CLUSTAL format seed alignment for MF_00802

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GLNE_AGRFC      -----------------------------MTKRETVERRLSEVPPGVIRPYTQTELKSVF
GLNE_RHIME      -------------------------------MAEAIERSLSDIDVVAIRPASQADAKAAL
GLNE_BARHE      -----------------------------------MKNAFLKTQLLPLRPLD-ESGSQWL
GLNE_BARQU      -----------------------------------MKNAFLKTHLFPLCPLD-ESGSQWL
GLNE_BRUME      ------------------------------MTVENAKALFFERNLCALTPLDPERASAFL
GLNE_BRUSU      ------------------------------MTVENAKALFFERNLCALTPLDPERASAFL
GLNE_RHILO      ----------------------------MAAVAKRTVTDWQLKPALGLAPLDQGRARQEL
GLNE_BRADU      ------------------------MNHSAPGNADKHGESLAARFAEAPHIAASTTDERRF
GLNE_RHOPA      ------------------------MIFSAI-TADLDNTALAARFGAGPRLYDPVLAAERW
GLNE_CAUVC      ------------------------MVTTVISNVKRQSRASLVGKRNAGHRSAMSKLADRL
GLNE_PSEPK      -----------------------------------------------MRLPLPSDLPATL
GLNE_PSESM      -----------------------------------------------MSLPSLADFPAIL
GLNE_PSEAE      -----------------------------------------------MSLPSLANLPATL
GLNE_ACIAD      ------------------------------------------------------------
GLNE_ECOLI      ----------------------------------------------------MKPLSSPL
GLNE_SHIFL      ----------------------------------------------------MKPLSSPL
GLNE_ECOL6      ----------------------------------------------------MKPLSSPL
GLNE_ECO57      ----------------------------------------------------MKPLSSPL
GLNE_SALTI      ----------------------------------------------------MTPLSSPL
GLNE_SALTY      ----------------------------------------------------MTPLSSPL
GLNE_YERPE      ----------------------------------------------------MLPLPSEL
GLNE_YERPS      ----------------------------------------------------MLPLPSEL
GLNE_PECAS      -----------------------------------------------MSILPLPALPVLL
GLNE_PHOLL      ----------------------------------------------------MLPLSTPL
GLNE_VIBVU      -----------------------------------------------------MSLPSPL
GLNE_VIBVY      -----------------------------------------------------MSLPSPL
GLNE_VIBPA      -----------------------------------------------------MQLPSSL
GLNE_VIBCH      -----------------------------------------------------MSLPSAL
GLNE_PHOPR      -------------------------------------------------MTQHLERPELL
GLNE_SHEON      ---------------------------------------------MAVQKDSNKSLSPLI
GLNE_HAEDU      ---------------------------------------------------MFSQLDFTG
GLNE_MANHA      --------------------------------------------------MLTTLIPLSQ
GLNE_MANSM      ------------------------------------------------MTMPLPSIEQTL
GLNE_PASMU      ------------------------------------------------MSFPLAHVDATL
GLNE_HAEIN      ------------------------------------------------MTALSALIEQKL
GLNE_METCA      -----------------------------------------------MAPPPDTSGSCSA
GLNE_XANAC      ------------------------------------------------MPMPTVSMSPAL
GLNE_XANCP      ------------------------------------------------MSQPIPSASPAL
GLNE_BORBR      ------------------------------------------------------------
GLNE_BORPA      ------------------------------------------------------------
GLNE_BORPE      ------------------------------------------------------------
GLNE_BURMA      ------------------------------------------------------------
GLNE_BURPS      ------------------------------------------------------------
GLNE_RALSO      ------------------------------------------------------------
GLNE_NEIMA      ------------------------------------------------------------
GLNE_NEIMB      ------------------------------------------------------------
GLNE_CHRVO      ------------------------------------------------------------
GLNE_NITEU      ------------------------------------------------------------
GLNE_BIFLO      ---------MESSIFKPSSMDLIRAGLQDLDKARALFDQLKADD------IPDERCAELL
GLNE_LEIXX      -----------MTREQLSLTVLARAGFVGLSSVRAELEELAT--------LTGFPVDDLL
GLNE_COREF      MTDPLIHTRKVMGFVRDPLPTTGALSLKSTNARADLEWLGWRN----------VESIPLM
GLNE_CORGL      MSGPLRSERKVVGFVRDPLPKVGSLSLKSEHAQADLEHLGWRN----------VESLDLL
GLNE_CORDI      --------------MRKTLPSIGALGFSNTNAEKDLCCLGWYSNDPDTVVDAPEQAAEIL
GLNE_MYCBO      ------MVVTKLATQRPKLPSVGRLGLVDPPAGERLAQLGWDRH-------EDQAHVDLL
GLNE_MYCTU      ------MVVTKLATQRPKLPSVGRLGLVDPPAGERLAQLGWDRH-------EDQAHVDLL
GLNE_MYCPA      ------MVVTKPATQRPRLPSVGRLGLVDPQAAERMAQLGWYDH-------DDQAHVDLL
GLNE_MYCLE      MCCTTVVVVRKPATERLKRPSVGRLGLFDPHAAENLALLGWYDY-------DCREHVDLL
GLNE_NOCFA      --------MVRPPSARSAVPGVGRLGLLDPTAAASLRELGW----------DNVESIPVL
GLNE_STRAW      --------MTAPGRRSSTFSRLLRHGFTDPSAAERLLESAELEPVKAD----PVLLEA--
GLNE_STRCO      ---------MTPGRRSSTFTRLLRHGFTDPSAAERLLDGAGLAELRAD----PVLLEA--
GLNE_CUTAK      -----------MDRKSSVTIDLLRLGVMDTDAASANHHRIA-ENIGAD----PNRLADWE
                                                                            

GLNE_AGRFC      STLKDIGKAE--PAVAALLAGES-------------------PLKDFIAAAFTLSPYLRD
GLNE_RHIME      SVLKDAAKGS--DHIAKLIASDA-------------------PLKDFLVAAFALSPFLRD
GLNE_BARHE      KDITEQARKENLESLVSSLSNQG-------------------KQINFLNAVMTLSPFLRE
GLNE_BARQU      KDIEEQARKENLESLVSYFSAKG-------------------KQVDFISAVMTLSPFLRE
GLNE_BRUME      ADLEARAREEELAGVVALLGRK--------------------KAADFLSAILDLSPFIRE
GLNE_BRUSU      ADLEARAREEELAGVVALLGRK--------------------KAADFLSAILDLSPFIRE
GLNE_RHILO      AEIAAAAREEGLARLAKFLAGKG-------------------AGQDFLAAVFDLSPFLRD
GLNE_BRADU      ESWLAELEPAQSARLEAL-LVQP-------------------FGRNILVGIAEFSPYLFD
GLNE_RHOPA      AGWLADLAPEQADAIAALGNAFP-------------------DLQIALQSIAEASPYLFD
GLNE_CAUVC      APCGPVLDPKAAERAYEAIAKRAGEA-----------MGQVDAAWGSLAPVFAASPYLAG
GLNE_PSEPK      QPLVTRNQQFISDAV---AGHPELDL-----------QAWSPLHRQQFDQVAAASEFVLS
GLNE_PSESM      LPFITRARQTWRTALTELSAEALASF-----------EAWPEARRTAFDRVCAASDFVTE
GLNE_PSEAE      LPAAERAGTALRSAVAALDAAALARL-----------EAWPEERLEDFRRVAAASDFVAE
GLNE_ACIAD      ----------------------MQTK-----------GCRFFMNTEQLQKTLRSSQYAEQ
GLNE_ECOLI      QQYWQTVVERLPEPLAE------------------------ESLSAQAKSVLTFSDFVQD
GLNE_SHIFL      QQYWQTVVERLPELLAE------------------------ESLSAQAKSVLTFSDFVQD
GLNE_ECOL6      QQYWQTVVERLPEPLAE------------------------ESLSAQAKSVLTFSDFVQD
GLNE_ECO57      QQYWQTIVERLPEPLAE------------------------ESLSAQAKSVLTFSDFVQD
GLNE_SALTI      SQYWQTVVERLPEGFTE------------------------TSLSAQAKSVLTFSDFALD
GLNE_SALTY      SQYWQTVVERLPEGFTE------------------------TSLSVQAKSVLTFSDFALD
GLNE_YERPE      QIQAQSIKQRFSELPAP------------------------PDLRDEDIAVLALSDFVSD
GLNE_YERPS      QIQAQSIKQRFSELPAP------------------------PDLRDEDIAVLALSDFVSD
GLNE_PECAS      TEQSQRALSRLREAAPD------------------------EPITDSDSAVLALSDFVSD
GLNE_PHOLL      LAQLQRVTEHFHQLTLNV-----------------------EPVAAHEQAILSLSDFVVE
GLNE_VIBVU      IPVAELAMQNAQ--QSGYLEHW------------------PQALITQFQFISGLSKFVVE
GLNE_VIBVY      LPVAELAMQNAQ--QSGYLEHW------------------PQALITQFQFISGLSKFVVE
GLNE_VIBPA      VSVAESAVQNAQ--EAGYLQSW------------------PNEVVEQFHYVSALSQFITE
GLNE_VIBCH      LPTAELHYQSLIS-EHPHIANW------------------PSSVLNQLRYVLGLSQFVAQ
GLNE_PHOPR      SIAATKALDKLQQAHPELLAQW------------------PTERQNELETVIGLSDFIAS
GLNE_SHEON      TQASERHWARLTEVWSEGLANL------------------TAAQQQELKTVLGLSDYIAN
GLNE_HAEDU      LPLANTGEN------------------------------------RPLAIAVAMSNFVKK
GLNE_MANHA      LNLPPNLQNS--------------------------------EQIQPLVTAEFASNFVHQ
GLNE_MANSM      IQLADNLITHFPEQFNSQIYQQIQKD-----------ISNIKTPVGALMRAVSMSDFVTE
GLNE_PASMU      NQLAKQLIAHFPEQYQDQIFQHIATD-----------KEKPTSNIGQLRYAIAMSDFFAE
GLNE_HAEIN      QSLGTILCQSFPELSPEKIHEAIQQN-----------SNHPELPVYQLGYAIAMSDFVEK
GLNE_METCA      FHECERIFAQWGYPFQDY----------------------SESFRQSLDTVCRCSRFFLG
GLNE_XANAC      TALIERAVARVRQSLPVEQAWPGGE------------------FDRQLAQVALASEFALD
GLNE_XANCP      AALIERAVARVRHALPADAPWPEG-------------------VEHPLARVALASDFVVD
GLNE_BORBR      -----------------------------------------MSSAPPFAAALAWSGHLRR
GLNE_BORPA      -----------------------------------------MSSAPPFAAALAWSGHLRR
GLNE_BORPE      -----------------------------------------MSSAPPFAAALAWSGHLRR
GLNE_BURMA      ------------------------------------------MTDASDLLSLSYSHYLAR
GLNE_BURPS      ----------------------------------------MTMTDASDLLSLSYSHYLAR
GLNE_RALSO      ----------MTAQAPLSVAPFLQTP-----------ACPSEAPGAVLPFSLNYSRYVQR
GLNE_NEIMA      ------------------------------------------MSDNRLDTARHHSLFLAR
GLNE_NEIMB      ------------------------------------------MSDNRLDTARRHSLFLAR
GLNE_CHRVO      ---------------------------------------MPANTSAAIARSCEFSQYLHR
GLNE_NITEU      -----------------------MST-----------PIDSSRAASIVASILPYSRYLKR
GLNE_BIFLO      SALAHACDPDMALSNFVDIVNAMQ-----SSQRDLEHVIPDNDALKRLVTVLGVSDAMGK
GLNE_LEIXX      PALLAAADPDTALRLALRLLRRAP-----DQA---AWFLRSWKDARRLLRVIGASEGAAE
GLNE_COREF      WALSGAGDPDVALNQLVRMYQTLESQSPQAREELDQRIRADEAFRVRLLALLGGSSAMGD
GLNE_CORGL      WGLSGAGDPDVALNLLIRLYQALEAIGEDARNELDQEIRQDEKLRVRLFALLGGSSAVGD
GLNE_CORDI      WHLSGTADPDLALNTIIRLMEALG----EQKGQLHNALRTDPELRVKLFSLLGASTALGD
GLNE_MYCBO      WSLSRAPDADAALRALIRLSENPD----TGWDELNAALLRERSLRGRLFSVLGSSLALGD
GLNE_MYCTU      WSLSRAPDADAALRALIRLSENPD----TGWDELNAALLRERSLRGRLFSVLGSSLALGD
GLNE_MYCPA      WALSRAPDPDAALLALVRLAETPD----AGWDELGAALLTERPLRGRLFAVLGSSLALGD
GLNE_MYCLE      WSLSRAPDADAVLRPMVRLFENPA----TGWDELNAALLTDRGLRGRLFAVLGSSLALGD
GLNE_NOCFA      WALSRAPDADLALNTLMRLREALG----SDWQRLDSAIRTDTSLRGRLFALLGSSTALGD
GLNE_STRAW      --LGATADPDLALLGLVRLVEAQDDH--TARRELLDTLIAAKPLRDRLLGVLGASAALAD
GLNE_STRCO      --LGATADPDLALHGLVRLLEAQPDA--TARQELLDTLIAAKPLRDRLLGVLGASEALAD
GLNE_CUTAK      HHLETCCDPDLALNVLAEL--AQDSA--QCLGEVLDHDASAC----RLVRLLGASSELGR
                                                                      *     

