHVLIR-PRGGDFVYSEAEFEVMQHDVAMAKSLGAA-
C1A229_RHOE4          LTPSIGVIEAA------SEVGIAVHPLIR-PRAGGFVFSPDEVWVMEHDVRAAVAGGAS-
A0JVM6_ARTS2          LTASRDLFQESLCG---AARLLQVHPLVR-CRPGDFVYSAGEISTMARQIATFVTEGAA-
Q15ZM9_PSEA6          LTPSMNAMQQARAA---AQGELILLAMIR-PRGGDFCYDEGEILQMQHDIALAAQAGMQ-
B8NCH8_ASPFN          LSPEPKALAILKSQ-----ISIPIYVMIR-PHAESFYYSDTDFEAMKHTMHSLREKGAD-
                       :                        ::*  :   *                        

E1T5A1_BURSG          ----GVVIGMLNADGTIDRDQLARAID----AAD--GLAVTFHRAFDEVR--DQRKALDV
B2JKE6_PARP8          ----AVVFGMLTASREVDREALLRVVD----AAD--GMPVTFHRAFDETR--DLREALDI
D3E5B9_GEOS4          ----GVVLGMLTPEGKIDEAALAQMLE----WTG--DMQVTFHRAFDELE--DQFEGLRT
B1YEC8_EXIS2          ----GIVVGSLTADGRVDEGFLGRIIK----HKG--DLSLTFHRAIDSSR--DILEAAEV
F4LQY7_TEPAE          ----GIVIGTLDEHNRIDEEKLKELLA----FAD--DMDVTFHRAIDSTE--SCVESVRT
Q8Y896_LISMO          ----GIVYGGITENGAIDQALLEKVIE----WKG--DLNLTFHRALEATK--DIEASYQV
D1B8G5_THEAS          ----GLVMGFLK-DGAVDLDALKSALT----WCP--GIDFTFHRAIDEAS--DPVEAARV
F8I114_WEIKK          ----IVTFGVLTAQKQLDTIVMERLIK----VAS--PMRVVMHMAFDSIP--LDHQAATI
C5RBC7_WEIPA          ----MVTFGVVDAKGRLARHHMLKLLE----AAK--PMKVVYHMAFDAID--VSCQSQAL
Q03AR7_LACP3          ----GVAFGALTPDGAIDEDAMTSLIA----ASA--GMTVVFHMAFDAIP--ETKQFAAI
Q38VP1_LACSS          ----GIVVGCLTPDNKIDDEAMEMLIG----AAN--GMQVVFHMAFDELA--VADQAEAI
CUTC_ENTFA            ----GIVIGCLTEDGWLDEEALDLFIE----TAE--GLQITFHMAFDALS--KENQFKAI
Q8DYB9_STRA5          ----ALVLGILTSNNHIDTEAIEQLLP----ATQ--GLPLVFHMAFDVIP--KSDQKKSI
Q9CE53_LACLA          ----NIVFGALTPGNEIDTDALETVSI----AAQ--GLPITFHMAFDEV----TDQEKAI
Q49YD8_STAS1          ----YFVFGCLTEDSTLNEWQMKTLKN----LAS--PTPVVCHMAFDEIY--LEGQIKAL
CUTC_TREDE            ----GLVFGFLKKDGTIDAKRCEALIKIA--E----SRDKVFHRAIDVVP--DPLKALDE
D1AXC4_STRM9          ----GIVFGFLNYDNSIDVKRTKKFITLA--KKY--NKEAIFHRAIDVSN--DYINNLIL
CUTC_DICDI            SSFSGIVIGLLNSDGTIDKCNTEKLVELA--S----PLSVTFHRAFDMTR--DYIESFNT
CUTC_BACTN            ----GVVFGCLTANGEIDLPVMQELMK----ASQ--GLSVTFHRAFDICR--DPEKALEQ
CUTC_PORGI            ----GVVFGCLTPEGGYDEEANSRLLK----EAQ--GMQLTFHRAFDVCA--APFEMLEK
CUTC_XANCP            ----GVVLGALDPQGQVDLPAMRALIE----AAG--TLGVTFHRAIDVSA--DPARVLED
CUTC_XYLFA            ----GVVLGALDPAGEVDMGMMRVLIA----VAG--SLGVTFHRAIDVSA--DPGRTLED
CUTC_CHRVO            ----GVVLGLLTADGDVDVARTRQLAA----LAG--PMAVTFHRAFDLAR--EPEQALED
CUTC_PHOLL            ----GVVFGVLDEEGHIDLPRMQQLMA----LSG--DMAVTFHRAFDMCF--NPYVALDQ
CUTC_PROMH            ----GAVVGILNEEGHIDLPKMAILME----LAG--PLAITFHRAFDMCI--NPLLALDQ
