CLUSTAL format seed alignment for MF_00800

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y5559_BACAN      --MTEIVKVREQLQISLSDFQEQASLQSGQIFVVGCSTSEVLGERIGTSGTMEVAEAIFS
Y4999_BACHK      --MTEIVKVREQLQISLSDFQEQASLQSGQIFVVGCSTSEVLGERIGTSGTMEVAEAIFS
Y5442_BACC1      --MTEIVKVREQLQISLSDFQEQASLQSGQIFVVGCSTSEVLGERIGTSGTMEVAEAIFS
Y5317_BACCR      --MTEIVKVREQLQMSLSDFQEQASLQSGQIFVVGCSTSEVLGERIGTSGTMEVAEAIFS
Y3766_ALKHC      -----MMTIQQQLETVLGDLQKAKPLSSKHLLVIGVSTSEVAGKQIGTNSSKDVAAALYA
YWLG_BACSU       -----MNELKQTWKTMLSEFQDQAELKQDQLFVLGCSTSEVAGSRIGTSGSVDIAESIYS
Y2986_OCEIH      ---MTNDRLAQDLKCIVKEWTDARILRENDIFVVGCSTSEVAGQPIGTAGSEEIASTIYQ
Y214_THET2       -----MEGIRRAAQRAVEEFLQAFPMGPGSLFVLGGSTSEVLGERVGTRPSLEAAHAVLE
Y583_THET8       -----MEGIRRAAQRAAEEFLQAFPMAPGSLFVLGGSTSEVLGERVGTRPSLEAAHAVLE
Y860_CALS4       ---MDLKEISKQTEEVIEELLDIANLKPGSLFVLGGSTSEILGKKVGTAGSLDVAKAVVD
Y078_SYMTH       --------MRAEARAAVGELLEAAGLSPGQVLVVGCSTSEVIGRRIGTAGSEAVAGAILE
Y2114_STAAM      ---------MKDLTMLLDELKDMSFFNKGDICLIGCSTSEVIGEKIGTVGSMEVAETIFN
Y1916_STAAN      ---------MKDLTMLLDELKDMSFFNKGDICLIGCSTSEVIGEKIGTVGSMEVAETIFN
Y2017_STAAS      ---------MKDLTMLLDELKDMSFFNKGDICLIGCSTSEVIGEKIGTVGSMEVAETIFN
Y2038_STAAW      ---------MKDLTMLLDELKDMSFFNKGDICLIGCSTSEVIGEKIGTVGSMEVAETIFN
Y2202_STAAR      ---------MKDLTMLLHELKDMSFFNKGDICLIGCSTSEVIGEKIGTVGSMEVAETIFN
Y1711_STAES      ---------MRDLQQLLDELKDMSFFNPGEMCIIGCSTSEVIGKRIGSVGSMDVAKEIYE
Y102_STRA3       -MILDYNKLKQETKAIVVDIIERSALKKGQIFVLGLSSSEVSGGLIGKNSSSEIGEIIVE
Y103_STRA5       -MILDYNKLKQETKAIVVDIIERSALKKGQIFVLGLSSSEVSGGLIGKNSSSEIGEIIVE
Y1636_STRP3      ----MLNNLEKQTREIVIDVVERSAIQPGNLFVLGLSSSEILGSRIGKQSSLEVGQIVVE
Y1963_STRP8      ----MLNNLEKQTREIVIDVVERSAIQPGNLFVLGLSSSEILGSRIGKQSSLEVGQIVVE
Y1898_STRP1      -----MNNLEKQTREIVIDVVERSAIQPGNLFVLGLSSSEILGSRIGKQSSLEVGQIVVE
Y087_STRMU       ---MDLENLAEETRIVLADLIKRSDIKKGQIFVLGLSSSEVAGGVIGKNSNLDIGEVIVK
Y663_STRPN       ---MNETQIQRETRQVVEDVLEKTNLKQGALFVLGLSSSEVLGGHIGKESSQEIGELIVE