GLNE_AGRFC      MA---AADEGLLTLAISKPLEPLLTDLVRDARDCWK-PAE--------------------
GLNE_RHIME      TA---RSHPAILEALLSETLPAFLKRRIEAARVAWRGDAA--------------------
GLNE_BARHE      VL---IANPSYLSPLLYVDIETRLSEIIEDITLIDK------------------------
GLNE_BARQU      VL---IANPSYLSPLLYVDIETRLSEIIDDVALIDK------------------------
GLNE_BRUME      AL---TRQPRILDRIVSATPESALEAILDEISASGT------------------------
GLNE_BRUSU      AL---TRQPRILDRIVSATPESALEAILDEISASGT------------------------
GLNE_RHILO      TS---RRRPRILDALFDQPVEARLEAITAAIEQAPL------------------------
GLNE_BRADU      LV---RADPLRLIRLLECDPDTHLAALIAEARGAVL------------------------
GLNE_RHOPA      LI---RGDPVRLLRVLRGAPEQRLAKLLEDAETFVA------------------------
GLNE_CAUVC      LA---RRDGKRLPRILGGDPGETLAAILAAAEAVAA------------------------
GLNE_PSEPK      LA---QREPAMLFALLASGELERRYAPGELRGQIAATA----------------------
GLNE_PSESM      QI---CRDPQMLLQLAGSGELERSFSVGELRGQIADAL----------------------
GLNE_PSEAE      QA---VRDSAMLLELAERGELENPHAPGELRSQLQARL----------------------
GLNE_ACIAD      VL---GLHQLYLEQDYQIDQFAAPLSRENIFQSVENEL----------------------
GLNE_ECOLI      SV---IAHPEWLTELES--QPPQADEWQHYAAWLQEAL----------------------
GLNE_SHIFL      SV---IAHPEWLTELES--QPPQADEWQHYSVWLQEAL----------------------
GLNE_ECOL6      SV---IAHPEWLTELES--QPPQADEWQHYASWLQEAL----------------------
GLNE_ECO57      SI---SAHPEWLTELES--QPPQADEWQHYVAWLQEAL----------------------
GLNE_SALTI      SV---IAHPEWLAELES--ASPQADEWRHYAGWLQEAL----------------------
GLNE_SALTY      SV---IAHPEWLAELES--ASPQADEWRHYAGWLQEAL----------------------
GLNE_YERPE      ML---LIHPQWLEELHQ--QPPQPQEWQYYSQWLSQAL----------------------
GLNE_YERPS      ML---LIHPQWLEELHQ--QPPQPQEWQYYSQWLSQAL----------------------
GLNE_PECAS      AL---ALHPDWWQGIHQ--QPPQPEEWQHYADWLSNAL----------------------
GLNE_PHOLL      NL---QAHPEWLVEIRQ--HPPEAQEWHQYTEWLQQLL----------------------
GLNE_VIBVU      TV---QRDAQLAESLPE--MLAQESRQEAYRTRLAEQL----------------------
GLNE_VIBVY      TV---QRDAQLAEGLPE--MLAQESRQEAYRTRLAEQL----------------------
GLNE_VIBPA      TI---HRDEALAQQLPT--MLSELSRHQAYRTRLAALL----------------------
GLNE_VIBCH      TL---QRDDPLCQVLPS--LLAKPSREQYYRSELAQWL----------------------
GLNE_PHOPR      SL---VCDGQLLLWLSE--HLDDKEHAEQYRQQLETKL----------------------
GLNE_SHEON      QL---TRSPEWINALFA--DDLQQVERKLFDAQLREQL----------------------
GLNE_HAEDU      TL---QKQADLRDDWQR--KLPTLADCGNYAERLTIYL----------------------
GLNE_MANHA      TL---QKQPDLLAEWLA--KFPTPDDCCNYTERLAKIL----------------------
GLNE_MANSM      IL---QKQPHFLAECWH--KTPQLADCDSYAARLSVQL----------------------
GLNE_PASMU      TL---QKQPHFLHQCWQ--QCPRLQDCEQYAERLTPLL----------------------
GLNE_HAEIN      VL---QKYPHLVKQWWE--KSPCFADCTAYIERLNKEL----------------------
GLNE_METCA      VV---KRDAHVIPLLAS--LFEGQTPERNPSADLQQRV----------------------
GLNE_XANAC      TL---ARQPALLQHLAQ-----------PDPPPLPLPQ----------------------
GLNE_XANCP      TL---ARQPALLAHLAQ-----------PDPPPLPVPR----------------------
GLNE_BORBR      RL---DAHPDLAAWLANACAHPVSANVLAAWQAELSGPDA--------------------
GLNE_BORPA      RL---DAHPDLAAWLANACAHPVSANVLAAWQAELSGPDA--------------------
GLNE_BORPE      RL---DAHPDLAAWLANACAHPVSANVLAAWQAELSGPDA--------------------
GLNE_BURMA      AA---AARPALAERIAAWAAAPVTRAALDARLDELLAQ-G--------------------
GLNE_BURPS      AA---AARPALAERIAAWAAAPVTRAALDARLDELLAQ-G--------------------
GLNE_RALSO      LA---QARAGWAERVQAAAAGPISVAWLSARFGELFEA-A--------------------
GLNE_NEIMA      QL---DNGKLKPEIFLPMLDKVLTEADFQAFADWDKIR----------------------
GLNE_NEIMB      QL---DNGKLKPEIFLPMLDKVLTEADFQAFADWGEIR----------------------
GLNE_CHRVO      LL---TARPEERQRLEQSLHHPFSLEDMQAFADWPALD----------------------
GLNE_NITEU      TL---ASEPGLQQELLDQLPNPFLWEEMLDFLQHPAIS----------------------
GLNE_BIFLO      FMRFKPQLVEAAAVDNCNSHLFNHAQRRARLLKAVGADPD--------------------
GLNE_LEIXX      F--FLRQPVELASLHRPVTALPTAAELREDLLDAVGA-----------------------
GLNE_COREF      H---LVANTHLWELLT--EEAPTRAEMFTAMLESVGATPAEVVPVDD------------E
GLNE_CORGL      H---LVANPLQWKLLK--LDAPSREEMFQALLESVKAQPA-VLEVED------------F
GLNE_CORDI      H---LVAHPHTWPELQ--RPMPTRQEMFRLMLGSVGAARASFSSESQQPQGSDSDSEFSF
GLNE_MYCBO      H---LVAHPQSWKLLRGKVTLPSHDQLQRSFVECVE------------------------
GLNE_MYCTU      H---LVAHPQSWKLLRGKVTLPSHDQLQRSFVECVE------------------------
GLNE_MYCPA      H---LVAQPRSWKLLRGNVSLPTHDELCAMFTGCVD------------------------
GLNE_MYCLE      H---LVAHPQSWKLLRGRVSLPSRTQLHQAFDECVSNFGD--------------------
GLNE_NOCFA      H---LVAEPAAWEVLR-RGDLPDRDELLADLLAAVQ---A--------------------
GLNE_STRAW      H---LARHPRDWQALVTYEPR--------------DLHPG--------------------
GLNE_STRCO      H---LARHAGDWQTLVTYEPR--------------DLHRG--------------------
GLNE_CUTAK      H---LIAHPDDLAEVIRDPVRLGHDEICDDLLEVVGAHKE--------------------
                                                                            

GLNE_AGRFC      ----------DAVPVEN----------EVMSRLRIAKRRLSFVAALADLARIFTAR----
GLNE_RHIME      ----------GAALPDA----------EIMTRLRRAKREVAFAVALADLSRLFGGR----
GLNE_BARHE      ----------NKSIHET----------TLMAALRRKKREAHVLIALADLGGVFTYE----
GLNE_BARQU      ----------SESINET----------ALMAALRRKKREAHILIALADLSGVFTYE----
GLNE_BRUME      ----------VAGVSES----------ELMTSLRQLKREAHVLIALCDLARIFNTE----
GLNE_BRUSU      ----------VAGVSES----------ELMTSLRQLKREAHVLIALCDLARIFNTE----
GLNE_RHILO      ----------AETVSES----------SLMMELRQCKAEAHFLIALADLAGEAETS----
GLNE_BRADU      -----------AAPDEA----------EVMRLLRRMKAEAALLTALCDIGGVWPVM----
GLNE_RHOPA      -----------AASAED----------EVMAALRRLKAEAALLIALCDIGGIWPVM----
GLNE_CAUVC      ------------EPDFE----------TARRVLRELKADLHLLTAISDLGGVWDLD----
GLNE_PSEPK      ----------QAAQSED----------ELARNLRRARNRQQLRIIWRDITRQAELG----
GLNE_PSESM      ----------SSAVTED----------ELGRNLRRQRARQQVRIIWRDLTRQADLI----
GLNE_PSEAE      ----------EDCADED----------ELGRRLRRFRTRQQLRIIWRDLTRRAALA----
GLNE_ACIAD      ----------KDIQDES----------QWMRVVRILRARLMFRWIWQDANRLTNVV----
GLNE_ECOLI      ----------CNVSDEA----------GLMRELRLFRRRIMVRIAWAQTLALVTEE----
GLNE_SHIFL      ----------SNVSDEA----------GLMRELRLFRRRIMVRIAWAQTLALVTEE----
GLNE_ECOL6      ----------SNVSDEA----------GLMRELRLFRRRIMVRIAWAQTLALVTEE----
GLNE_ECO57      ----------INVSDEA----------GLMRELRLFRRRIMVRIAWAQTLALVTEE----
GLNE_SALTI      ----------AGVCDDA----------SLMRELRLFRRRIMVRIAWAQTLSLVDDE----
GLNE_SALTY      ----------AGVCDDA----------SLMRELRFFRRRIMVRIAWAQTLSLVDDE----
GLNE_YERPE      ----------AGVQDEA----------ALLTALRLFRRRVMVRIAWSQVLQTSGTA----
GLNE_YERPS      ----------AGVQDEA----------ALLTALRLFRRRVMVRIAWSQVLQTSGTA----
GLNE_PECAS      ----------VDVNDEN----------ALMAALRRFRRHMLARIAWSQALQTSTTE----
GLNE_PHOLL      ----------ASVEDEN----------TLMRVLRQFRNKILVRIAWSQALHSITTQ----
GLNE_VIBVU      ----------QACHDEV----------AGHRVLRQFRNREMVYIAWKDFTQAWSLE----
GLNE_VIBVY      ----------QACHDEV----------AGHRVLRQFRNREMVYIAWKDFTQAWSLE----
GLNE_VIBPA      ----------AECPDEM----------SGHRVLRQFRNREMVYIAWKDFLHAWTLE----
GLNE_VIBCH      ----------AECQDEA----------VAQKRLRQFRNQEMVYIAWRDFCASWTLE----
GLNE_PHOPR      ----------ATTADDV----------GLMRQLRAFRRQEMVWIAWRDFTNKSTLE----
GLNE_SHEON      ----------ASATTED----------MAKRLLRRFRNYQMVRFAWRDFLDYASLE----
GLNE_HAEDU      ----------STINDEV----------QLSHCLRNFRHREMARLSFIQSNKLATVE----
GLNE_MANHA      ----------ARVPNEE----------MLGRVLRQFRHRELARLSFIQSNKLATVE----
GLNE_MANSM      ----------ADIREET----------GLYKTLRDFRNQEMAKLSICQSLNSATVE----
GLNE_PASMU      ----------AQVENEE----------QLYKVLRQFRHREMAKLSFCQSLNLGSVE----
GLNE_HAEIN      ----------ANVHDET----------ALYQTLRQFRNIEMAKLSFCQSLNLATVE----
GLNE_METCA      ----------AEVADRN----------GLMRVLRQWRNREMAIIAWQDICGLLDID----
GLNE_XANAC      ----------FDPAQPQ----------LWPAQLRRYRSAESTRLVWRDVLGLDSVE----
GLNE_XANCP      ----------LDPAQPQ----------EWAAQLRRYRAAASARLVWRDVLGLDDVD----
GLNE_BORBR      ----------PEVLPVE----------QCRGMLRKLRERVFLTLIVRDLGGQADLE----
GLNE_BORPA      ----------PEVLPVE----------QCRGMLRKLRERVFLTLIVRDLGGQADLE----
GLNE_BORPE      ----------PEVLPVE----------QCRGMLRKLRERVFLTLIVRDLGGQADLE----
GLNE_BURMA      ----------GQPPSED----------ALKKALRQLRGEAFGAVAERDLAGRADVA----
GLNE_BURPS      ----------GQPPSED----------ALKKALRQLRGEAFGAVAERDLAGRADVA----
GLNE_RALSO      ----------AAEP-EQ----------ALKRALRLLRNEVFAALAERDLSGAATLD----
GLNE_NEIMA      -----------AEENEE----------ELARQLRELRRYVVSQIIVRDINRISDLN----
GLNE_NEIMB      -----------AEENEE----------ELARQLRELRRYVVSQIIVRDINRISDLN----
GLNE_CHRVO      -----------APE-------------ALAPALRRLRQAVVARLICRDLESLATLD----
GLNE_NITEU      -----------LED-EA----------DLHRLLRQLRKRVILRLAARDLAGLADLN----
GLNE_BIFLO      -----EPAMPVASKDLA----------EAATALRSSYRNQLAAIIAQDAVAD--------
GLNE_LEIXX      -------VGGFASVAEE----------EAWTALRVRYRRRLVQLASFDLEQD--------
GLNE_COREF      GEERQVANTATEDLTTPGTYRATLTGVDAERALRFTYRTLMMRLAALDLAGTYPNDARRR
GLNE_CORGL      SDAH---NIARDDLSTPGFYTASVTGPEAERVLKWTYRTLLTRIAAHDLAGTYPTDMRRK
GLNE_CORDI      GADLSADDTANTDLSTPGTYRAEITGERAEVALKTTYRSLLLRIAAADLAGTYPEDIHRT
GLNE_MYCBO      -------ESEGMPGS-------------LVHRLRTQYRDYVLMLAALDLAATVEDE----
GLNE_MYCTU      -------ESEGMPGS-------------LVHRLRTQYRDYVLMLAALDLAATVEDE----
GLNE_MYCPA      -------EALADPGS-------------AMVRLRTLYRDRLLVLAALDLAATVEDE----
GLNE_MYCLE      -------DPLDAPDS-------------VLPRLRTLYCDQLLVLAALDLAATVEDE----
GLNE_NOCFA      -------TPEAGPHAGPMLFRAGIAGPEAVALLRCRYRDQLMLLAALDLAATVENE----
GLNE_STRAW      ------VEEFERGLAEA----------ADPVSLRVAYRRCLLSIAARDVCG---------
GLNE_STRCO      ------VEEFERGLAEA----------TDPVTLRVAYRRCLLSIAARDVCG---------
GLNE_CUTAK      ------GEFTVAGTPTG----------PASDRLRLANRRHLVRIASRDVSAD--------
                                                ::             :            

GLNE_AGRFC      --------DTTRWLSEMADASLSAAIDHLLLSAHESGKLKLKNLAAPSEGSGLIVLGMGK
GLNE_RHIME      --------ETTGWLSDFAEAAVSAAIDHLLLGAHESGKFVLKDSSAPSTASGVVVLGMGK
GLNE_BARHE      --------ISCAWLTRLGEAALGVALRFLLREAHDHGKINLSNREDPEKDCGLIILGMGK
GLNE_BARQU      --------ISCTWLTRLGEAALGVALRFLLREAHDHGKISLSSRDNPEKDSGLIILGLGK
GLNE_BRUME      --------TTTDRLTDLAEACTGAAVRFLLLDADAAGRINLPDRSNPEKDCGWIVLGMGK
GLNE_BRUSU      --------TTTDRLTDLAEACTGAAVRFLLLDADAAGRINLPDRSNPEKDCGWIVLGMGK
GLNE_RHILO      --------LTVRRLSDLADACTRAAVDFLLRDAHGQGKLKLPDLDNPSLQSGWILLGMGK
GLNE_BRADU      --------RVTSALTDVAVSSVQAALQYLLRQEAARGKLFPPNPEAPEEGCGLIVLAMGK
GLNE_RHOPA      --------QVTQALTDLAGRSVQMALRFLLRQEAGRGRIVPPNPDCPEQGSGLIVLAMGK
GLNE_CAUVC      --------QVTGALTRFADAVLHAALAQAVRQEVSRGALTHVGDGSAGPAPGLFCVAMGK
GLNE_PSEPK      --------ETCRDLSDLADAAIDEAYQWLYPRHCQQ--FGTPIGNRSGQPQHMVVLGMGK
GLNE_PSESM      --------ETCRDLSEMADASIDLAYQWLYPRHCQQ--FGTPTGRHCGLPQQMVILGMGK
GLNE_PSEAE      --------ETCRDLSALADACIDLACEWLHRRQCEQ--FGTPIGRRSGEPQRMVVLGMGK
GLNE_ACIAD      --------SLTRELSDFADACICAAKQFARAPLVAK--HGEPVG-YDGQIQDLIVIGMGK
GLNE_ECOLI      --------SILQQLSYLAETLIVAARDWLYDACCRE--WGTPCN-AQGEAQPLLILGMGK
GLNE_SHIFL      --------SILQQLSYLAETLIVAARDWLYDACCRE--WGTPCN-AQGEAQPLLILGMGK
GLNE_ECOL6      --------SILQQLSHLAETLIVAARDWLYDACCRE--WGTPCN-AQGEAQPLLILGMGK
GLNE_ECO57      --------SILQQLSYLAETLIVAARDWLYDACCRE--WGTPCN-AQGEAQPLLILGMGK
GLNE_SALTI      --------TILQQLSHLAETLIVGARDWLYAACCRE--WGTPCN-PQGVPQPLLILGMGK
GLNE_SALTY      --------TILQQLSHLAETLIVGARDWLYAACCRE--WGTPCN-PQGVPQPLLILGMGK
GLNE_YERPE      --------ETLQQLSTLAESMIIAARDWLYQVCCRE--LGTPCN-RQGVPQPLLILGMGK
GLNE_YERPS      --------ETLQQLSTLAESMIIAARDWLYQVCCRE--LGTPCN-RQGVPQPLLILGMGK
GLNE_PECAS      --------HSLRQLSELAEVIIVAARSWLYQVCCHE--WGTPCN-AKGVAQPLLILGMGK
GLNE_PHOLL      --------ETLQQLSMLAETLIIAARDWLYQRCCQD--WGTPCN-ERGEPQPLLIIGMGK
GLNE_VIBVU      --------ESLSHLSELAEAMIFETYQWQYQLCCKE--WGTPTN-AQGEAQPMLIIGMGK
GLNE_VIBVY      --------ASLSHLSELAEAMIFETYQWQYQLCCQE--WGTPTN-AQGEAQPMLIIGMGK
GLNE_VIBPA      --------ESLRHLSQLAEAMIFETYQWQYKICCAE--WGTPTN-AEGEAQPMLIIGMGK
GLNE_VIBCH      --------ESLSHLSQLAEALIFESYQWLYQRCCLE--MGTPCN-AQGEAQPMLIIGMGK
GLNE_PHOPR      --------QSLAHLSQLAEALIMEAYQWLYNQCCKE--WGTPTN-SAGEAQPMLVLGMGK
GLNE_SHEON      --------ESLLDLSALAEALVIGARDWLYKEMCVQ--YGTPMD-KAGNPQPLLILGMGK
GLNE_HAEDU      --------FVFEQLSDLAEAIILAARDWLFTRCCAE--YGTPVN-GLGEIQPLLIIGMGK
GLNE_MANHA      --------LVFQHLSDLAESLILAARDWLFQRCCAE--YGTPKN-TLGETQELLILGMGK
GLNE_MANSM      --------EIFIRLSQLAEALIIGARDWLYQRACLD--WGTPTD-NQGNVQQLYILGMGK
GLNE_PASMU      --------DIFIRLSQLAESVIIGARDWLYQRACAE--MGTPVD-EQGTPLQLYILGMGK
GLNE_HAEIN      --------EIFVQLSQLAESLIIAARDWLYHQACAE--IGTPMD-EQGNPQQLYILGMGK
GLNE_METCA      --------SVLTRISETAESAIRTALDWLFDDACRR--WGVPRR-KDGSAQSLVVLGMGK
GLNE_XANAC      --------ATLAGATQLAEHCLQCGLQALEQQFHTR--HGKVVA-ADGSVQRLVVFGLGK
GLNE_XANCP      --------ATLAGATTLAETCLQCALQALEQQFSTR--HGQVIA-EDGSVQRLVVFGLGK
GLNE_BORBR      --------EVVGAMTVLADIAVGTAYRSVAAELAAV--HGLPREQSTGDPQEMLIVGMGK
GLNE_BORPA      --------EVVGAMTVLADIAVGTAYRSVAAELAAV--HGLPREQSTGDPQEMLIVGMGK
GLNE_BORPE      --------EVVGAMTVLADIAVGTAYRSVAAELAAV--HGLPREQSTGDPQEMLIVGMGK
GLNE_BURMA      --------EVTGTMTDLAEAAIQRALALLAAELEAQ--YGEPRG-PSGERLALGVVGMGK
GLNE_BURPS      --------EVTGTMTDLAEAAIQRALALLAAELEAQ--YGEPRG-PSGERLALGVVGMGK
GLNE_RALSO      --------EVTGAMTDFAEFAVRAAIAVIGQELGAL--HGQPVGQSSGEVQELVVVGMGK
GLNE_NEIMA      --------EVTRTITLFADFAVNTALDFAYAYYRDM--YGTPIGRYTKSPQHLSVVAMGK
GLNE_NEIMB      --------EVTRTITLFADFAVNTALDFAYAYYRDM--YGTPIGRYTKSPQHLSVVAMGK
GLNE_CHRVO      --------EVVSTISQLAEFAVRQALACAAASLPQ---YGRPIGEDSGEPQQLIVIGMGK
GLNE_NITEU      --------EVMTTMTALADTTIRFALEFLHTAMTHPGHFGKPTGEKTGTEQQLLIVAMGK
GLNE_BIFLO      -DPASIQPTISRELSDLADAALEGALAIARHETEGS------------EHVRFTIIGMGK
GLNE_LEIXX      -DPVAGFDGVAAALSDLAGAALDASLAVARRQASGSGPGRFPEA--EVRATRFAIIGMGK
GLNE_COREF      SQPRVEFTTVTRRLSNLADAALTAALAVAVTGVYGQKPV----------DARLSVMAMGK
GLNE_CORGL      GGDPVPFSTVTMQLSDLADAALTAALAVAIANVYGEKPV----------DSALSVIAMGK
GLNE_CORDI      GLPEVPFVTVTKALADLADAALTAALAVAVAHVYPEGEV----------DTHLAVMAMGK
GLNE_MYCBO      --PVLPFTVVAARLADAADAALAAALRVAEASVCGEHP-----------PPRLAVIAMGK
GLNE_MYCTU      --PVLPFTVVAARLADAADAALAAALRVAEASVCGEHP-----------PPRLAVIAMGK
GLNE_MYCPA      --PVLPFTVVAAHLSDLADAALAAALRVAEHNVCGDRT-----------PPRLAVIAMGK
GLNE_MYCLE      --PVLPFTLVAAQLADIADAAMATALRVAEKIVCGDRT-----------PPRLAVIAMGK
GLNE_NOCFA      --PVLPYRVVGRHLTDLADAALTAALAVAVARVCKDQPC----------PVRLAVIAMGK
GLNE_STRAW      ---TTDLAQTAAELADLATATLRAALLIARTAAP-DDAA----------ICRLAVIAMGK
GLNE_STRCO      ---TIDVAETAAELADLAIATLRAALALAEAAAP-EDAA----------RCRLAVIAMGK
GLNE_CUTAK      -DPTEIIEDVAAELADLADGIVTAALALARADCP-DHAD-----------ARLAIIAMGK
                              :  .                                     ..:**