CUTC_YERPE            ----GVVVGVLDTDGHIDMPRMREIMS----VSG--SLAVTFHRAFDMCQ--NPMIALKQ
CUTC_PECAS            ----GVVVGALNEEGHIDLPKMREIMA----VAQ--GMAVTFHRAFDMCL--NPYIALEQ
CUTC_ECOLI            ----GLVTGVLDVDGNVDMPRMEKIMA----AAG--PLAVTFHRAFDMCA--NPLYTLNN
CUTC_SALTY            ----GLVTGVLTVDGDVDMSRMEKIMA----AAG--PLAVTFHRAFDMCA--NPFNALKN
N2A031_9FIRM          ----GVVIGCLQEDGGLHMERMRELTA----AAG--DMKVTLHRAFDVCA--DPIRAYGQ
CUTC_VIBCH            ----GVVLGLLNADGTIDVKRSKPLIELA--HSL--GLGVTFHRAFDHCV--NPEHALEE
CUTC_VIBPA            ----GVVLGVLTQEGDIHIPFATALCEFA--QAL--GLGITFHRAFDQCR--NAEQALED
CUTC_RHIME            ----GVVLGASLADGRLDARMLTKLAG----HAA--GMGLTLHRAFDLVP--DFAEAMEI
Q2KCX7_RHIEC          ----GVVIGANRPDGTLDMPLIHRLKT----HAS--GLGSTLHRAFDLVP--DADQALEQ
CUTC_CAUVC            ----GVTIGASQANGALDLKVLRKLVE----QAE--GLGTTLHRAFDVVP--DMSEALEI
CUTC_AGRFC            ----GVVLGASRGDGSLDMALLEDLRR----HAD--GMDATLHRAFDVAP--DMEEALEA
G8PV40_PSEUV          ----GVVLGANQHSSALDANLLEKLID----HSA--GLGLTLHRVIDLAP--DLVEATET
CUTC_DROME            ----GFVFGSLNPDRSINVDQCRHVLL----ASG--GLPVTFHRAFDLTDQKSMDENVDM
CUTC_CAEEL            ----GFVFGALTSAGSLDRTSCQSIIE----TAR--PHPVTFHRAIDVA--YDWKTCLED
F2ICU8_FLUTR          ----GLIVGALTKDFKLNLEALETWKR----TAP--NVDFTFHRAFDSID--DWKTAMDQ
A0A1D9MM36_9ACTO      DIQIGFVFGTLNPDLTVNAAACKQIREAA--GDR----LLTFHRAIDSVP--NWEEAIDA
A4XCW1_SALTO          GLTVGVVVGALTPDNNLDLAVLRHMIEAA--GPL----PVTVHKAFDEVD--DQLAAIDQ
L0DMK4_SINAD          ----GVVIGLLQPDHSLDQTRLVQLIAAS--HPM----DVTFHRAFDEMA--NPLEVVDE
C1A229_RHOE4          ----GIVVGALTEDNTIDTVVLRRIIGCV--DRA--RVEVTVHRAMDVVA--DRLTALDE
A0JVM6_ARTS2          ----GVVFGALTCEGAIDGDGMTRLIDSA--REANPQVEITCHRAIDQCR--DPLSALLE
Q15ZM9_PSEA6          ----GVVLGALTPDNKLDQGALTRLIAVA--NNA--NLQVTFHRAFDALA--EPAQAIDT
B8NCH8_ASPFN          ----GFVFGILTQDTPAQTAPRIDVARNKELVELAQGRPCTFHRAFDLISESNWDTALAD
                              *                                 * .::             

E1T5A1_BURSG          LLGF-----------------DEVTNVLTSGAR--ASVL----DAEATIRELVRHA---S
B2JKE6_PARP8          LLEV-----------------DGVANVLTSGGR--SSVL----DAVGEVQLLVAQA---A
D3E5B9_GEOS4          LQKY-----------------PAVTRVLTSGGP--QPAP----QAIPRIRELVEQA---A
B1YEC8_EXIS2          LADF-----------------PEVDRILTSGGH--ATAL----EGQAVIAQLIEQ-----
F4LQY7_TEPAE          LLKY-----------------PKIKRIVTAGGK--GKVT----DNLDVIRKMVGVA----
Q8Y896_LISMO          LRTYG----------------KDINQLLTSGGT--ANAL----DSLPRLKRWIQDSEA-Q
D1B8G5_THEAS          ACGA------------------GVTDLLTSGGP--GPIE----GNLDRLRRMVEAA----
