CLUSTAL format seed alignment for MF_00798

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MTRB_BACPU      -MSENKASDFVVIKAIDNGVNVIGLTRGSDTRFHHSEKLDKGEVIIAQFTEHTSAIKVRG
MTRB_BACSU      -MNQKHSSDFVVIKAVEDGVNVIGLTRGTDTKFHHSEKLDKGEVIIAQFTEHTSAIKVRG
MTRB_GEOSE      -MYTN--SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRG
MTRB_BACHD      -MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRG
MTRB_OCEIH      MTDRTDKAEYFIIKALENGVNVMGLTRGHDTRFHHTEKLDQGEVMIAQFTEHTSAIKVRG
                       :::.:*** ::****:*:*** **:***:****:***:**********:*:**

MTRB_BACPU      DAVIQTSFGEIQSEAKK
MTRB_BACSU      EALIQTAYGEMKSEKK-
MTRB_GEOSE      KAYIQTRHGVIESEGKK
MTRB_BACHD      KAIIQTSYGTLDTEKDE
MTRB_OCEIH      KALIQTSHGEITNE---
                .* *** .* : .*