GLNE_AGRFC      LGARELNYSSDIDAVVFFEPSAG------IIDDPYDATENFGRMMRRLVRIMQERTA---
GLNE_RHIME      LGAGELNYSSDIDLVVFYDPQSS------IITNRDDAPETFARLLRRLIRILQERTG---
GLNE_BARHE      FGAGELNYSSDIDLIVFIDEMSP------HVGNLSESIDVFSKMVRRLIRIIQERTA---
GLNE_BARQU      LGAGELNYSSDIDLIVFIDEMSP------HIGDLSESVDVFSKMVRRLIRIIQERTA---
GLNE_BRUME      FGARELNYSSDIDLIVFIDETKP------AIGDPYECVDTFSRLTRRLVRILQDRTG---
GLNE_BRUSU      FGARELNYSSDIDLIVFIDETKP------AIGDPYECVDTFSRLTRRLVRILQDRTG---
GLNE_RHILO      LGAHELNFSSDIDLVVFFDPDAP------AVVDRLDATELFSRLTRRLVRILQDRTE---
GLNE_BRADU      MGAGELNYSSDIDLIVFFDPDAT------TLAPDIEPQPFFVRVTQGMARILQQRTY---
GLNE_RHOPA      MGAGELNYSSDIDLIVFYELDAP------TLAPDIEPQPFFVRVTQGLSRILQQRRG---
GLNE_CAUVC      HGAFELNYSSDIDFSIFYAPEKL------PVAEGHEPQAVAVRIANHLGRILQERTG---
GLNE_PSEPK      LGAVELNLSSDIDLIFGFPEGG----ETEGVKRSLDNQEFFTRLGQRLIKALDPVTV---
GLNE_PSESM      LGAVELNLSSDIDLIFAYPEGG----ETVGTKRALDNQEFFIRLGQRLIKALDPVTV---
GLNE_PSEAE      LGAVELNLSSDIDLIFGYPEGG----ETEGAKRSLDNQEFFTRLGQKLIKALDAITV---
GLNE_ACIAD      LGAQELNLSSDIDLIFAYDEQG----ETNG-RKSIDVQQFCILWGQKLIYLLDHITA---
GLNE_ECOLI      LGGGELNFSSDIDLIFAWPEHG----CTQGGRRELDNAQFFTRMGQRLIKVLDQPTQ---
GLNE_SHIFL      LGGGELNFSSDIDLIFAWPEHG----CTQGGRRELDNAQFFTRMGQRLIKVLDQPTQ---
GLNE_ECOL6      LGGGELNFSSDIDLIFAWPEHG----CTQGGRRELDNAQFFTRMGQRLIKVLDQPTQ---
GLNE_ECO57      LGGGELNFSSDIDLIFAWPEHG----CTQGGRWELDNAQFFTRMGQRLIKVLDQPTQ---
GLNE_SALTI      LGGGELNFSSDIDLIFAWPEHG----ETRGGRRELDNAQFFTRLGQRLIKALDQPTM---
GLNE_SALTY      LGGGELNFSSDIDLIFAWPEHG----ETRGGRRELDNAQFFTRLGQRLIKALDQPTM---
GLNE_YERPE      LGGGELNFSSDIDLIFAYPENG----QTQGGRRELDNAQFFTRLGQRLIKALDQHTI---
GLNE_YERPS      LGGGELNFSSDIDLIFAYPENG----QTQGGRRELDNAQFFTRLGQRLIKALDQHTI---
GLNE_PECAS      LGGGELNFSSDIDLIFVYPENG----HTQGGRRELDNAQFFTRLGQRLIKVLDQPTV---
GLNE_PHOLL      LGGGELNFSSDIDLIFVYPENG----ITQGGRREMDNTQFFTRLGQHLIKVLDQQTV---
GLNE_VIBVU      LGGGELNFSSDIDLIFTYPENG----ETQGARRSIANAQFFTRLGQRLIKALDQQTF---
GLNE_VIBVY      LGGGELNFSSDIDLIFTYPENG----ETQGARRSIANAQFFTRLGQRLIKALDQQTF---
GLNE_VIBPA      LGGGELNFSSDIDLIFTYPENG----ETQGARRSIANAQFFTRLGQRIIKALDQQTF---
GLNE_VIBCH      LGGGELNFSSDIDLIFTYPENG----ETQGARRSIANAQFFTRLGQRLIKLLDQSTP---
GLNE_PHOPR      LGGGELNFSSDIDLIFTYPENG----DTVGGRRSMANAQFFTRLGQRLIKALDQPTY---
GLNE_SHEON      LGGRELNFSSDIDLIFTFPEHG----ETVGGRRSLDNQQFFIRMGQRLVNLLDQITV---
GLNE_HAEDU      LGGRELNFSSDIDLIFTYPEAG----QTVGGHKTIENSKFFTRLGQRLIKALDEITV---
GLNE_MANHA      LGGRELNFSSDIDLIFTYPDIG----ETEGGRKSIENSKFFTRMAQRLIKVLDEITA---
GLNE_MANSM      LGGFELNFSSDIDLIFTYPANG----ETVGSRKPIDNQKFFTRLGQRLISALDEFTE---
GLNE_PASMU      LGGFELNFSSDIDLIFTYASNG----ETVGARRSIDNAKFFTRLGQRLINALDQYTC---
GLNE_HAEIN      LGGFELNFSSDIDLIFTYPSQGETSVENTNARRSVDNGKFFTRLGQRLISALDEFTS---
GLNE_METCA      LGGYELNFSSDIDLVFAYVEDG-----ELPGRNGATYAEFYTRLAQSLVHVLDAVTE---
GLNE_XANAC      LGGGELNFSSDVDLVYAYPQGG-----QSDGARPLAAEEYFARLGQQLARLLDETTA---
GLNE_XANCP      LGGGELNFSSDVDLVYAYPQAG-----QSDGARPLAAEEYFARLGQQLARLLDETTA---
GLNE_BORBR      LGGRELNVSSDIDLVMLYGDEGE---TDGPRR--ISNHEFYGRLTRRMMPVLSEVDA---
GLNE_BORPA      LGGRELNVSSDIDLVMLYGDEGE---TDGPRR--ISNHEFYGRLTRRMMPALSEVDA---
GLNE_BORPE      LGGRELNVSSDIDLVMLYGDEGE---TDGPRR--ISNHEFYGRLTRRMMPVLSEVDA---
GLNE_BURMA      LGGRELNVSSDIDLIFVYEDDGE---TAGGARAPISVHEFFTRLGRRLIGVLSEATA---
GLNE_BURPS      LGGRELNVSSDIDLIFVYEDDGE---TAGGARGPISVHEFFTRLGRRLIGVLSEATA---
GLNE_RALSO      LGGRELNVSSDIDLIFLYDEEGD---TQGGPR-PLSNHEYFTKLGRRLINALADVTE---
GLNE_NEIMA      AGGYELNVSSDIDLIFVYPESGD---TDGRRE--RGNQEFFTKVGQKLIALLNDITA---
GLNE_NEIMB      AGGYELNVSSDIDLIFVYPESGD---TDGRRE--RGNQEFFTKVGQKLIALLNDITA---
GLNE_CHRVO      LGGGELNVSSDIDLIFIYPEGGE---TDGARK--ISNHEYFTQVGKRLIALLNDATA---
GLNE_NITEU      LGGGELNVSSDVDLIFIYPEDGE---TDGRKS--ITNHEFFVRLGRKLIASLSDYTV---
GLNE_BIFLO      LGAQELNYVSDVDLIYVVEPA-DK-----DVDHQ-TLIRVGTKMGTMLQRVCQSAIMGVA
GLNE_LEIXX      AGARELNYVSDVDVIYVTDGAEDA-----GVPPG-RAVDIATRLAVLTQRGIQDPAL---
GLNE_COREF      CGAQELNYISDVDVIFIAEPAHS----------------RSTRLAAEFIRTGCS------
GLNE_CORGL      CGAQELNYISDVDVVFVAEPANS----------------KSTRTAAELIRIGSN------
GLNE_CORDI      CGAQELNYISDVDVIFVAEPVTP----------------KAIRLAGEFIRIGCA------
GLNE_MYCBO      CGARELNYVSDVDVIFVAERSDP----------------RNARVASEMMRVASA------
GLNE_MYCTU      CGARELNYVSDVDVIFVAERSDP----------------RNARVASEMMRVASA------
GLNE_MYCPA      CGARELNYVSDVDVIFVGERADT----------------VTTRVASEMMRLASE------
GLNE_MYCLE      WGARELNYVSDVDIIFVAEQADP----------------LSTRVASEMMRVASE------
GLNE_NOCFA      CGARELNYVSDVDVVFVAEPADA----------------TATRLAAEMMSVGSQ------
GLNE_STRAW      CGGHELNYVSDVDVIFVGEPAN--------GADEGKAVQAATRLASHMMRICSETTV---
GLNE_STRCO      CGGHELNYVSDVDVIFVGEAADTG-----PDADEAKAMRAATSLAAHMMRICSETTV---
GLNE_CUTAK      CGAQELNYISDVDVMYVAEPAND-------DVSGASAVTIATKLAASVARMCSAHSG---
                 *. ***  **:*                                               