F8I114_WEIKK          NWLSQ----------------HQVERILTHGGPLNQPIE----QSLKQIKITIEQA----
C5RBC7_WEIPA          QWLYQ----------------YGVVRVLTHGGTLRTGIE----ETIPHLQEIIAMA----
Q03AR7_LACP3          DWLAD----------------HDVERILTHGGPLTTPIT----DTLPRLQAIINYA----
Q38VP1_LACSS          DWLVE----------------HDVKRILTHGGPLTAPLN----EE--RLQELVRLA----
CUTC_ENTFA            DWLAE----------------RGVTRILTHGGPAGTPIE----DNFDHLKELIVYA----
Q8DYB9_STRA5          DQLVA----------------LGFTRILLHGSSNGEPII----ENIKHIKALVEYA----
Q9CE53_LACLA          DQLVE----------------FGVDKILTHGGPLDQSL------NTDKLKSLIDYA----
Q49YD8_STAS1          HQLID----------------IGFTRLLTHGGPSDTNLF----DNLNQLGKLVVNS----
CUTC_TREDE            LISLG------------------FTRVLTSGQE--PTAY----EGADLIAKMVKRAK---
D1AXC4_STRM9          LKNLG------------------ITRILTSGHE--KNAE----LGIENIKKAIKE-----
CUTC_DICDI            LNSINCSTSNNNNNNNSGGGCGKISRILTSGME--SSVL----EGIDTIKELIKLSN---
CUTC_BACTN            IIELG------------------CNRILTSGQQ--ATAE----LGIPLLKALQTQAS---
CUTC_PORGI            LIAAG------------------FHRVLTSGCA--PTAL----EGKDMIGALNKQAT---
CUTC_XANCP            AITLG------------------CERVLTSGAR--ASAL----EGVETIAALVRQAG---
CUTC_XYLFA            VIALG------------------CERVLTSGGR--SSAL----EGAETIAALVAQAA---
CUTC_CHRVO            VIAAG------------------CSRLLSSGQA--ASAP----EGAALLARLREQAG---
CUTC_PHOLL            LTQLG------------------VKRILTSGQQ--QNAE----LGLPLLKELHQAS----
CUTC_PROMH            LTQLG------------------VARILTSGQQ--ANAE----LGLPLLRTLNEKT----
CUTC_YERPE            LAELN------------------VARILTSGQQ--QNAE----LGLALLKDLVAATK---
CUTC_PECAS            LTDLG------------------VSRILSSGQQ--QTAE----NGLRLLRELTQAS----
CUTC_ECOLI            LAELG------------------IARVLTSGQK--SDAL----QGLSKIMELIAHR----
CUTC_SALTY            LADAG------------------VARVLTSGQK--ADAA----QGLSIIMELIAQG----
N2A031_9FIRM          AQELG------------------IDTILTSGQQ--GSCA----KGMALLKRLCAMQK---
CUTC_VIBCH            IIALG------------------CERILTSGLA--RNAY----LGIERLAQLVKQSA---
CUTC_VIBPA            IIHLG------------------CERILTSGLA--PSAP----AGESVLKSLVEQAQ---
CUTC_RHIME            AVDLG------------------FERILTSGGA--KTAP----EAVDTLERLIELSA---
Q2KCX7_RHIEC          AVELG------------------CERILTSGCA--LKAV----DGIETLKRLSAKAA---
CUTC_CAUVC            AVELG------------------FERVLTSGGA--LSAL----DATDRLAALVEQAG---
CUTC_AGRFC            AISLG------------------FPRILTSGGA--RSAL----EGVKTLARLSELAK---
G8PV40_PSEUV          AMDLG------------------FERILSSGGA--HKAL----DGIESLAAMHHAAA---