Y580_STRR6       ---MNETQIQRETRQVVEDVLEKTNLKQGALFVLGLSSSEVLGGQIGKESSQEIGELIVE
Y489_LACLA       ---MDLEKLKKDTQVIIDDVIKQTEIKAGQVFVLGLSSSEVNGGLIGHASSSEIGQVIVS
Y1967_ENTFA      -MTIDEKMLKEQLVTITEEVITAGNLKKGDLFVLGCTTSEVVGGVIGKNSSAEVGQWIVS
Y1278_TREDE      MSGIDLEKIKEETIAALNELLEAASLKAGDILVLGCSTSEVSGGVIGKASNEEAGRTIVS
                                   :      :    : ::* ::**: *  :*   .   .  :  

Y5559_BACAN      ELKQFQEQTGIELAFQCCEHLNRALVVERELAMKYQFEIVTVTPVRSAGGALATYAYHNL
Y4999_BACHK      ELKQFQEQTGIELAFQCCEHLNRALVVERELAMKYQFEIVTVTPVRSAGGALATYAYHNL
Y5442_BACC1      ELKQFQEQTGIELAFQCCEHLNRALVVEKELAMKYQFEIVTVTPVRSAGGALATYAYHNL
Y5317_BACCR      ELKQFQEQTGIELAFQCCEHLNRALVVEREVAIKYQFEIVTVTPVRSAGGALGTYAYHNL
Y3766_ALKHC      ALFSYQQKTGVALAFQCCEHLNRALVMERDEAEARGYEEVAVIPVRKAGGAMATYAFTQF
YWLG_BACSU       GLAELREKTGIHLAFQCCEHLNRALVVEAETAKLFRLPTVSAVPVPKAGGAMASYAFKQM
Y2986_OCEIH      QLQSLQNATGINLAFQCCEHLNRAIVVERTIATTYSLPEVTAIPVREAGGAMAAYAYQHM
Y214_THET2       GLLPPLLERGVHVAVQACEHLNRALVVERETARAFGLEEVAVFPHPKAGGALATAAFLRF
Y583_THET8       GLLPPLLERGVHVAVQACEHLNRALVVERETARAFGLEEVAVFPHPKAGGALATAAFLRF
Y860_CALS4       PILEAIHKRGLYLAVQGCEHINRALLVEEEAKDKYGLEEVNVIPHEHAGGSIQTYAYQQF
Y078_SYMTH       PLLEATQAAGVHLAVQCCEHLNRALVVERAAAERYDWERVTVVPVPRAGGALAARAMRRL
Y2114_STAAM      ALDVVSKETGVTFAFQGCEHINRAITIEKSQYNPLTMEEVSVVPDVHAGGSLATYAFQHM
Y1916_STAAN      ALDVVSKETGVTFAFQGCEHINRAITIEKSQYNPLTMEEVSVVPDVHAGGSLATYAFQHM
Y2017_STAAS      ALDVVSKETGVTFAFQGCEHINRAITIEKSQYNPLTMEEVSVVPDVHAGGSLATYAFQHM
Y2038_STAAW      ALDVVSKETGVTFAFQGCEHINRAITIEKSQYNPLTMEEVSVVPDVHAGGSLATYAFQHM
Y2202_STAAR      ALDVVSKETGVTFAFQGCEHINRAITIEKSQFNPLTMEEVSVVPDVHAGGSLATYAFQHM
Y1711_STAES      NLKQLEIDTGVTFAFQGCEHINRAVTIERANFNPLTMEEVTVVPDVHAGGSLSTYAYQQM
Y102_STRA3       VILKELHSRGIYLAVQGCEHVNRALVVEAELAERQQLEVVNVVPNLHAGGSGQVAAFKLM
Y103_STRA5       VILKELHSRGIYLAVQGCEHVNRALVVEAELAERQQLEVVNVVPNLHAGGSGQVAAFKLM
Y1636_STRP3      VVLDELNKRGVHLAVQGCEHVNRALVVERHVAESKQLEIVNVVPNLHAGGSAQMAAFQLM
Y1963_STRP8      VVLDELNKRGVHLAVQGCEHVNRALVVERHVAESKQLEIVNVVPNLHAGGSAQMAAFQLM