GLNE_AGRFC      DGYVFRTDLRLRPDPGSTPLAIPVEAALLYYEGRGQNWERAAYIKARPVAG-------DI
GLNE_RHIME      DGYVFRTDLRLRPDPGSTPLAIPVEAAMLYYESRGQNWERAAFIKARPIAG-------DL
GLNE_BARHE      EGYVFRLDFRLRPDPGSTPLALPVRTALRYYEGRGQNWERAAMIKARPVAG-------DK
GLNE_BARQU      EGYVFRLDFRLRPDPGSTPLALPVRTALRYYEGRGQNWERAAMIKARPVAG-------DK
GLNE_BRUME      DGYVFRVDLRLRPDPGSTPLAIPVGAALHYYEGRGQNWERAAMIKARPVAG-------DR
GLNE_BRUSU      DGYVFRVDLRLRPDPGSTPLAIPVGAALHYYEGRGQNWERAAMIKARPVAG-------DR
GLNE_RHILO      HGYVFRTDLRLRPDPGSTPLAIPVEAALRYYEARGQNWERAAMIKARPVAG-------DL
GLNE_BRADU      DGYVFRVDLRLRPDPSSTQVAISRDAALHYYEREGRTWERAAMIKARACAG-------DA
GLNE_RHOPA      DGYVFRVDLRLRPDPASTPVALSTVSALDYYEREGRTWERAAMIKARPCAG-------DL
GLNE_CAUVC      DGYVFRIDLRLRPDPSSTPPAMPVDAAMDYYESVGQNWERAAHIKARIAAG-------DA
GLNE_PSEPK      DGFVFRVDMRLRPYGSAGALVLSFNALEQYYQDQGRDWERYAMIKARVVA-------GDQ
GLNE_PSESM      DGFVFRVDMRLRPYGSSGALVLSFNALEQYYQDQGRDWERYAMIKARVVG-------GDL
GLNE_PSEAE      DGFVFRVDMRLRPYGSSGPLVYSFAALEQYYQDQGRDWERYAMIKARVVG-------GDQ
GLNE_ACIAD      DGFVFRVDMRLRPWGDGSALAISHMALEKYLIQHGREWERYAWIKARIIS-------GGK
GLNE_ECOLI      DGFVYRVDMRLRPFGESGPLVLSFAALEDYYQEQGRDWERYAMVKARIMG------DSEG
GLNE_SHIFL      DGFVYRVDMRLRPFGESGPLVLSFAALEDYYQEQGRDWERYAMVKARIMG------DSEG
GLNE_ECOL6      DGFVYRVDMRLRPFGESGPLVLSFAALEDYYQEQGRDWERYAMVKARIMG------DSDG
GLNE_ECO57      DGFVYRVDMRLRPFGESGPLVLSFAALEDYYQEQGRDWERYAMVKARIMG------DSEG
GLNE_SALTI      DGFVYRVDMRLRPFGDSGPLVLSFAALEDYYQEQGRDWERYAMVKARLMG------DNDD
GLNE_SALTY      DGFVYRVDMRLRPFGDSGPLVLSFAALEDYYQEQGRDWERYAMVKARLMG------DNDD
GLNE_YERPE      DGFVYRVDMRLRPFGDSGPLVLSFAALEDYYQEQGRDWERYAMVKARLMG------GADD
GLNE_YERPS      DGFVYRVDMRLRPFGDSGPLVLSFAALEDYYQEQGRDWERYAMVKARLMG------GADD
GLNE_PECAS      DGFVYRVDMRLRPFGDSGPLVLSFAAMEDYYQEQGRDWERYAMVKARLMG------GMDD
GLNE_PHOLL      DGFVYRVDMRLRPFGDSGPLVFSFVALEDYYQEQGRDWERYAMVKARIMG------SDNQ
GLNE_VIBVU      DGFCYRVDMRLRPFGESGPLVMSYAALEDYYQEQGRDWERYAMIKARVMG------REMY
GLNE_VIBVY      DGFCYRVDMRLRPFGESGPLVMSYAALEDYYQEQGRDWERYAMIKARVMG------REMY
GLNE_VIBPA      DGFCYRVDMRLRPFGESGPLVMSYAALEDYYQEQGRDWERYAMIKARVMG------CEMY
GLNE_VIBCH      DGFCYRVDMRLRPFGDSGPLAMSYAALEDYYQEQGRDWERYAMIKARVMG------REMY
GLNE_PHOPR      DGFCYRVDMRLRPFGDSGPLVMSYAALEDYYQEQGRDWERYAMIKARVMG------RESF
GLNE_SHEON      DGFVFRVDMRLRPYGESGPLVVSFSGLEDYYQEQGRDWERYAMVKARSLG------PWN-
GLNE_HAEDU      DGFVYRTDMRLRPFGDNGALVLSFAAMEDYYQEQGRDWERYAMIKAKILGE-----DLTD
GLNE_MANHA      DGFVYRTDMRLRPFGDSGRLVLSFTAMEDYYQEQGRDWERYAMIKAKILGE-----DSQN
GLNE_MANSM      DGFVYRTDMRLRPFGDSGALALSFNAMESYYQEQGRDWERYAMIKGRILGA-----DEQD
GLNE_PASMU      DGFVYRTDMRLRPFGENGALALSFAAMELYYQEQGRDWERYAMIKGRILGA-----NAQD
GLNE_HAEIN      DGFVYRTDMRLRPFGDSGVLVLSFSAMEQYYQDQGRDWERYAMIKGRVLGA-----QTKD
GLNE_METCA      DGFVFRVDVRLRPFGESGPLVVSFDSCERYYQAQARDWERYAMVKVRAVG-------GDA
GLNE_XANAC      DGFSHRVDLRLRPFGTAGRVALSFAGMDQYFQREGRDWERYAWLKARAVA-------GDI
GLNE_XANCP      DGFSHRVDLRLRPFGSAGRVALSFNGMDQYFQREGRDWERYAWLKARAVA-------GDI
GLNE_BORBR      DGQVFRTDLRLRPDGDAGPLAWSLDALEHYLIGQGREWERYAWLKARLMPAQAFADSNPD
GLNE_BORPA      DGQVFRTDLRLRPDGDAGPLAWSLDALEHYLIGQGREWERYAWLKARLMPAQAFADSNPD
GLNE_BORPE      DGQVFRTDLRLRPDGDAGPLAWSLDALEHYLIGQGREWERYAWLKARLMPAQAFADSNPD
GLNE_BURMA      DGYVFRVDMRLRPNGDSGPLVCSLGMLEEYFYVQGREWERYAWIKGRLVTERASA--AAR
GLNE_BURPS      DGYVFRVDMRLRPNGDSGPLVCSLGMLEEYFYVQGREWERYAWIKGRLVTERASA--AAR
GLNE_RALSO      DGYVFRVDMRLRPNGDAGPLACSLGMLEEYFVVQGREWERYAWIKGRVITDPGSP--HAA
GLNE_NEIMA      DGQVFRVDMRLRPDGDSGALVLSETALEQYLITQGREWERYAWCKGRVVTP------YPN
GLNE_NEIMB      DGQVFRVDMRLRPDGDSGALVLSETALEQYLITQGREWERYAWCKGRVVTP------YPN
GLNE_CHRVO      DGQVFRVDMRLRPYGDSGPLVMSFAALENYLLSQGREWERYAWIKAKAITG------DAD
GLNE_NITEU      DGYVFRVDMRLRPHGENSPLAISLPMLEDYFITQGREWERHAWIKSRVITG------SSV
GLNE_BIFLO      EQPLWQIDGGLRPEGKDGALVRVLSSHKNYYEQWAENWEFQALLKARPVAG-------DP
GLNE_LEIXX      EPGLWEVDSNLRPEGRDGALVRTLDSHLAYYDRWAKGWEFQALLKARSLAG-------DW
GLNE_COREF      --SFFEVDAALRPEGKSGALVRTLESHIAYYKRWAETWEFQALLKARPMTG-------DM
GLNE_CORGL      --SFFEVDAALRPEGKSGALVRSLDSHMAYYKRWAETWEFQALLKARPMTG-------DI
GLNE_CORDI      --CFFEVDAALRPEGKHGVLVRTLDSHVAYYKRWAETWEFQALLKHRPMTG-------YM
GLNE_MYCBO      --AFFEVDAALRPEGRNGELVRTLESHIAYYQRWAKTWEFQALLKARPVVG-------DA
GLNE_MYCTU      --AFFEVDAALRPEGRNGELVRTLESHIAYYQRWAKTWEFQALLKARPVVG-------DA
GLNE_MYCPA      --AFFQVDAGLRPEGRSGELVRTVESHIAYYQRWAKTWEFQALLKARAAVG-------DA
GLNE_MYCLE      --AFFQVDAGLRPEGRNGELVRTVESHIAYYQRWAKTWEFQALLKARSAVG-------DA
GLNE_NOCFA      --AFFEVDAALRPEGKQGALVRTLDSHLTYYKRWARTWEFQALLKNRPMTG-------DL
GLNE_STRAW      EGTIWPVDANLRPEGRNGPLVRTLSSHLAYYQRWAKTWEFQALLKARPVAG-------DI
GLNE_STRCO      EGSIWPVDANLRPEGRNGPLVRTLSSHVAYYQRWAKTWEFQALLKARPVAG-------DP
GLNE_CUTAK      AGSIWQVDAALRPEGNAGPLVRTMDSMRTYYEKWAKNWEFQALLKARPMAG-------DL
                       *  ***       .        *    .. **  *  * :             

GLNE_AGRFC      KAGENFLRELTPFIFRKYLDYAAIADIHSIKRQIHAHKGHGA-------------IAVKG
GLNE_RHIME      EAGERFLKELTPFVFRKYLDYAAIADIHSIKRQIHAHKGHGE-------------IAVKG
GLNE_BARHE      SAGFNFLKELFPYVWRKYLDYAAIADIHSIKRQIHAYKNYDQ-------------ISAYG
GLNE_BARQU      RAGFKFLKELFPYVWRKYLDYAAIADIHSIKRQIHACKNYGQ-------------ITAYG
GLNE_BRUME      LSGKQILAELSPYVWRKYLDYAAIADVHSIKRQIHAHKGHGD-------------IAVRG
GLNE_BRUSU      LSGKQILAELSPYVWRKYLDYAAIADVHSIKRQIHAHKGHGD-------------IAVRG
GLNE_RHILO      AAGAAFLRELQPYIWRKYMDYAAIADVHSIKRQIHAHKGHGE-------------IAVKG
GLNE_BRADU      RAGEALLAEIAPFVWRKHLDFAALADVHDMKRQMQTYRGQSE-------------VAVEG
GLNE_RHOPA      VAGDALLSEIAPFVWRKHLDFAALSDVHDMKRQMQTYRGQTE-------------IAVEG
GLNE_CAUVC      AEGAAFLEGLQPFIWRRNLDFAAIADIHSIKRQIHTYKVDDR-------------LTAKG
GLNE_PSEPK      AAGAQLQEMLRPFVYRRYLDFSAIEALRTMKQLIQQEVRRKG----------------MA
GLNE_PSESM      AAGAELLEMLRPFVYRRYLDFSAIEALRTMKQLIQQEVKRKG----------------MA
GLNE_PSEAE      QAGEQLLGMLRPFVYRRYLDFSAIEALRTMKQLIQQEVRRKG----------------MS
GLNE_ACIAD      -HGDDLLEMTRPFVFRRYVDYSAFAAMREMKSMIEREVARRN----------------IA
GLNE_ECOLI      VYANELRAMLRPFVFRRYIDFSVIQSLRNMKGMIAREVRRRG----------------LT
GLNE_SHIFL      VYANELRAMLRPFVFRRYIDFSVIQSLRNMKGMIAREVRRRG----------------LT
GLNE_ECOL6      VYANELRAMLRPFVFRRYIDFSVIQSLRNMKGMIAREVRRRG----------------LT
GLNE_ECO57      VYANELRAMLRPFVFRRYIDFSVIQSLRNMKGMIAREVRRRG----------------LT
GLNE_SALTI      AWSRELRAMLRPFVFRRYIDFSVIQSLRNMKGMIAREVRRRG----------------LK
GLNE_SALTY      AWSRELRAMLRPFVFRRYIDFSVIQSLRNMKGMIAREVRRRG----------------LK
GLNE_YERPE      PYSQELRQMLRPFVFRRYIDFSVIQSLRNMKGMIAREVRRRG----------------LK
GLNE_YERPS      PYSQELRQMLRPFVFRRYIDFSVIQSLRNMKGMIAREVRRRG----------------LK
GLNE_PECAS      AYSQELRSTLKPFVFRRYIDFSVIQSLRNMKGMIAREVRRRD----------------LR
GLNE_PHOLL      AYGEELRRMLRPFIFRRYIDFSVIQSLRNMKGMIEREVRHRG----------------LK
GLNE_VIBVU      PEYQELRQMLRPFVFRRYIDFSAIQSLRRMKSMISSEVRRRG----------------LS
GLNE_VIBVY      PEYQELRQMLRPFVFRRYIDFSAIQSLRRMKSMISSEVRRRG----------------LS
GLNE_VIBPA      PQYQELRKMLRPFVFRRYIDFSAIQSLRRMKSMISSEVRRRG----------------LT
GLNE_VIBCH      PQYQELRQMLRPFVFRRYIDFSAIQSLRRMKSMISSEVRRRG----------------LS
GLNE_PHOPR      TQYQELRQMLRPFVFRRYIDFSAIQALRRMKSMISSEVRRRG----------------LS
GLNE_SHEON      HFSDELHSLLRPFVYRRYIDFSAIESLRKMKQLIAQEVRRRQ----------------LT
GLNE_HAEDU      VNHRYLQQMLRPFVYRRYLDFSAIQSLREMKQKISREVLRRN----------------LQ
GLNE_MANHA      LNHRYLKQMLRPFVYRRYLDFSAIQSLREMKEKISREVVRRN----------------LT
GLNE_MANSM      PNVKTLRQLLRPFIYRRYIDFSVIQSLRDMKSKIEREVLRRG----------------LV
GLNE_PASMU      PHVNTLQQLLRPFVYRRYIDFSVLQALRDMKHKIEREVRRRG----------------LV
GLNE_HAEIN      PNVSKLKKMLRPFVYRRYIDFSVIQSLREMKGKIEREVRRRG----------------LK
GLNE_METCA      KDGREFERFFHPFVYRRYLDYRVFGELRSLKARIMAELRRKD----------------RG
GLNE_XANAC      DAGEAWLETLRPFVYRRYLDFTALDGLREMKAAITAEVARHD----------------RL
GLNE_XANCP      AAGEAWLETLRPFVYRRYLDFTALDGLRDMKAAITAEVAHHA----------------RL
GLNE_BORBR      AQARQLESLRVPFVYRKYFDFDALAALRALRERIRQDWQRRALA---------RNGVDSA
GLNE_BORPA      AQARQLESLRVPFVYRKYFDFDALAALRALRERIRQDWQRRALA---------RNGVDSA
GLNE_BORPE      AQARQLESLRVPFVYRKYFDFDALAALRALRERIRQDWQRRALA---------RNGVDSA
GLNE_BURMA      RLAQQLDAIVKPFVYRRYLDFGVIGAIRSLHEQIRQEARRRA-----------TMRPDKA
GLNE_BURPS      RLAQQLDAIVKPFVYRRYLDFGVIGAIRSLHEQIRQEARRRA-----------TMRPDKA
GLNE_RALSO      RVIQQLERVTTPFVFRRYLDYGVIAAIRALHAQIRAEAAKRSNAANRQHGGHDSQVQAHA
GLNE_NEIMA      GIKSL----VRPFVFRKYLDYSAYEAMRKLHRQISSEVSKKG----------------MA
GLNE_NEIMB      DIKAL----VRPFVFRKYLDYGAYEAMRKLHRQISSEVSKKG----------------MA
GLNE_CHRVO      GLAQL----VRPFVYRKYLDYNAYGAMRGLHAQIRREVARRD----------------MA
GLNE_NITEU      AEATLMELIVRPFVFRKYLDFEAYEAMRSLHAQLRKEVDRRE----------------LH
GLNE_BIFLO      DLGRAYMDMTRPFVWSASKRKNFVYDCQKMRKRVEDLIPAPL----------------KD
GLNE_LEIXX      ELGERYVTALAPRVWSSASRENFVESVQRMRERVTDNIPDGD----------------LH
GLNE_COREF      DLGQAYLDAIGPMVWTASQRDSFVDDIQAMRRRVLENVPEEL----------------RD
GLNE_CORGL      NLGQSYVDALSPLIWTASQRESFVTDVQAMRRRVLDNVPEDL----------------RD
GLNE_CORDI      PLGQAYSEKLQPMVWEASQRESFVDNVQRMRRRVLENVPAKL----------------KN
GLNE_MYCBO      ELGERYLTALMPMVWRACEREDFVVEVQAMRRRVEQLVPADV----------------RG
GLNE_MYCTU      ELGERYLTALMPMVWRACEREDFVVEVQAMRRRVEQLVPADV----------------RG
GLNE_MYCPA      ELGRRYLDALMPMVWVACEREDFVVEVQAMRRRVEQLVPADV----------------RG
GLNE_MYCLE      ELGERYLAALMPMVWAACERADFVAEVQAMRRRVEQLVPADV----------------RG
GLNE_NOCFA      ELGREYRDAVMPMVWTASERPDFVPEVQGMRRRVEDLVPAEL----------------RE
GLNE_STRAW      GLGEEYVATLAPLVWQAAERDNFVADVQKMRRRVVANIPAAE----------------IE
GLNE_STRCO      GLGAEYVAALQPLVWQAADRENFVPDVQKMRRRVVENIPLTE----------------VD
GLNE_CUTAK      DLGQRFVEMVSPMVWQVGEAEGFVPETRAMRTRVVSLIAAKN----------------KG
                           * ::            : ::  :                          