CUTC_DROME            LRELG------------------FRRLLSSGFR--PTAA----DGVDCLAQLIAKHQ---
CUTC_CAEEL            AIDVG------------------FKAVLTSGQE--PSAL----DGVYIIREMQELHK---
F2ICU8_FLUTR          LIKMG------------------FKRILTSGSD--QSVA----HGIKRLKELVTYAN---
A0A1D9MM36_9ACTO      LGEAG------------------VNLILTTGKGVAPADEGQGYSTEGMIKLAQRGEK---
A4XCW1_SALTO          VVGLG------------------ADAVLTSGAAATAL------AGAARLAALRQRAG---
L0DMK4_SINAD          LIGLG------------------VDRILTSGGAVRAV------DGLARLAELSRQTA---
C1A229_RHOE4          LIDLG------------------VTRVLTSGGADTCS------EGLDEIGRMVEHAA---
A0JVM6_ARTS2          LAELG------------------VSRVMSSGGAKTAG------AGRVTLAAMHRIAD---
Q15ZM9_PSEA6          LIELG------------------VQRILTSGCDWGSHDTAQ--QHSAQIAHYLALAK---
B8NCH8_ASPFN          IVECG------------------FTSILTSGPSGGTAIECVDHLDRLVHERLEQLRGRVE
                                                ::  *                             

E1T5A1_BURSG          G--SHCTVLAGAGLTVDAVAGFVSRTQVEAVHFGSGVRVGGNGLAPIDTDKVARVRALLD
B2JKE6_PARP8          G--SACTVLAGAGLTVDRVAGFVHAAHVKAVHFGSGVRSDG----VVAEEKVRLVRGLLD
D3E5B9_GEOS4          G--TGLKILAGNGLKWEIIRDFIDQTGVSEVHFGSAVRYGRSGLKPIDPVELRSLADSLH
B1YEC8_EXIS2          N--PDLIVLPGSGITVERAEELLKATQATELHVGSAVLVDG----QVDADKVAALKQLLA
F4LQY7_TEPAE          N--NKITIMLGGGLNKENLQLAIERTGTCEVHFGSGVRENYHYTGNISRELMQEVIEEWR
Q8Y896_LISMO          P--DSFQVLVGSGVKPENIATFQATLNHSDYHVGSAAREANDFSKDILKEKIDILQQQIN
D1B8G5_THEAS          ---GSVRVMAGGGITGENAPRVILHGGVPAVHLGRSVRRDNSPTEPIDSQLLRRMVELVK
F8I114_WEIKK          Q--GKIEILPGGGINYQNYEQIARQLGVEQVHGSQIIKLNVVE-----------------
C5RBC7_WEIPA          P--KGLTIMPGGGVTYMNASRVATVLGVNDVHGSKIVRLS--------------------
Q03AR7_LACP3          G--DKISILPGGGITSQNAASIGETLGVKALHGTKLIAF---------------------
Q38VP1_LACSS          D--GRLGILPGGGITAENVAGITKRLNVTEAHGTKIVG----------------------
CUTC_ENTFA            D--QRILILPGGGISTENVQTVMDTLKVTEVHGTKIV-----------------------
Q8DYB9_STRA5          N--NRIEIMVGGGVTAENYQYICQETGVKQAHGTRITQ----------------------
Q9CE53_LACLA          K--GKINIIIGGGVNAENFENLAQLTGTNYVHGTKIIKL---------------------
Q49YD8_STAS1          G--GHIEIVPGGGLNKDNLPELLEAFPFQEVHGTKIV-----------------------
CUTC_TREDE            -G--RIEILPGGGITEKNASKIIKLTGVDQIHFAALKRR-----EEPSTKANPSIYYGGA
D1AXC4_STRM9          ----NLPIIVGCGINANNIHKFKNL-GITDIHGSFSKK----------ILNDYTIDFGNY
CUTC_DICDI            -G-TDITILPGGGITQKNINKIIKKTKLKEYHISARTVS-----DSKMQFRNTSVFMGGS
CUTC_BACTN            ---GRIILLAGCGVNEKNIARIASETGIQEFHFSARESI-----KSDMKYKNESVSMGGT