Y1898_STRP1      VVLDELNKRGVHLAVQGCEHVNRALVVERHVAESKQLEIVNVVPNLHAGGSAQMAAFQLM
Y087_STRMU       TILTYLNDRGIYLAVQGCEHLNRALVVERELADKRNLEIVNVLPNLHAGGSGQLAAFKYM
Y663_STRPN       TILDILGSRGIHLAVQGCEHVNRALVVERQVAEQFGLEIVSVHPTLHAGGSGQLAAFKFM
Y580_STRR6       TILGILGSRGIHLAVQGCEHVNRALVVERQVAEQFGLEIVSVHPTLHAGGSGQLAAFKFM
Y489_LACLA       VIHKTLSDKGIYLAVQACEHLNRALLIEEELAEKKDWEIVSVIPQLHAGGSGQVAAYQLF
Y1967_ENTFA      TLIEQLDKKGISLAVQGCEHINRALAMERRVAEEKGFEIVSVVPQLHAGGSCSVAAFEKF
Y1278_TREDE      ALLSVLEPKGIFLAVQGCEHINRALVIEKESQEKYGFEEVSVVPALHAGGAASLAAYNLF
                  :       *: .*.* ***:***: :*           * . *   ***:    *   :

Y5559_BACAN      KDPVVIEFIK--ADAGMDIGDTFIGMHLKHVAVPVRTSVKEIGSAHVTMATTRGKLIGGA
Y4999_BACHK      KDPVVIEFIK--ADAGMDIGDTFIGMHLKHVAVPVRTSVKEIGSAHVTMATTRGKLIGGA
Y5442_BACC1      KDPVVIEFIK--ADAGMDIGDTFIGMHLKHVAVPVRTSVKEIGSAHVTMATTRGKLIGGA
Y5317_BACCR      KDPVVVEFIK--ADAGMDIGDTFIGMHLKHVAVPVRTNVKEIGSAHVTMAKTRGKLIGGA
Y3766_ALKHC      RDPVIVEQIR--ADAGIDIGDTFIGMHLKRVAVPVRSSISAIGDAHVTMAYSRPKLIGGV
YWLG_BACSU       KSPVLVETIQ--ADAGIDIGDTFIGMHLKPVAVPVRVSQNSLGSAHVTLARTRPKLIGGV
Y2986_OCEIH      IDPVVVEKIT--AEAGMDIGETMIGMHLKHVAVPLKFKQRFINYARVRAARTRPKLVGGS
Y214_THET2       QDPVVVESLKAQAHGGMDIGGVLIGMHLRPVAVPLRLSVRKIGEAVLLAAKTRPKLVGGA
Y583_THET8       RDPVMVESLKAQAHGGMDIGGVLIGMHLRPVAVPLRLSVRKIGEAVLLAAKTRPKLVGGA
Y860_CALS4       KNPVMVENLKGLGHAGLDIGLVLIGMHLRPVVVPVRLSRNKIGEATIVAARTRPKMVGGE
Y078_SYMTH       PDAVVVEEIK--ADAGLDIGLTLIGMHLRRVAVPVRLKTAAIGHARVVAARTRPKLIGGA
Y2114_STAAM      KDPIVVEHIT--VPCGIDIGQTLIGMHIKHVCVPVRTSVKQVGQAIVTIATSRPKKIGGE
Y1916_STAAN      KDPIVVEHIT--VPCGIDIGQTLIGMHIKHVCVPVRTSVKQVGQAIVTIATSRPKKIGGE
Y2017_STAAS      KDPIVVEHIT--VPCGIDIGQTLIGMHIKHVCVPVRTSVKQVGQAIVTIATSRPKKIGGE
Y2038_STAAW      KDPIVVEHIT--VPCGIDIGQTLIGMHIKHVCVPVRTSVKQVGQAIVTIATSRPKKIGGE
Y2202_STAAR      KDPIVVEHIT--VPCGIDIGQTLIGMHIKHVCVPVRTSVKQVGQAIVTIATSRPKKIGGE
Y1711_STAES      EDPIVVEHIT--VSKGIDIGQTLIGMHIKHVCVPVRTSVKQIGEAIVTIATSRPKKIGGE
Y102_STRA3       TSPVEVEEIV--AHAGIDIGDTSIGMHIKRVQVPLIPISRELGGAHVTALASRPKLIGGA