GLNE_AGRFC      HNVKLGRGGIREIEFFAQTQQLIAGGRMPPLRVRATEDALAALTEAKWIDAETRDSLTEA
GLNE_RHIME      HNIKLGRGGIREIEFFVQTQQLIAGGRTPALRLRQTETMLRMLAESGWIDGATAEELIEA
GLNE_BARHE      HNIKLGRGGIREIEFFVQTQQLIAGGRFPQLRGRQTVAMLAELHRLGWISEKTRDSLVKS
GLNE_BARQU      HNIKLGRGGIREIEFFVQTQQLIAGGRFPQLRGRQTVAMLTELHTLGWISEKTSDNLIKS
GLNE_BRUME      HNVKLGRGGIREIEFFVQTQQLIAGGRFPELRGNQTVPMLARLAERGWITQQARDALAQE
GLNE_BRUSU      HNVKLGRGGIREIEFFVQTQQLIAGGRFPELRGNQTVPMLARLAERGWITQQARDALAQE
GLNE_RHILO      HNVKLGRGGIREIEFFVQTQQLIAGGRFPELRGRETVPMLGQLAARGWITADARDALARQ
GLNE_BRADU      HNVKVGRGGIREIEFFAQTQQLIAGGRHPELRVRPTLAALDVLASSNWITLAARDELARA
GLNE_RHOPA      HNVKVGRGGIREIEFFAQTQQLIAGGRHPELRVRPTLEALEILAARNWITLQARDELTEA
GLNE_CAUVC      ADLKLGRGGIREIEFFVQTQQLILGGRQPDLRSPRTLDALQALAAAGHVTPEDAAWLTQA
GLNE_PSEPK      ENIKLGAGGIREVEFIAQAFQLIHGGRDLSLQQRPLLKVLATLEGQGYLPPAVVAELREG
GLNE_PSESM      ENIKLGAGGIREVEFIAQAFQLIHGGRDLSLQQRPLFNVLKTLEGQGYLPSAVTEELREG
GLNE_PSEAE      ENIKLGEGGIREVEFIAQAFQLIHGGRDLSLQQRPLLKVLATLEGQGYLPPAVVEELRGG
GLNE_ACIAD      DDIKLGAGGIREVEFIVQVFQLIYGGSKRELQDRQCLVSLNHLGQAGLLQSQDVIELEDA
GLNE_ECOLI      DNIKLGAGGIREIEFIVQVFQLIRGGREPSLQSRSLLPTLSAIAELHLLSENDAEQLRVA
GLNE_SHIFL      DNIKLGAGGIREIEFIVQVFQLIRGGREPLLQSRSLLPTLSAIAALHLLSENDAEQLRVA
GLNE_ECOL6      DNIKLGAGGIREIEFIVQVFQLIRGGREPSLQSRALLPTLSAIAALHLLSENDAEQLRVA
GLNE_ECO57      DNIKLGAGGIREIEFIVQVFQLIRGGREPSLQSRSLLPTLSVIAALHLLSENDAEQLRVA
GLNE_SALTI      DNIKLGAGGIREIEFIVQVFQLIRGGREPSLQSRSLLPTLDAIAALHLLPENDVAQLRVA
GLNE_SALTY      DNIKLGAGGIREIEFIVQVFQLIRGGREPSLQSRSLLPTLDAIAALHLLPENDVAQLRVA
GLNE_YERPE      DNIKLGAGGIREIEFITQVFQLIRGGREPRLQERALLPTLQAVAELGLLPEQQVADLSGS
GLNE_YERPS      DNIKLGAGGIREIEFITQVFQLIRGGREPRLQERALLPTLQAVAELGLLPEQQVADLSGS
GLNE_PECAS      NNIKLGAGGIREIEFITQVFQLIRGGREPGLQGRSLLPTLQHVGALGLLTPQQVLDLSTS
GLNE_PHOLL      DNIKLGAGGIREIEFIAQVFQLIRGGRELCLQSQALLPTLQIIAKLTLLQSLQVKQLADG
GLNE_VIBVU      NNIKLGAGGIREIEFIAQVFQLIRGGREPALRQRGLLVTLEAIKQLQLLEEAQVCHLVEA
GLNE_VIBVY      NNIKLGAGGIREIEFIAQVFQLIRGGREPALRQRGLLVTLEAIKQLQLLEEAQVCHLVEA
GLNE_VIBPA      NNIKLGAGGIREIEFIAQVFQLIRGGREPSLRNRGLLETLSGIEELALLTPQEVSNLEAA
GLNE_VIBCH      NNIKLGAGGIREVEFIAQVFQLIRGGREPSLRKRGLLETLDAIAELELLTREQVQDLRDA
GLNE_PHOPR      NNIKLGAGGIREVEFIAQSFQLIRGGREPSLRGRGLLETLAAMKQLALLPEKQIEHLEQG
GLNE_SHEON      DNIKLGAGGIREVEFVVQSFQLIRGGREPSLRQQSLFGAMDTLYSLGQFEYLAVDELKHS
GLNE_HAEDU      DNIKLGAGGIREIEFIVQTFQMIRGGRDKILQQRSLLQVLPHLVTLNLLTKQQAKHLGDA
GLNE_MANHA      DNIKFGAGGIREVEFIAQTFQMIRGGRDKILQERSLLKVLPRLAELNLLTQTQVETLHNA
GLNE_MANSM      DNIKLGAGGIREIEFIVQVFQLIRGGREISLQQHELLKLLPEIEKLNLITADQHQDLLQA
GLNE_PASMU      DNIKLGAGGIREIEFIVQVFQLIRGGRESALQQPALLKVLPEISALELISAQQQEDLRQA
GLNE_HAEIN      DNIKLGAGGIREVEFIVQVFQLIRGGREINLQQHSLLKILPEITKLRLITEQQFHDLRES
GLNE_METCA      DNIKLGAGGIREIEFIGQAFQLIRGGRNVELQDRRILVVLERLGRLRLLEHGTASFLCAA
GLNE_XANAC      DDIKRGPGGIREIEFLAQSLQLIRGGREPSLRERRLLPALQALVAAGQIDQENGQALSTA
GLNE_XANCP      DDIKRGPGGIREIEFLAQSLQLIRGGREASLRERRLLPALQALVDLGQIDPPTGQALADA
GLNE_BORBR      NNIKLGDGGIREIEFIVQLSQLIRGGRMPALQRRGLLEALHAERAAGLVPEGDAQKLEAA
GLNE_BORPA      NNIKLGDGGIREIEFIVQLSQLIRGGRMPALQRRGLLEALHAERAAGLVPEGDAQKLEAA
GLNE_BORPE      NNIKLGDGGIREIEFIVQLSQLIRGGRMPALQRRGLLEALHAERAAGLVPEGDAQKLEAA
GLNE_BURMA      DDIKLGRGGIREIEFSAQVFQLIRGGQDAGFRVQPTLAVLRHASASGLITEEVRAGLTHA
GLNE_BURPS      DDIKLGRGGIREIEFSAQVFQLIRGGQDAGFRVQPTLAVLRHASASGLITEEVRAGLTHA
GLNE_RALSO      PNIKLGRGGIREIEFVAQVFQLIRGGQDFGLRIRPTLEVLRAAAERGLIGADAVARLTDA
GLNE_NEIMA      DNIKLGAGGIREVEFIAQIFQMIRGGQMRALQLKGTQETLKKLAETGIMPSENVETLLAA
GLNE_NEIMB      DNIKLGAGGIREVEFIAQIFQMIRGGQMRALQLKGTQETLKKLAELGIMLSEHVETLLAA
GLNE_CHRVO      DNIKLGPGGIREAEFIAQVFQLIRGGRDRTLQLRGTRATLERLAALRLLEPAAVAELQAS
GLNE_NITEU      DNIKLGPGGIREIEFITQVFQLIRGGRDADLCIRPTLGVLRRLRQKQPLPGQTIEELTEA
GLNE_BIFLO      REIKLGRGGLRDVEFTVQMLQLVHGRTDESLRTSNTLDSLQRLSEGGYVSRKQAVRMSQD
GLNE_LEIXX      YQLKLGPGGLRDVEFTVQLLQLVHGQTDGLVRQRDTLSALAALAGQSYIGREEAAAFSHD
GLNE_COREF      RELKLGRGGLRDVEFAVQLLQMVHGRYDETLRVRSTVEALQVLVDQGYIGREDGHNLIES
GLNE_CORGL      RELKLGRGGLRDVEFAVQLLQMVHGRIDETLRVRSTVNALHVLVDQGYVGREDGHNLIES
GLNE_CORDI      LELKLGEGGLRDVEFAVQLLQLVHGRSDESLRTLSTIDALNALIEGGYVGREDGAELIRA
GLNE_MYCBO      RELKLGSGGLRDVEFAVQLLQLVHARSDESLRVASTVDALAALGEGGYIGREDAANMTAS
GLNE_MYCTU      RELKLGSGGLRDVEFAVQLLQLVHARSDESLRVASTVDALAALGEGGYIGREDAANMTAS
GLNE_MYCPA      REIKLGSGGLRDVEFAVQLLQLVHGRSDESLHVASTVDALAALGQGGYIGREDAANLTAS
GLNE_MYCLE      RELKLGSGGLRDVEFAVQLLQLVHGRSDESLHVVSTVDALAALGEGGYIGREDAANLTAS
GLNE_NOCFA      RELKLGRGSLRDVEFAVQLLQLVHGRVDENLHVASTVDALSALAAGGYVGRDDAANLTAS
GLNE_STRAW      RELKLGPGGLRDVEFAVQLLQLVHGRADASLRSGTTLDALKALAAGGYVGRADAVQLDEA
GLNE_STRCO      RQLKLGPGGLRDVEFAVQLLQLVHGRADTSLHSGTTLDALEALAAGGYVGRTDAAQLDEA
GLNE_CUTAK      REIKLGAGGLRDVEFTAQLLQLVHGRQDESLRVRATLPALRALAAGGYISRGAAERLKEA
                 ::* * *.:*: **  *  *:: .     .        :        .       :   

GLNE_AGRFC      YWFLREVEHRIQMVRDEQTHVLPDT---------------------EAELKRIAFMLG--
GLNE_RHIME      YWFLRDVEHRIQMVHDEQTHLLPET---------------------EPELRRIAYMLG--
GLNE_BARHE      YAFLRNVEHRIQMLADEQTHILPID---------------------VSQFTSVAYLMG--
GLNE_BARQU      YAFLRNVEHRIQMLADEQTHLLPND---------------------VSQFTSVAYLMG--
GLNE_BRUME      YWFLRDVEHRIQMIADEQTHILPED---------------------DEGFARVSHMMG--
GLNE_BRUSU      YWFLRDVEHRIQMIVDEQTHILPED---------------------DEGFARVSHMMG--
GLNE_RHILO      YWFLRRVEHAVQMVADEQTHTLPED---------------------DEGLERIAHMLG--
GLNE_BRADU      YEFLRRVEHRLQMVADEQTHALPDD---------------------REAVERFARFFG--
GLNE_RHOPA      YLFLRKVEHRVQMIADEQTHALPDT---------------------VEAIEQFSRFLG--
GLNE_CAUVC      YKDLRALEHRAQMIADDQTHKLPES---------------------DVERKKVAALWG--
GLNE_PSEPK      YEFLRYTEHAIQAIADRQTQMLPEG---------------------ETDQARVAYVLG--
GLNE_PSESM      YEFLRYTEHAIQAIADRQTQMLPDN---------------------EQDQARIALIMG--
GLNE_PSEAE      YEFLRYAEHAIQALADRQTQMLPSD---------------------EYDRIRVAFIMG--
GLNE_ACIAD      YLFLRRVEHAIQALNDQQTQMLPME---------------------PELRQRILDTLE--
GLNE_ECOLI      YLFLRRLENLLQSINDEQTQTLPSD---------------------ELNRARLAWAMD--
GLNE_SHIFL      YLFLRRLENLLQSINDEQTQTLPSD---------------------ELNRARLAWAMD--
GLNE_ECOL6      YLFLRRLENLLQSINDEQTQTLPFD---------------------ELNRARLAWAMD--
GLNE_ECO57      YLFLRRLENLLQSINDEQTQTLPSD---------------------ELNRARLAWAMD--
GLNE_SALTI      YLFLRRLENLLQSINDEQTQTLPAD---------------------DLNRARLAWGMK--
GLNE_SALTY      YLFLRRLENLLQSINDEQTQTLPAD---------------------DLNRARLAWGMK--
GLNE_YERPE      YLFLRRLENLLQAIADEQTQTLPND---------------------PLNQARLAWGMG--
GLNE_YERPS      YLFLRRLENLLQAIADEQTQTLPND---------------------PLNQARLAWGMG--
GLNE_PECAS      YLFLRRLENLLQAIADEQTQTLPSD---------------------ELNQQRLAWGMG--
GLNE_PHOLL      YLFLRRLENLLQSINDQQTQTLPED---------------------ELNRSRLTWGMG--
GLNE_VIBVU      YKYLRRLENLLQAMADKQTQTLPDN---------------------ELEQLALAVAMG--
GLNE_VIBVY      YKYLRRLENLLQAMADKQTQTLPDN---------------------ELEQLALAVAMG--
GLNE_VIBPA      YKYLRQLENLLQAMADKQTQTLPDC---------------------DIERLKLATAMQ--
GLNE_VIBCH      YRFLRRLENLLQAMADKQTQTLPDK---------------------EDDQLRLSIAIG--
GLNE_PHOPR      YCFLRKLENLLQAIDDKQTQTLPDK---------------------PLDQIRLAFAMG--
GLNE_SHEON      YLLLRRVENLLQAIDDKQTQTLPNN---------------------ALDWARLCYVLD--
GLNE_HAEDU      YIFHRQLENVLQAIDDQQTQSLPAD---------------------AKNQARIMYACQSY
GLNE_MANHA      YIFYRQIENVLQAIDDKQTQTLPTD---------------------EASQARLVFACQSY
GLNE_MANSM      YLFLRRVENVLQAINDKQTQLLPAD---------------------ELNRCRLISATCEF
GLNE_PASMU      YLFLRRTENILQAIHDQQTQQLPEN---------------------TLDQQRLVLATQRF
GLNE_HAEIN      YIFLRRVENILQAINDQQTQTLPTD---------------------EIDQIRLVEACKTF
GLNE_METCA      YRFLRKVENRLQQYEDKQTHELPVS---------------------EERRGLLAFSMG--
GLNE_XANAC      YRFLRRLENRLQMLRDAQTHALPQA---------------------PLDRERIALGLG--
GLNE_XANCP      YRFLRRVENRLQMLRDAQTHALPQG---------------------EPERERIALGLG--
GLNE_BORBR      YRFLRRTEHALQYREDEQTHLLPAD---------------------PAQRAALAAALGY-
GLNE_BORPA      YRFLRRTEHALQYREDEQTHLLPAD---------------------PAQRAALAAALGY-
GLNE_BORPE      YRFLRRTEHALQYREDEQTHLLPAD---------------------PAQRAALAAALGY-
GLNE_BURMA      YLFLRTLEHRLQYRNDAQTHAMPVD---------------------PAERAALAASLGFA
GLNE_BURPS      YLFLRTLEHRLQYRNDAQTHAMPVD---------------------PAERAALAASLGFA
GLNE_RALSO      YRFLRQLEHRLQYVDDAQTHNLPGA---------------------PEDQLRIARMMGFA
GLNE_NEIMA      YRFLRDVEHRLQYWDDQQTQTLPTS---------------------PEQRQLLAESMGFD
GLNE_NEIMB      YRFLRDVEHRLQYWDDQQTQTLPTS---------------------PEQRQLLAESMGFD
GLNE_CHRVO      YAFLRNLEHRLQYLDDQQTQTLPEA---------------------PETRQKIAASMGHA
GLNE_NITEU      YCFLRKLEHRLQYLDDQQTQNLPQH---------------------PDEQTLIARSMGFT
GLNE_BIFLO      YRFERVMEHRQQIWSLKRTHLFPDLGRASVGGLEKKRDIDVDELNQNQELRRLARAFGLH
GLNE_LEIXX      YRTLRLLEHRLQLRHLRRTHLMP---------------------RDEVEVRILARATGLA
GLNE_COREF      YEFLRLLEHRLQLERVKRTHTMPKV-------------------EDRMNMRWLARASGFT
GLNE_CORGL      YEFLRLLEHRLQLERIKRTHLLPKP-------------------DDRMNMRWLARASGFT
GLNE_CORDI      YEFLRLLEHRLQLQKVKRTHTMPEA-------------------TKTKQLRWLARAAGFK
GLNE_MYCBO      YEFLRLLEHRLQLQRLKRTHLLPDP-------------------EDEEAVRWLARAAHIR
GLNE_MYCTU      YEFLRLLEHRLQLQRLKRTHLLPDP-------------------EDEEAVRWLARAAHIR
GLNE_MYCPA      YEFLRLLEHRLQLQRLKRTHLLPEA-------------------DDEEAVRWLARAAHIR
GLNE_MYCLE      YEFLRLLEHRLQLQRLKRTHLLPED-------------------GDEEAVRWLARAAHIR
GLNE_NOCFA      YEFLRLLEHRLQLQRLKRTHTLPAD-------------------DDEEGMRWLARAAHIR
GLNE_STRAW      YRFLRTMEHRIQLFRLRRTHLVP---------------------EDDADLRRIGRSLGLR
GLNE_STRCO      YRFLRSMEHRIQLHRLRRTHLVP---------------------EDEADLRRLGRSLGLR
GLNE_CUTAK      YRLERVMEHRVQMFRLRRTHLLP---------------------DDEDGLRRLARAVGLR
                *   *  *:  *     :*: .*                             .       