CUTC_PORGI            ---GRIGIMAGCGIRLGNIETLARHTGITQFHSSLRHDI-----PSSMRFRRPEVSMGGT
CUTC_XANCP            ---ERISIMPGAGVSAANVQALRAGTGAREFHASARGPV-----AAQVHAPH--PYITD-
CUTC_XYLFA            ---GRVVVMPGAGVSAGNVLELRVRTGAHEFHASARSVV-----AARRLGPH--PDIHD-
CUTC_CHRVO            ---GRLTVMPGAGVRPGNIAGLAAASGCIEFHASARGQV-----ASAMRYRRGGVGMGA-
CUTC_PHOLL            ---QGPIIMAGAGVRMSNIHKF-IDIGLTEVHSSASRIM-----LSTMTYRKAGVTMSAD
CUTC_PROMH            ---QGPIIMAGAGVRLSNIQKF-LDSGLQEIHSSAGKQA-----PSTMNYRKAGVTMSSD
CUTC_YERPE            -D-QGPIIMAGAGVRLTNMQKF-IDAGIRELHSSAGRTV-----PSTMRYRKAGVTMCAD
CUTC_PECAS            ---RGPIIMAGSGVRLTNVHKF-QQAGIRELHSSAGQWT-----SSPMRYRKIGVSMCSD
CUTC_ECOLI            ---DAPIIMAGAGVRAENLHHF-LDAGVLEVHSSAGAWQ-----ASPMRYRNQGLSMSSD
CUTC_SALTY            ---DAPTIMAGAGVRANNLQNF-LDAGVREVHSSAGVLL-----PSPMRYRNQGLSMSAD
N2A031_9FIRM          -ETGGPKIMAGAGVTPAVIRKFRTETDITSYHLSAKKIV-----DSGMRYRKEGVPMGA-
CUTC_VIBCH            ---GRISIMAGAGINAQNVAEIALATGVNELHLSAKTTR-----PSEMLFIRSESKMGAA
CUTC_VIBPA            ---GRIAIMAGAGVNADNARDLVKNTNVQEVHLSGKTTR-----PSQMTFIAGQSKMGAS
CUTC_RHIME            ---GRISIMPGSGITSDTIEALVPRLAITEVHSSCSSA------EPANDMR--LVEMGFA
Q2KCX7_RHIEC          ---GRISIMPGSGIRPANVGAILQATGAREVHGSCSSQ------VDSVDPR--AVAFGFE
CUTC_CAUVC            ---ERISIMAGAGVRPGNIAELVRRTGVREAHGSFGGP------VPGADPRSQLGAMGFV
CUTC_AGRFC            ---GRIVIMPGAGVRPQSVQALLDSFPITEIHASCSAVP-----LYDPESR--VAKLGFT
G8PV40_PSEUV          ---GHLSVMPGSGINAKTAPEILQAADFTEIHAGCGST-------YPQDQR--LLDFGFE
CUTC_DROME            ---RDFIVMPGAGIKVSNLEEILTVSRCLEFHASALDTAGEDYVAPTTTRMECDVTMGKQ
CUTC_CAEEL            ---GKIDVLAGCGVNSSNVANLVEWTKCHWYHASA--------SVAKKNAPLNKVSMGKQ
F2ICU8_FLUTR          ---GRIEIMAGGGVKEELIPEL-KATGIHAIHFSGTSKV----------------TVESE
A0A1D9MM36_9ACTO      ---YGLGVLASGGLRPEKWDGGLLEAGFTQYHLRAPWTPEENGKQNSYGSPMRETSHGWT
A4XCW1_SALTO          ---DRLRVIAAGGIRSHNVRQVLTETGAREVHLRAPVQRDG-----------REATDGDE
L0DMK4_SINAD          ---GRIAIAAGGRI-TEADLSAFLQANLKGIHIGSAVCTGD-----------RIDADKVR
C1A229_RHOE4          ---GRIQIMAGGGI-TVDDIPAIAAVGVDAVHLSARKVVAGSGGPGGGSDGYDVTDAVVA
A0JVM6_ARTS2          ---GRLEIMAGGGL-KIADIPALKTAGVNAVS---SRPDGRAGDPPPRTGAWSEQPVRHQ
Q15ZM9_PSEA6          ---GQIEIVIGGGIAPVSAKLIAQSIGQQMEQHYHYSFH----------AYSSALIDGVV
B8NCH8_ASPFN          GHARLPQIIVGGGVRATNIRMLWERTRAPAFHSAALAQS--------------SVELVSD
                             :  .  :                                              

E1T5A1_BURSG          EQAGSPRAQ------------------------
B2JKE6_PARP8          A--------------------------------