Y103_STRA5       TSPVEVEEIV--AHAGIDIGDTSIGMHIKRVQVPLIPISRELGGAHVTALASRPKLIGGA
Y1636_STRP3      SDPVEVEEVI--AHAGLDIGDTAIGMHIKRVQIPLIPCQRELGGAHVTALASRPKLIGGA
Y1963_STRP8      SDPVEVEEVI--AHAGLDIGDTAIGMHIKRVQIPLIPCQRELGGAHVTALASRPKLIGGA
Y1898_STRP1      SDPVEVEEVI--AHAGLDIGDTAIGMHIKRVQIPLIPCQRELGGAHVTALASRPKLIGGA
Y087_STRMU       KDPVEVEEIV--ADAGLDIGDTAIGMHVKRVQVPLRPLLRELEGAHLTALASRPKLIGGS
Y663_STRPN       QDPVEVEFIK--AHAGLDIGDTAIGMHVKHVQVPIRPILREIGHAHVTALASRPKLIGGA
Y580_STRR6       QDPVEVEFIK--AHAGLDIGDTAIGMHVKHVQVPIRPILREIGHAHVTALTSRPKLIGGA
Y489_LACLA       KSPVEVEHIV--ANAGLDIGDTSIGMHVKHVQIPVRPILRELGGAHVTALKSRPKLIGGE
Y1967_ENTFA      DEPVEVEHIV--AQAGIDIGDTSIGMHVKHVQVPLRLSIRTLGAAHVTALYSRPKYIGGP
Y1278_TREDE      KSPVMIEHVR--AHAGIDIGDTEIGMHVKFVQVPVRLKTKYIGSARLTALKSRPKLIGGE
                  ..: :* :      *:*** . ****:: * :*:      :  * :    :* * :** 

Y5559_BACAN      RAVYAAKEETITCR-------
Y4999_BACHK      RAVYAAKEETITCR-------
Y5442_BACC1      RAVYAAKEETITCR-------
Y5317_BACCR      RAVYAAVEETTTCR-------
Y3766_ALKHC      RANYERTEEHESFRC------
YWLG_BACSU       RAVYECE--------------
Y2986_OCEIH      RAYYGK---------------
Y214_THET2       RAVYTREEMLKKLEEFLPKPP
Y583_THET8       RAVYTREEMLKKLEEFLPKPP
Y860_CALS4       RARYKKL--------------
Y078_SYMTH       RAVYEMQ--------------
Y2114_STAAM      RAKYK----------------
Y1916_STAAN      RAKYK----------------
Y2017_STAAS      RAKYQ----------------
Y2038_STAAW      RAKYQ----------------
Y2202_STAAR      RAKYQ----------------
Y1711_STAES      RAKYQ----------------
Y102_STRA3       RAGYTSDPIRKF---------
Y103_STRA5       RAGYTSDPIRKF---------
Y1636_STRP3      RADYNMDIIRKS---------
Y1963_STRP8      RADYNMDIIRKS---------
Y1898_STRP1      RADYNMDIIRKS---------
Y087_STRMU       RASYQPDPIRKF---------
Y663_STRPN       RAHYPQDAIRKF---------
Y580_STRR6       RAHYPQDAIRKF---------
Y489_LACLA       RARYK----------------
Y1967_ENTFA      RAHYETTQERNR---------
Y1278_TREDE      RAVYEKVL-------------
                 ** *