GLNE_AGRFC      ----------------FEDTKAFSEKLEEVLRLVERRYSALFEQE------------TKL
GLNE_RHIME      ----------------FEDTASFSNALSRVLRTVERRYAQLFEQE------------AKL
GLNE_BARHE      ----------------YQETNSFICDLLKTLQVVEKHYAALFENE------------QEL
GLNE_BARQU      ----------------YQESSSFIRDLLKVLQVVEKHYAALFENE------------QEL
GLNE_BRUME      ----------------YADPAEFSEIFLAALKVVEKQYAALFEQA------------PEL
GLNE_BRUSU      ----------------YADPAEFSEIFLAALKVVEKQYAALFAQA------------PEL
GLNE_RHILO      ----------------FGDAAAFSQAFRASLLQVERHYAALFETA------------PEL
GLNE_BRADU      ----------------YPDREAFARDLLRQLEIVQGHYEKLFEGDD-----------PTG
GLNE_RHOPA      ----------------YDSRDSFARDLLGYLERVQGHYAKLFEGD------------PTG
GLNE_CAUVC      ----------------EGNLRVFDAAVGKMLKGVNLRYGRLFAGE------------EAL
GLNE_PSEPK      ----------------FADWQSFHDQLMYWRGRIDWHFRQVIADPDDE-----DGEGELV
GLNE_PSESM      ----------------FADWASFHERLMYWRSRVSWHFRQVIADPDSDPDDELQDDSEVV
GLNE_PSEAE      ----------------FASWAAFHERLSHWRARIDWHFRQVIADPDED---ESGEAACGS
GLNE_ACIAD      ----------------YPTWDNFIEALNEKRHKVSEQFKKLIQE----------------
GLNE_ECOLI      ----------------FADWPQLTGALTAHMTNVRRVFNELIGDDESET-------QEES
GLNE_SHIFL      ----------------FADWPQLTGALTAHMTNVRRVFNELIGDDESET-------QEES
GLNE_ECOL6      ----------------FADWPQLTGVLTAHMANVRRVFNELIGDDESET-------QEES
GLNE_ECO57      ----------------FADWPQLTGALTAHMTNVRRVFNELIGDDESET-------QEES
GLNE_SALTI      ----------------AENWPQLVGELTDHMANVRRVFNELIGDDEADTP------QEEE
GLNE_SALTY      ----------------AENWPQLVGELTDHMANVRRVFNELIGDDEADTP------QEEE
GLNE_YERPE      ----------------YADWAAMSTALENHMQAVRVVFDDLIGDETPDI-------GEDP
GLNE_YERPS      ----------------YADWAAMSTALENHMQAVRVVFDDLIGDETPDI-------GEDP
GLNE_PECAS      ----------------FDSWDTLQSMLSQHMQAVRHVFDELIGDDAPDN-------NDIP
GLNE_PHOLL      ----------------FESWDALIIELNNKMSAVRAIFTQLIGDDSDNS-------DEEP
GLNE_VIBVU      ----------------YSQWQALQNDVQQHMAKVHAVFVTLIGD-EEDE--------VSP
GLNE_VIBVY      ----------------YSQWQALQNDVQQHMAKVHAVFVTLIGD-EEDE--------VSP
GLNE_VIBPA      ----------------LESWDLLIEQTQQHMNKVHQVFETLIGDDEEDE--------GST
GLNE_VIBCH      ----------------LADWPSLQREVSEHMQRVHRVFATLIGEEDEEE--------EHT
GLNE_PHOPR      ----------------YADWQSLFEAIELHMSAVHLVFDDIIGTDEDDA--------GCS
GLNE_SHEON      ----------------MTNEIDLRTHIEAAMAKIHRHFKATVGGEEGEE----------K
GLNE_HAEDU      WQKDQ-QNQPLMIEYHWQSWQQFLSTLAQHQQHVRVIFNQLIGEEE--QA------NQSP
GLNE_MANHA      YQQDLYSEKTHWVEHSFNDWQQFMAVLSQYQQAVRQIFNEIIGEEET-QA------NCNP
GLNE_MANSM      TQWDN-NHRPQKIQYPIHDWESFYQVLQQHQQKVRSVFNNLIGFNNENEA------DDS-
GLNE_PASMU      TQWDT-QNKLETVTYPIHDWASFCEVLQQHQQNVRTVFDHLIGEEKE-EL------SET-
GLNE_HAEIN      TCLNE-NNQTIEKHYPIENWDDFYRTLQQKQEKVRAVFTQLIGDEQD-ES------SQT-
GLNE_METCA      ----------------FESWEGFLHRLDEVRRRVHEIFTEVIAEPPQPAR----------
GLNE_XANAC      ----------------YAQWSALLDALAPQRARVAAEFAELLAPRVRATA----------
GLNE_XANCP      ----------------YAHWQALLEALAPHRTRVAAEFAELLAPRVHATA----------
GLNE_BORBR      ------------------EPAAFERTLAEHRAFVSQTFRNAFRLAGMGEEDDSPAPARTP
GLNE_BORPA      ------------------EPAAFERTLAEHRAFVSQTFRNAFRLAGMGEEDDSPAPARTH
GLNE_BORPE      ------------------EPAAFERTLAEHRAFVSQTFRNAFRLAGMGEEDDSPAPARTH
GLNE_BURMA      ------------------DYAALIDRLDQHRAFVEAQFDQVFA-----DKADGGARREDD
GLNE_BURPS      ------------------DYAALIDRLDQHRAFVEAQFDQVFA-----DKADGGARREDD
GLNE_RALSO      ------------------DYAALVAQLERYQDEVAQQFEQTFS-----DKQDNQP-----
GLNE_NEIMA      ------------------SYSAFSDGLNIHRNKVNQLFNEILSE----PEEQTQDNSEW-
GLNE_NEIMB      ------------------SYSAFSDGLNVHRNKVNQLFNEILSE----PEEQTQDNSEW-
GLNE_CHRVO      ------------------DWPAFLDALNEVRRKVSRHFEQVFIL----PSEDS-ASHPL-
GLNE_NITEU      ------------------GYGDFLDHLDLHRQNVTRHFEQIFAARRKSPRHDTFARIRP-
GLNE_BIFLO      PE-------------------ELVDKYDDTRREVRHLHLDIYYRPMLPVN-------AQM
GLNE_LEIXX      ASA-----------------GQLLTQWNEIKHRVRGLHERLFYRPLLSAV-------AAM
GLNE_COREF      GSGGQ------------SSARAMEHHLRRVRLQIQSLHSQLFYRPLLNSV-------VNL
GLNE_CORGL      GSMEQ------------SSAKAMERHLRKVRLQIQSLHSQLFYRPLLNSV-------VNL
GLNE_CORDI      TSKLA------------SATDEMNAMLKTSRLHISSLHRKLFYRPLLDSV-------VNI
GLNE_MYCBO      PDGRN------------DAAGVLREELKKQNVRVSKLHTKLFYQPLLESI-------GPT
GLNE_MYCTU      PDGRN------------DAAGVLREELKKQNVRVSKLHTKLFYQPLLESI-------GPT
GLNE_MYCPA      PDGRH------------DAAGVLREELRHQNLRVSQLHAKLFYQPLLESI-------GPA
GLNE_MYCLE      PDGRH------------DAAGVLREELKNQNLRVSQLHAKLFYQPLLESI-------GPA
GLNE_NOCFA      PDGRQ------------DAMGVLRSEIRRNAVRVRRLHAKLFYRPLLEAV-------VRM
GLNE_STRAW      AD----------------PITDLNREWKRHATVVRRLHEKLFYRPLLDAV-------AQL
GLNE_STRCO      TD----------------PVTGLLRAWKRHASVVRRLHEKLFYRPLLDAV-------AQL
GLNE_CUTAK      T------------------ADEVRRVWTATSKAVLRAHGQVFYSPVVEAV-------ARI
                                      .          :   .                      

GLNE_AGRFC      SGEAGNLVFTGQKDDPDTLKTLSTLGFQRP-------EDISRVIRTWHNGRYRATQSVEA
GLNE_RHIME      STETGNLVFTGQQDDPDTLETLKKLGFQRP-------SDIANIIRTWHYGRYRATQSVEA
GLNE_BARHE      GLEIGNLVFTGEEDDPETLITLRRLGFERA-------SDICRIMRTLHCGRYKSTQSAEA
GLNE_BARQU      GLEIGNLVFTGEEDDPETLITLSCLGFERA-------SDICRIMRTLHCGRYKATQSAEA
GLNE_BRUME      GAASGNLVFTGDVDDPGTLETLSAMGYERS-------SDICRVIRTWHFGRYRATQSAEA
GLNE_BRUSU      GAASGNLVFTGDVDDPGTLETLSAMGYERS-------SDICRVIRTWHFGRYRATQSAEA
GLNE_RHILO      SAGIGNLVFTGDVDDPNTLQTLQGLGFQRP-------SDICRVIRGWHFGRYRVTQSAEA
GLNE_BRADU      TAKLPALDYSAGPDDPRLFQHLTTLGFKKP-------AAVAQTVRDWITGDYRVFRNEAT
GLNE_RHOPA      TAKLPPVDYGAGPEDTRLLDHLLSLGYKKP-------LMIATTLQQWMTGGYRVLKVETT
GLNE_CAUVC      SSRFGSLVFTGVEDDPETLATLKRMGFSSP-------ERVAATIRGWHHGHIAATRTERG
GLNE_PSEPK      VGGEWSPLWEQAQDEEAAGRQLQEAGFKQP-------AEALRRLAGLRSSPQLRSMQRIG
GLNE_PSESM      VGGEWLPLWEESQDEDAAGRQLLQAGFVDT-------GKALKSLADLRSSPNLRSMQRLS
GLNE_PSEAE      VGAEWIPLWEEALDEESASRQLADAGFVDA-------EAAWKRLSDLRHGPQVRAMQRLG
GLNE_ACIAD      ---------EVTSPDETDTELEQQLNAILD-------ETAQNLVHEFWQSNALKRLPSKA
GLNE_ECOLI      LSEQWRELWQDALQEDDT-TPVLAHLSEDD------RKQVLTLIADFRKELDKRTIGPRG
GLNE_SHIFL      LSEQWRELWQDALQEDDT-TPVLAHLSEDD------RKQVLTMIADFRKELDKRTIGPRG
GLNE_ECOL6      LSEQWRELWQDALQEDDT-TPVLAHLSEDD------RKQVLMLIADFRKELDKRTIGPRG
GLNE_ECO57      LSEQWRELWQDALQEDDT-TPVLAHLSEDD------RKQVLTLIADFRKELDKRTIGPRG
GLNE_SALTI      RSEPWREVWQDALQEDDS-TPVLAHLADED------RRQVLTLIADFRKELDKRPIGPRG
GLNE_SALTY      RSEPWREVWQDALQEDDS-TPVLAHLADEE------RRQVLTLIADFRKELDKRPIGPRG
GLNE_YERPE      SHGLYKSLWQDVLEESDL-APLTPHLEEAA------RRQLLATISGFRHDVDKRTIGPRG
GLNE_YERPS      SHGLYKSLWQDVLEESDL-APLTPHLEEAA------RRQLLATISGFRHDVDKRTIGPRG
GLNE_PECAS      EHSSYSSLWQDTLDDGDL-APLTPHLTETV------REKLMRTIVEFRNDVAKRTIGPRG
GLNE_PHOLL      SHVPFKSLWLEDLEKEEL-IILAPHLDEEI------AQQILHIISVFRHDVGKRTIGPRG
GLNE_VIBVU      VERHFNELWDMAHNPEVIEQILQNDLACQN------AATMSEQIIQFKADLAKKTLGPRG
GLNE_VIBVY      VERHFNELWDMAHNPEVIEQILQNDLACQN------AATMSEQIIQFKADLAKKTLGPRG
GLNE_VIBPA      IARHFHELWDMANKQDVLELILEQDIQVEE------PAIFSKAIINFKADLAKKTLGPRG
GLNE_VIBCH      VARHFHELWDMAHKPEVIEHIIEQDLGLSD------AGEQIRTITQFKDDLAKRTIGPRG
GLNE_PHOPR      VSEQYNEMWTMAKDEDVLLNIMA-ELEAPD------SANQVSTILGMKAELSKRTLGPRG
GLNE_SHEON      AEHWTAQLWNVQQDDHAINLLAEQQIDDD---------KLWPLLSRWRETVTKRSIGPRG
GLNE_HAEDU      VNE-QLAIWQDILHPEIRQLELAEVLRDYP-VATEDYATIFHLLANTLQDWSKRPIGVRG
GLNE_MANHA      VNE-KLAEWKDILHYNIRLEDLSAVLKGYPKVAENDYTEIFRHFSTTFQDWVKRPIGVRG
GLNE_MANSM      -----DNAWSDFLDADLEQGEIADILAQQG-VSEEERDEIIGRLEAFRHSVSHRSIGIRG
GLNE_PASMU      -----ETLWHDFLENEIEESEIEQMLIEHH-IEERDFHEIIEKLMQFRNEVTRRPIGTRG
GLNE_HAEIN      -----DSQWQDFLEADFE--DIEQTLLESS-VSENNIDEVLEKLAQFKDGLNHRVIGSRG
GLNE_METCA      --------GEPLLDGGEAELSQALAGFDGA------AEAMTGALVKFRASAPVRRLGAGA
GLNE_XANAC      -PDALADYWRALPDGDAAPLAGIGLNDPDG---------AHRALADFAQSSGVRALSDSA
GLNE_XANCP      -PDTLADYWRALPEGDAAPLLGIGLHDPNN---------AHHMLADFAQSSGVRALSDGA
GLNE_BORBR      ANGHGMRPHAGALHDIEERLAGQIQRDFPE-----HAEDLLRRTETLLGSHRVRSLPDSS
GLNE_BORPA      ANGHAMRPHAGALHDIEERLAGQIQRDFPE-----HAEDLLRRTETLLGSHRVRSLPDSS
GLNE_BORPE      ANGHAMRPHAGALHDIEERLAGQIQRDFPE-----HAEDLLRRTETLLGSHRVRSLPDSS
GLNE_BURMA      QAAGCIWSGALADDGADEALVARLAELGFA-----DPAAVLARLQAVWRSSRYAGLPESS
GLNE_BURPS      QAAGCIWSGALADDGADEALVARLAELGFA-----DPAAVLARLQAVWRSSRYAGLPESS
GLNE_RALSO      -PCAAIWHADLLDDERTESARAQLLELGYA-----DADSVLERLRASRHSPRYRALSEVS
GLNE_NEIMA      -------QWAWQEKPDEEERLGRLKEYGF------DAETIATRLDQIRNGHKYRHLSAHA
GLNE_NEIMB      -------QWAWQDKPDEEGRRCRLKAHGF------DAETVAARLDQIRHGHKYRHLSAHA
GLNE_CHRVO      -------SELWLDVAEQSPE-TRLAELGYA-----DPAAVARQLTGLAQSQRYLQMPLAG
GLNE_NITEU      -------EQSG-DHETVEAFSKQLQTLGYL-----DPGKITARVRQFYDSTFFRQLTHSS
GLNE_BIFLO      END------QIVLSVEAAQERFESIGFGDP-------------DAAIRHVQALTAGVGRA
GLNE_LEIXX      PNEDARLSGEAGLTSEQAQARLAAIGFRDP-------------RGALAHIAALTAGVSRR
GLNE_COREF      SVD------AMKLSQEAAKLQLGALGYQHP-------------VRAYEHLTALASGTSRK
GLNE_CORGL      SAD------AIRLSPDAAKLQLAALGYLHP-------------SRAYEHLTALASGASRK
GLNE_CORDI      SVG------TLKLSPAAAKLQLAALGYVFP-------------DRAMDHLHALAAGGSRK
GLNE_MYCBO      GLEI-----AHGMTLEAAGRRLAALGYEGP-------------QTALKHMSALVNQSGRR
GLNE_MYCTU      GLEI-----AHGMTLEAAGRRLAALGYEGP-------------QTALKHMSALVNQSGRR
GLNE_MYCPA      GLEI-----RHGMTSEAAERQLAALGYEGP-------------QSALKHMSALVNQSGRR
GLNE_MYCLE      SLEI-----RHGMTSEAAERQLATLGYEGS-------------QTALKHISALVNQSGRR
GLNE_NOCFA      DPD------ALRLSPDAAVRQLAALGYAAP-------------ENAFGHLKALTGGVSRK
GLNE_STRAW      APG------EARLSPNAARERLVALGYADP-------------AAALRHLEALASGVTRK
GLNE_STRCO      APG------EARLSPEAARERLVALGYADP-------------AAALRHLEALASGVTRK
GLNE_CUTAK      PTQ------DLRMSAEAAKVRLSALGFHDE-------------DAGLRHIEALTSGTSRA
                                                                            