D3E5B9_GEOS4          Q--------------------------------
B1YEC8_EXIS2          R--------------------------------
F4LQY7_TEPAE          KSNICIS--------------------------
Q8Y896_LISMO          KD-------------------------------
D1B8G5_THEAS          GV-------------------------------
F8I114_WEIKK          ---------------------------------
C5RBC7_WEIPA          ---------------------------------
Q03AR7_LACP3          ---------------------------------
Q38VP1_LACSS          ---------------------------------
CUTC_ENTFA            ---------------------------------
Q8DYB9_STRA5          ---------------------------------
Q9CE53_LACLA          ---------------------------------
Q49YD8_STAS1          ---------------------------------
CUTC_TREDE            LYPPEDSIEVAGLDEMTKVIKSL----------
D1AXC4_STRM9          TILDKNIEKNIDFNSF-----------------
CUTC_DICDI            LRESEYTYAIVDKNKIQGFINKSNTN-------
CUTC_BACTN            VHIDEYERNVTTAQRVINTIQAIKS--------
CUTC_PORGI            VKIDEYSRPETSADMVRQAVDILQGI-------
CUTC_XANCP            LGGD---YQRTDVARVRSIVQLLQTA-------
CUTC_XYLFA            LGGD---YDCTDVDKVRQLVRLLSQGAS-----
CUTC_CHRVO            SGVDEYARQETSASQVRALREALDKA-------
CUTC_PHOLL            NEVDEFSHYCVDGGVVEVMKGMLSLTLFE----
CUTC_PROMH            SEVDEFTHYCVDEDVVGAMKDIMSIYTTSVN--
CUTC_YERPE            SDVDEFSHYCVDGEVVEAMKSLLVMGSPLAKHT
CUTC_PECAS            TELDEFSQYCVDGDVVEAMKRAVSPDREMQYVS
CUTC_ECOLI            EHADEYSRYIVDGAAVAEMKGIIERHQAK----
CUTC_SALTY            IQADEYSRYRVEGAAVAEMKGIIVRHQAK----
N2A031_9FIRM          VGMSEFQIFRTDEEIVKQAKWELHKAR------
CUTC_VIBCH            DCDDFIIPVTSRDALQQTVHALAALNSVLH---
CUTC_VIBPA            DVDDFAIPITSTQAIANVAAALK----------
CUTC_RHIME            APERRRTDAAKIRAMRARLDAPAAKA-------
Q2KCX7_RHIEC          AKSSNRTNVDVVREMCRVIAAGA----------
CUTC_CAUVC            PPELRDTSQAAVAEAVKALRAL-----------
CUTC_AGRFC            GAGRKATDEAAVRELKTILSAHHKGGATL----
G8PV40_PSEUV          ATGEKKTDENQVRLLKTILIDLSQNTLDN----
CUTC_DROME            DVDPYYGTNSIVVRKMVTIAKAMSSR-------
CUTC_CAEEL            DNQPSRVTSLEEVRMLKATLAPV----------
F2ICU8_FLUTR          TAFQETLLLPDENKLTTILVAIQG---------
A0A1D9MM36_9ACTO      TTNPEIVAGFAGKLAG-----------------
A4XCW1_SALTO          VSRLVVAARGR----------------------
L0DMK4_SINAD          RIVEVVRAWYH----------------------
C1A229_RHOE4          QEAAAALRAVRLY--------------------
A0JVM6_ARTS2          PERAILRRSPD----------------------
Q15ZM9_PSEA6          HEDPVLQLYQGVNDT------------------
B8NCH8_ASPFN          AEVEALRAALNKAT-------------------