GLNE_AGRFC      RERLTELTPDLLRAFGESKRAD----------EALLRFDNFLSGLPAGIQLFSLLGNNPA
GLNE_RHIME      RERLTELTPELLRVFGESRRAD----------EAFLRFDHFLSGLPAGIQLFSLLGNNPG
GLNE_BARHE      RERLTELTPALLKAFGATKRAD----------EVMLRFDSFLQGLPSGIQLFSLLQSNPS
GLNE_BARQU      RERLTELTPALLKAFGAIKRAD----------EAMLRFDSFLQGLPSGIQLFSLLQSNPS
GLNE_BRUME      RERLTELTPALLKAFAETRRAD----------ESLLRFDGFLQGLPAGIQLFSLLQSNPR
GLNE_BRUSU      RERLTELTPALLKAFAETRRAD----------ESLRRFDGFLQGLPAGIQLFSLLQSNPR
GLNE_RHILO      RERLTELTPALLKAFGQTRRAD----------EALIRFDEFLAGLPAGIQLFSLLQSNPA
GLNE_BRADU      RSAFIEFVPALIDGLALAEEPD----------RAVVAFDQFLGALQRGGRLITLLGQNRD
GLNE_RHOPA      QRAFREFVPALIEELARAEQPD----------DAVNAFDRLLQALHRGGRLISLLSQNRE
GLNE_CAUVC      RELFTRLAPRLLDAANATGAPD----------QAFNRFSDFFSRLSSGVQIQSLFLAQPR
GLNE_PSEPK      RERLDAFIPRLLAQAVEHDNPD----------LVLERVLPLVEAVARRSAYLVLLTENPG
GLNE_PSESM      RERLDAFIPRLLAQAVEHEKPD----------LVLERVLPLVEAVARRSAYLVLLTENPD
GLNE_PSEAE      RERLDAFVPRLLAMTVENPQPD----------LVLERVLPLVEAVARRSAYLVLLTENPG
GLNE_ACIAD      VQRLKDFWPHFIEAILQSEHPQ----------MAFMRLMPLIESVMRRTVYLVMLMESRG
GLNE_ECOLI      RQVLDHLMPHLLSDVCAREDAA----------VTLSRITALLVGIVTRTTYLELLSEFPA
GLNE_SHIFL      RQVLDHLMPHLLSDVCAREDAA----------VTLSRITALLVGIVTRTTYLELLSEFPA
GLNE_ECOL6      RQVLDHLMPHLLSDVCAREDAA----------VTLSRITALLVGIVTRTTYLELLSEFPA
GLNE_ECO57      RQVLDHLMPHLLSDVCAREDAA----------VTLLRITALLAGIVTRTTYLELLSEFPA
GLNE_SALTI      RQVLDQLMPHLLADVCSREDAA----------VTLSRITPLLAGIVTRTTYLELLSEFPG
GLNE_SALTY      RQVLDQLMPHLLADVCSREDAA----------VTLSRITPLLAGIVTRTTYLELLSEFPG
GLNE_YERPE      REVLDQLMPRLFAEVCPRPDAN----------VALSRLILLLLSIVTRTTYLELLVEYHA
GLNE_YERPS      REVLDQLMPRLFAEVCPRPDAN----------VALSRLILLLLSIVTRTTYLELLVEYHA
GLNE_PECAS      RDVLDQLMPCLLAEVCARQEAD----------TVLSRLTPLLLGIVTRTTYLELLLESRA
GLNE_PHOLL      RDVLDHLMPRLLAKVCLRQDANNQDVNNRNVNIVLERVIPLLLSIVSRTTYLELILESEA
GLNE_VIBVU      REVLNRLMPKLFSAIFADADAQ----------FGLPRVLHLLHNIATRTTYLELLDEHPA
GLNE_VIBVY      REVLNRLMPKLFSAIFADADAQ----------FGLPRVLHLLHNIATRTTYLELLDEHPA
GLNE_VIBPA      REVLNRLMPKVFDAVFAHPDAQ----------FGLPRVLHLLHNICTRTTYLELLDEHPA
GLNE_VIBCH      REVLNRLMPKVYQAVFAHPDAE----------FGLSRVLALLHSIATRTTYLELLDEHPA
GLNE_PHOPR      REVLTRLMPEVLSRIVPRPDAS----------AVLARVTKLIVRVATRTTYLELLGEHPA
GLNE_SHEON      RETLDKLMPRLLDELLNQPSPS----------AAFEPVSKVLEQILTRTTYLELLCENPG
GLNE_HAEDU      RKVLSQLMPKVMHSICSKTDYL----------VVLPRLLNIIDRVTTRTTYLELLQEKDQ
GLNE_MANHA      REVLRNLMPRIADSIFKGEDHL----------LLLPRVLNIVDKITTRTTYLELMLEKEQ
GLNE_MANSM      REVLTQLMPLLLLQIFSNKKYR----------TLLPRMLNIVEKILTRTTYLELLLENPQ
GLNE_PASMU      RIALTQVMPTLLPQIFAHTAYL----------HLLPRMLNIVDKILTRTTYLELLVENPQ
GLNE_HAEIN      RDVLSHLMPTVLALIFEQENYR----------TLLPRILNIIEKISSRTTYLELLLENPR
GLNE_METCA      RAELQRVIGKLLAELAAFRVSDPV--------GVLGRILELFESIAGRGVYFSLLAENPS
GLNE_XANAC      RARLDRVMPALLHAATRASQPD----------AAVRRMLGLLQATLRRTSYLALLDEQPS
GLNE_XANCP      RTRLDRVMPALLHAAIRATQPD----------AALRRVLGLLQATLRRTSYLALLDEQPS
GLNE_BORBR      RHRLEALLPAALTAAAQTSAPM----------DAALRLFDLIETIAQRSAYLALLAEYPD
GLNE_BORPA      RHRLEALLPAALTAAAQTSAPM----------DAALRLFDLIETIAQRSAYLALLAEYPD
GLNE_BORPE      RHRLEALLPAALTAATQTSAPM----------DAALRLFDLIETIAQRSAYLALLAEYPD
GLNE_BURMA      RVRFDRVAHRALEAAPGIDAAHR--------DETVVRCFDLLETVGRRGAYLALLTEYPA
GLNE_BURPS      RVRFDRVAHRALEAAPGIDAAHR--------DETVVRCFDLLETVGRRGAYLALLTEYPA
GLNE_RALSO      RQRFDLLINRALDHAARQTDA----------DVTIARFLDFFDAISRRSSYLSLLSEYPQ
GLNE_NEIMA      QPRFDAIVPLFVQAAAEQNNP----------TDTLMRLLDFLENISRRSAYLAFLNEHPQ
GLNE_NEIMB      QPRFDAVVPLFVQAAAAQSNP----------TDTLMRLLDFLENISRRSAYLAFLNEHPQ
GLNE_CHRVO      RKQLDALMPALIEVAARFPNA----------DDTLSRIIGLMEAISRRASYLALLTEYPQ
GLNE_NITEU      QERIFELMPTLMEVIARFPPV----------DITLERILRLLEKIGQYPAYLALLQEHPQ
GLNE_BIFLO      AKINRIILPAVLQWLGEGQNPD----------MGLLNWRKLEENFGTESGYLGFLRDSTS
GLNE_LEIXX      ATIQRHLLPVMLQWFSAGADPD----------YGLLSFRRLSDDLGGTHWYLRMLRDSSG
GLNE_COREF      AKIQAMLLPTLMEWLSQTADPD----------AGLLNYRKLSDAAYDRSWFLRMLRDEGV
GLNE_CORGL      AKIQAMLLPTLMEWLSQTAEPD----------AGLLNYRKLSDASYDRSWFLRMLRDEGV
GLNE_CORDI      AKIQAMLLPTLMEWLSETAEPD----------AGLLNYRKLSDAAYDRTWFLRMLRDEGV
GLNE_MYCBO      GRVQSVLLPRLLDWMSYAPDPD----------GGLLAYRRLSEALATESWYLATLRDKPA
GLNE_MYCTU      GRVQSVLLPRLLDWMSYAPDPD----------GGLLAYRRLSEALATESWYLATLRDKPA
GLNE_MYCPA      GRVQSVLLPRLLNWMSYAPDPD----------GGLLAYRRLSEALAGESWYLSTLRDKPA
GLNE_MYCLE      GRVQSVLLPRLLNWMSYAPDPD----------GGLLAYRRLSEALSAETWYLSTLRDKPA
GLNE_NOCFA      GRIQALLLPTLLEWLGETPNPD----------AGLLAYRRVSEALDEQTWFLRELRDEGA
GLNE_STRAW      AAIQRTLLPVLLGWFADSADPD----------AGLLNFRKVSDALGKTPWYLRLLRDEGA
GLNE_STRCO      AAIQRTLLPVLLGWFADSADPD----------TGLLNFRKVSDALGTTPWYLRLLRDEGA
GLNE_CUTAK      VRIQTALMPAMLAWLADGPSPD----------HGLLAFRQVSEALGESPWYLRALRDEGA
                      .                                 .             :     

GLNE_AGRFC      LLSLLVTIMSSAPRLAEIIAARPHVFDGMLDPALMSDVPTRDYLAHRMGNFLSNARH---
GLNE_RHIME      LLSLIVNIMSSAPRLADIIAAKPHVFDGMLEPGLLAELPTRDYLAPRIATFVGGGRH---
GLNE_BARHE      LLDMLVLIMGAAPRLAEIITHKPHVFDGMLDPTIFSELPTKTYLKNRLEYFLEGVIS---
GLNE_BARQU      LLDMLVLIMGAAPRLAEIITRKPHVFDGMLDPTILSELPTKTYLENRLEYFLEGVIP---
GLNE_BRUME      LLNLLVMIMSAAPRLADIITRNPHVFDGLLDPAIFSEVPTRAYLEERLRAFLGSATD---
GLNE_BRUSU      LLNLLVMIMSAAPRLADIITRNPHVFDGLLDPAIFSEVPTRAYLEERLRAFLGSATD---
GLNE_RHILO      LLKLMATIMGAAPRLAAIITRRPHVFDGLLDPALLTELPDRVYLSARLSAFLEGDRA---
GLNE_BRADU      LVALVALVLGAAPRLGEMLARQPQLMDGLIDPRFFGAMPDRRELSGRLAATVQDAAS---
GLNE_RHOPA      LLTLVALVLGAAPRLGDMLARQPQILDGLIDPRFFGAMPDQAELSARLAVTLADAGS---
GLNE_CAUVC      LFELIVEVMAFAPRLAATMAKRPTALDALLDPTFFGPIETP-------AIAPWDPED---
GLNE_PSEPK      ALRRLLTLCAASPWIAEQIALYPLLLDELLNEGRLFSPPLAPELASELRERLTRIPE---
GLNE_PSESM      ALRQLLTLCAASPWIAEQIARFPLLLDELLNEGRLFNPPLAPELAAELRERLVRIPE---
GLNE_PSEAE      ALERLLTLCAASPMVAEQIARFPILLDELLNEGRLFRPPQAAELAAELRERLMRIPE---
GLNE_ACIAD      AMQRLVKMATVSPWICEELTQYPVLLDEFLSMD--FELPQRKDLEDSLRQQLLRIEI---
GLNE_ECOLI      ALKHLISLCAASPMIASQLARYPLLLDELLDPNTLYQPTATDAYRDELRQYLLRVPE---
GLNE_SHIFL      ALKHLISLCAASPMIASQLARYPLLLDELLDPNTLYQPTATDAYRDELRQYLLRVPE---
GLNE_ECOL6      ALKHLISLCAASPMIASQLARYPLLLDELLDPNTLYQPTATDAYRDELRQYLLRVPE---
GLNE_ECO57      ALKHLISLCAASPMIASQLARYPLLLDELLDPNTLYQPTATDAYRDELRQYLLRVPE---
GLNE_SALTI      ALKHLIMLCAASPMIASQLARYPLLLDELLDPGTLYQPTATDAYRDELRQYLLRVPE---
GLNE_SALTY      ALKHLIMLCAASPMIASQLARYPLLLDELLDPGTLYQPTATDAYRDELRQYLLRVPE---
GLNE_YERPE      ALKHVIRLCSASPMVASQLARYPLLLDELLDPQSLYQPLAPSAYRDELRQYLLRVPE---
GLNE_YERPS      ALKHVIRLCSASPMVASQLARYPLLLDELLDPQSLYQPLAPSAYRDELRQYLLRVPE---
GLNE_PECAS      ALAQLIRLCAASPMVASQLARYPLLLDELLDASTLYQPTAPGAYADELRQYLMRVPE---
GLNE_PHOLL      VLAHVIRLCAASPMIATQLACHPLLLDELLDPQFLYEPLPLNAYKDELRQYLLRIPE---
GLNE_VIBVU      ALTQLVRLCTASPMISEQLARYPILLDELIDPQQLYNPIALDAYRTELRDFLARIPE---
GLNE_VIBVY      ALTQLVRLCTASPMISEQLARYPILLDELIDPQQLYNPIALDAYRTELRDFLARIPE---
GLNE_VIBPA      ALVQLVRLCTASPMISEQLSRYPILLDELIDPQQLYNPIPLDSYRTELRDFLARIPE---
GLNE_VIBCH      ALVQLVRLCTASPMISEQLARYPILLDELIDPQHLYNPIPLESYQTELRDFLARIPE---
GLNE_PHOPR      ALGQLIRLCAASPMVAEQLTQYPILLDELLDPQHLYNPTPLDQYGDELREYLARIPE---
GLNE_SHEON      ARQQLVSLCCASPWIAVQLAKFPMLLDELIDPAHLYDTTSLDDYPSELRQYLLRVPE---
GLNE_HAEDU      ILPLLERLCGHSIMVAEQIARYPMLLDEFIINKSLMKVIEFEQYKTELTEYLIRIPE---
GLNE_MANHA      ILPQLLALCSKSVMIAEQIARYPMLLDELMSHRGLTDVQAFEKYQSALQDYLIRIPE---
GLNE_MANSM      ALTQLIELCAKSQLIAEQVAQHPILLDELLDREALLNPPSFEQYPAELQQYLLRLPE---
GLNE_PASMU      ALTQLIELCAQSRMIAEQVARHPILLDELLDRNALLNPPPYDHYASELRQYLLRLTP---
GLNE_HAEIN      ALQQVIELCAQSQLISEQLAHYPILLDELLNTEALRHPLPFTQYPAELHQYLLRLPP---
GLNE_METCA      ALSQLVRLAAASPWIVRLIAGAPILLDELLDPRTLYSPLTRESLGREADILFSSLAP---
GLNE_XANAC      ALARLVDVLSRSALLAERLAAYPLLLDELLDTRISGPLP---DRAALHAACAHTLHI---
GLNE_XANCP      ALARLVDVLSRSALLAERLAAYPLLLDELLDTRISGPLP---DRAALHTACVDTLQI---
GLNE_BORBR      TLARVARMVAASPWAAQYLTQHPLLLDSLIDWRTLFEPLDFAQVARQLAADLDACRLPDG
GLNE_BORPA      TLARVARMVAASPWAAQYLTQHPLLLDSLIDWRTLFEPLDFAQVAHQLAADLDACRLPDG
GLNE_BORPE      TLARVARMVAASPWAAQYLTQHPLLLDSLIDWRTLFEPLDFAQVAHQLAADLDACRLPDG
GLNE_BURMA      ALRRVLSVLGATRWGGGYLIRHPQLLDELLDDEAIDSPFDWPAFKDALRRRL------AA
GLNE_BURPS      ALRRVLSVLGATRWGGGYLIRHPQLLDELLDDEAIDSPFDWPAFKDALRRRL------AA
GLNE_RALSO      AMARVAHTLHASRWAADYLTRHPQLLDELLDTEALSAAPDWQGFRERVRERLR-----AA
GLNE_NEIMA      TLAQLAQIMGQSSWVAAYLNKYPILLDELISAQLLDTAFDWQALAAALSDDLKACG----
GLNE_NEIMB      TLAQLAQIMGQSSWVAAYLNKYPILLDELISAQLLDTAFDWQALAAALSDDLKACG----
GLNE_CHRVO      TLQRLASLYSSSAWVSAYLSRHPILLDELLDARMLYAAPDWPLLAAQLETQLAQAD----
GLNE_NITEU      TLPRVAKLASVSQWASDYLGRHPILLDELLTSSGLHILPDWPALKTELTHQLHHVNI-PK
GLNE_BIFLO      AAQRLCHILSNSRFLGDALNKSVESISWLGDDDN----LQARTREALDVQTGSALERFG-
GLNE_LEIXX      AAERLTRVLSGSRFVAELLGRIPESVAWLESEEE----LRPRAPELLREETAAILARHE-
GLNE_COREF      VGQRLMRILGTSPYTSELIIATPDFVSELGDGTTG-PKLLETAPDRVCKALKATVARHD-
GLNE_CORGL      VGQRLMRILGNSPYISELIISTPDFMKQLGDAASG-PKLLATAPTQVVKAIKATVSRHE-
GLNE_CORDI      VGQRLMRILGNSPYTADLIISAPDIVKQLGDGATR-PKLLETSEDRVTKSIVAAAARHD-
GLNE_MYCBO      VAKRLMHVLGTSAYVPDLLMRAPRVIQQYEDGPAG-PKLLETEPAAVARALIASASRYP-
GLNE_MYCTU      VAKRLMHVLGTSAYVPDLLMRAPRVIQQYEDGPAG-PKLLETEPAAVARALIASASRYP-
GLNE_MYCPA      VARRLMHVLGTSAYVPDLLMRAPRVIQDYGDGPSG-PRLLETDPAAVARALVASASRYS-
GLNE_MYCLE      VARRLMHVLGTSVYVPDLLMRAPEVIQSYGDGLAG-PKLLEAEPAMVARALITSAGRHT-
GLNE_NOCFA      VAQRLMIVLGSSEFLPDLLINAPETIRMFADGPHG-PLLLGPQPEEVARGILTAAARYD-
GLNE_STRAW      AAENLARVLSAGRLAPDLLMRAPEAVALLGDGDGGRGGLEPRGRAQLEQEVLAAVGRAG-
GLNE_STRCO      AAENLARVLSAGRLAPDLLMRAPEAVALLGDGVA--GGLRPRDRAQLEQETLAAVRRAD-
GLNE_CUTAK      MAQRLAVVLSTSRYAVDVLTRAPETVQVLVDDDL-----TPLSREDLARQMNAVARRHH-
                    :             :      .                                  

GLNE_AGRFC      ---YEDILDRLRIFAAEQRFLIGVRLLTGAIR-------------GEVAARAFTHLADLV
GLNE_RHIME      ---YEEVLDRLRIIAAEQRFLIGIRLLTGAIT-------------GLQAGRALTDLADLI
GLNE_BARHE      ---YEEILDHLRVFADEQRFLIGIRILNGAIT-------------GKKAGFAFTALADLI
GLNE_BARQU      ---YEEILDHLRVFADEQRFLIGIRILNGAIT-------------GEKAGFAFTALADLM
GLNE_BRUME      ---FEEVLDRLRIFAAEHRFLIGIRLLTGAIN-------------GVRAGQAFSDLAELM
GLNE_BRUSU      ---FEEVLDRLRIFAAEHRFLIGIRLLTGAIN-------------GVRAGQAFSDLAELM
GLNE_RHILO      ---YEEVLDRLRIFASEQKFLIGVRLLAGSID-------------PARAGRAFSDLADLT
GLNE_BRADU      ---YEEFLDRLRLFGQESLFLIGTRILSGTVS-------------AQQASTAFADVAEGV
GLNE_RHOPA      ---YEEFLDRLRLFGQESLFLIGTRILSGTVP-------------TQQAAVAFADVAEGI
GLNE_CAUVC      ---FEGAMDAARRLFRDQSFRIGVRVMSGTAD-------------ARDIGRAFAELADLI
GLNE_PSEPK      -DDLEQQMEALRHFKLAHSLRVAASEISGNLP-------------LMKVSDYLTWLAEAI
GLNE_PSESM      -DDLEQQMEALRHFKLAHSLRVAASEISGSLP-------------LMKVSDYLTWLAEAI
GLNE_PSEAE      -DDLEQQMETLRHFKLAHGLRVAASEIAGTLP-------------LMKVSDYLTWLAEAI
GLNE_ACIAD      -DQVEDQMRVLRLFKKSNVLTVAASDVLAESP-------------LMKVSDALTDIAEVS
GLNE_ECOLI      -DDEEQQLEALRQFKQAQLLRIAAADIAGTLP-------------VMKVSDHLTWLAEAM
GLNE_SHIFL      -DDEEQQLEALRQFKQAQLLRIAAADIAGTLP-------------VMKVSDHLTWLAEAM
GLNE_ECOL6      -DDEEQQLEALRQFKQAQLLRIAAADIAGTLP-------------VMKVSDHLTWLAEAM
GLNE_ECO57      -DDEEQQLEALRQFKQAQLLRIAAADIAGTLP-------------VMKVSDHLTWLAEAM
GLNE_SALTI      -EDEEQQLEALRQFKQAQLLRIAAADIAGTLP-------------VMKVSDHLTWLAEAM
GLNE_SALTY      -EDEEQQLEALRQFKQAQLLRIAAADIAGTLP-------------VMKVSDHLTWLAEAM
GLNE_YERPE      -DDEEQQLEALRQFKQAQQLRIAAGDITEALP-------------VMKVSDHLTYLAEAI
GLNE_YERPS      -DDEEQQLEALRQFKQAQQLRIAAGDITEALP-------------VMKVSDHLTYLAEAI
GLNE_PECAS      -DDEEQQLEAVRQFKQSQQLRIAAGDIGGVLP-------------VMKVSDHLTYLAEAI
GLNE_PHOLL      -DDEEQQLEALRQFKQAQLLRIAAEDITGVLP-------------VMKVSDHLTYLAEAI
GLNE_VIBVU      -DDVEQQMDALRQFKQICSLRIAAADIAGVLP-------------VMKVSDHLTYLAEAI
GLNE_VIBVY      -DDVEQQMDALRQFKQICSLRIAAADIAGVLP-------------VMKVSDHLTYLAEAI
GLNE_VIBPA      -DDMEQQMEALRQFKQICILRIAAADIAGVLP-------------VMKVSDHLTYLAEAI
GLNE_VIBCH      -EDMEQQMEGLRQFKQISILRIAAADIAGVLP-------------VMKVSDHLTYLAEAI
GLNE_PHOPR      -EDMEQQMEAIRQYKQAQLLRIAAADIAGALP-------------LMAVSDHLTYLAEAI
GLNE_SHEON      -DDMEQQMEALRQFKLSQQLKIAAADVTGVLP-------------VMQVSDHLTFLAEAI
GLNE_HAEDU      -EDEEALIDALRQFKQGHLLRIAVADILGVLP-------------VMKISDHLTYLAAAI
GLNE_MANHA      -EDEEALIDGLRQFKQTQILRIAAADILGVLL-------------VMKISDHLTYLAEAI
GLNE_MANSM      -DDDEQFITALRQFKQATLLRIAAADILGALP-------------VMKVSDHLTFLAETI
GLNE_PASMU      -DDEEQMIDGLRQFKQATLLRIAAADILGALP-------------VMKVSDHLTFLAEAI
GLNE_HAEIN      -DDEEQLIDALRQFKQATLLKVAAADILGALP-------------VMKVSDHLTYLAEAI
GLNE_METCA      -DDDEQLMLRLRQFKAAHQLRIAAADIMNVIP-------------VMVVSDYLTDLAEVV
GLNE_XANAC      -DDTEAALRELNERRLALSFRIALATLDGRQQ-------------AVESTRQLAWLAEAV
GLNE_XANCP      -DDTEAALRELNERRLALSFRIALATLDGRQQ-------------PVDSTQQLAWLAEAV
GLNE_BORBR      EPDIERQMNLMRDVQRQASFQLLAQDLEGELT-------------VEKLADQLSALADLL
GLNE_BORPA      EPDIERQMNLMRDVQRQASFQLLAQNLEGELT-------------VEKLADQLSALADLL
GLNE_BORPE      EPDIERQMNLMRDVQRQASFQLLAQDLEGELT-------------VEKLADQLSALADLL
GLNE_BURMA      ADGAEHQMDLLRHAHQAEVFRILLLDLAGRLS-------------VEHVSDRLSELADAM
GLNE_BURPS      ADGAEHQMDLLRHAHQAEVFRILLLDLAGRLS-------------VEHVSDRLSELADAM
GLNE_RALSO      GDHVEMQMDILRQEHHAETFRILLQDLQGMLT-------------VEPISDRLSDLADAV
GLNE_NEIMA      -GDTEAQMDTLRRFQHAQVFRLAVQDLAGLWT-------------VESLSDQLSALADTI
GLNE_NEIMB      -GDTEAQMDTLRRFQHAQVFRLAVQDLAGLWT-------------VESLSDQLSALADTI
GLNE_CHRVO      -GDVEAKMDALRHFQHAQTFRLVAQDLAGMWT-------------LEALSDELSRLADLV
GLNE_NITEU      VQMVEWQMDVLRHFQHAQVFRLLVTDLEGDLL-------------LEKLSDHLTELADLI
GLNE_BIFLO      -SNINEFATSMRAMRRHEIERIGLSWMSGVIS-------------DSDSLKAMTDVYDAI
GLNE_LEIXX      -SAETA-AAALRAVRRREVLRLAFSGILGFST-------------IEELARGLSAVTENL
GLNE_COREF      -DPDRA-IQAARSLRRQELARVASADLLNLLT-------------VQEVCHSLSLVWDAV
GLNE_CORGL      -SPDRA-IQAARSLRRQELARIASADLLNMLT-------------VQEVCQSLSLVWDAV
GLNE_CORDI      -DPDVA-IAVARSLRRAELARIASADLLQMLS-------------VQQVCRRLSYVWDAV
GLNE_MYCBO      -DPERA-IAGARTLRRRELARIGSADLLGLLE-------------VTEVCRALTSVWVAV
GLNE_MYCTU      -DPERA-IAGARTLRRRELARIGSADLLGLLE-------------VTEVCRALTSVWVAV
GLNE_MYCPA      -DPVRA-IAGARTLRRRELARVASADLLGMLE-------------VTDVCKALTSVWVAV
GLNE_MYCLE      -DPIRA-IDAARSLRRRELARVGSADLLGLLE-------------VTEVCKALTSVWVAV
GLNE_NOCFA      -DPNRA-VAAARSLRRHELARVASADLLGMLE-------------VPQVCRALSSVWVAV
GLNE_STRAW      -GSEQA-VTTVRGVRRRELFRTAARDIVSSYGTEETPAEADQGALVDLVGGAVSDLTAAT
GLNE_STRCO      -DAVQA-VTAVRGVRRRELFRTAAADIVGSYGTETQPVEADQGALVDLVGGAVSDLTSAT
GLNE_CUTAK      -DVEEA-VGAIRAVRRRKLFRILVADILNVTG-------------IRRIGQALTDLTGAT
                           .              :                         .: :    

GLNE_AGRFC      IEAALNAVLSEMEAAHGP----------YPGGRVAVMGMGKLGSFELTAGSDVDLILLYD
GLNE_RHIME      IAAALDAVLEEVRSAHGR----------FPGGRVAIVGMGKLGSHELTAGSDIDLILLYD
GLNE_BARHE      IAKTFATVQEEFSRLHGN----------IKGGRVGILGMGKLGSCELTAGSDVDLILLYE
GLNE_BARQU      IAKTLAAVQEEFSRIHGN----------IKGGRVGILGMGKLGSCELTAGSDVDLILVYE
GLNE_BRUME      VGRALEAVEAELQRRHGK----------VKGAKVALLAMGKLGSRELTAGSDVDLILLYD
GLNE_BRUSU      VGRALEAVEAELQRRHGK----------VKGAKVALLAMGKLGSRELTAGSDVDLILLYD
GLNE_RHILO      IEAALQAVTAEFAARHGT----------IAGGVVSLLGMGKLGSRELTAGSDVDLILLYD
GLNE_BRADU      VHTVHDLVADRFAAQHGR----------IKGQETAIIAMGRLGSREMTASSDLDLILLYD
GLNE_RHOPA      VGTVHGLVSEQFASTYGR----------VKGQQTAILAMGKLGSREMTASSDLDLILIYD
GLNE_CAUVC      IGGLAPAALAEVERIGGA----------FPG-QVAVVALGKAGSREMTAKSDLDLMTLYV
GLNE_PSEPK      LDQVLALAWRQTVARHGQPKRSDG---SLCDPGFIIIGYGKMGGLELGHGSDLDLVFIHD
GLNE_PSESM      LDQVLALAWRYSVARHGTPSRPDG---TLCDPGFVIVGYGKVGGIELGHGSDLDLVFIHD
GLNE_PSEAE      LVEVLELAWRQLVQRHGRPLRADG---TPCDPDFVIVGYGKVGGLEFGHGSDLDLVFIHD
GLNE_ACIAD      VAATLNLAYQAVVKKHGYPKDASGERCSLEHTGFAVIGYGKLGGIELGYGSDLDLVFIHY
GLNE_ECOLI      IDAVVQQAWVQMVARYGKPNHLNE----REGRGFAVVGYGKLGGWELGYSSDLDLIFLHD
GLNE_SHIFL      IDAVVQQAWGQMVARYGKPNHLNE----REGRGFAVVGYGKLGGWELGYSSDLDLIFLHD
GLNE_ECOL6      IDAVVQQAWVQMVARYGKPNHLNE----REGRGFAVVGYGKLGGWELGYSSDLDLIFLHD
GLNE_ECO57      IDAVVQQAWVQMVARYGKPNHLNE----REGRGFAVVGYGKLGGWELGYSSDLDLIFLHD
GLNE_SALTI      IDAVVQQAWTQMVARYGQPAHLDE----RQGRGFAVVGYGKLGGWELGYSSDLDLIFLHD
GLNE_SALTY      IDAVVQQAWTQMVARYGQPAHLDE----RQGRGFAVVGYGKLGGWELGYSSDLDLIFLHD
GLNE_YERPE      IDAVIQQAWNQMVARYGQPSHLQQ----SEGRGFAVIGYGKLGGWELGYSSDLDLVFLLD
GLNE_YERPS      IDAVIQQAWNQMVARYGQPSHLQQ----SEGRGFAVIGYGKLGGWELGYSSDLDLVFLLD
GLNE_PECAS      IAAVVQQAWGLMVERYGQPSHLQH----REGRGFAVIAYGKLGGWELGYSSDLDLVFLLD
GLNE_PHOLL      IEAVVLQAWGQMAKRYGVPSHLSQ----RQGLGFAVIGYGKLGGWELGYGSDLDLVFLLD
GLNE_VIBVU      VEAVVHQAWQQVAEKYGEPTHLKD----REGKGFAVVGYGKVGGWELGYNSDLDVVFLHD
GLNE_VIBVY      VEAVVHQAWQQVAEKYGEPTHLKD----REGKGFAVVGYGKVGGWELGYNSDLDVVFLHD
GLNE_VIBPA      VEAVVSQAWLQVSEKYGEPTHVKD----REGKGFAVIGYGKVGGWELGYNSDLDIVFMHD
GLNE_VIBCH      VEAVVSQAWLQVSSKYGEPTHLKH----RDGRGFAVVGYGKVGGWELGYNSDLDIVFMHD
GLNE_PHOPR      ITAVVNQAWLQMAEKYGEPTHLVD----RNGKGFGVIGYGKVGGWELGYGSDLDVVFLHD
GLNE_SHEON      IEQVVMQAWQQVAVRHGVPSYLAE----SSDTGFAVIGYGKLGGIELGYGSDLDLVFLYE
GLNE_HAEDU      ISEVVNMAWKSLVKRFGKPTHLAE----DE-RGFAVIAYGKLGGLELGYNSDLDLVFLHN
GLNE_MANHA      INAVVNMAWKQVSQRFGVPEHLEA----DE-KGFAVIGYGKLGGIELGYNSDLDLVFLHN
GLNE_MANSM      LHTVVNLAWQQITARFGKPEHLQN----NE-KGFLVAGYGKLGGIELGYRSDLDLVFLCD
GLNE_PASMU      IHVVVELAWQQVTTRFGTPAHLAE----GE-KGFLVIGYGKLGGIELGYKSDLDLVFLYQ
GLNE_HAEIN      IEVVVNLAWKQVSSRFGVPEHLQN----NE-KGFLVIGYGKLGGIELGYKSDLDLVFLYD
GLNE_METCA      IERVLRLAWKFAAARHGIPPVEAE--TSVDFPGFGIIAYGKLGGIELGYGSDLDLVFLYD
GLNE_XANAC      VQTVLHLARSDMLAAHGHVP----------GGSFAIVGYGSLGGLELGFGSDLDLVFLYD
GLNE_XANCP      VQTVLQLARRELVAAHGQVP----------GGAFAIIGYGSLGGLELGFGSDLDLVFLYD
GLNE_BORBR      LAETIRRVWPLVNRRP------------GAEPHLAVIAYGKLGGKELGYASDLDLVFLFD
GLNE_BORPA      LAETIRRVWPLVNRRP------------GAEPHLAVIAYGKLGGKELGYASDLDLVFLFD
GLNE_BORPE      LAETIRRVWPLVNRRP------------GAEPHLAVIAYGKLGGKELGYASDLDLVFLFD
GLNE_BURMA      LDVTIEVVWSQLAKRH------------RDTPCFAAIAYGKLGGKELGYASDLDLIFLYD
GLNE_BURPS      LDVTIEVVWSQLAKRH------------RDTPCFAAIAYGKLGGKELGYASDLDLIFLYD
GLNE_RALSO      LDLTLETVWQQVSTRH------------REVPRFAVVAYGRLGGKELGYASDLDLIFLYD
GLNE_NEIMA      LAAALLCAWADMPKKH------------RDTPQFAIVGYGKLGGKELGYASDLDLVYLYD
GLNE_NEIMB      LAAALLCAWADMPKKH------------RDTPQFAVVGYGKLGGKELGYASDLDLVYLYD
GLNE_CHRVO      LAAAVRHAWRDIPSRH------------CETPRFAVIGYGKLGGKELGYASDLDIIFLYD
GLNE_NITEU      LDNVLQLAWQGLKKKH------------RELPAFAIIGYGKLGGKELGYASDLDIVFLYR
GLNE_BIFLO      IDASLTWAVRHQIAEFGV---------ETAPAGITVIAMGRYGGREVNFSSDADAILIYR
GLNE_LEIXX      LTGVLG-----AIRAARD---------DAAALEFAIIGMGRFGGRELGFGSDADIMYVFR
GLNE_COREF      LDAALEAEIRAATADPA--------KPDEPLAAISVIGMGRLGGAELGYGSDADVMFVAE
GLNE_CORGL      LDAALDAEIRAALNDPQ--------KPDQPLANISVIGMGRLGGAELGYGSDADVMFVCE
GLNE_CORDI      LEAGLQAEIRASLIGSTGD------KNSVPPARIAVIGMGRLGGSELGYGSDADVMFVCE
GLNE_MYCBO      LQAALDVMIRASLPDDD-----------RAPAAIAVIGMGRLGGAELGYGSDADVMFVCE
GLNE_MYCTU      LQAALDVMIRASLPDDD-----------RAPAAIAVIGMGRLGGAELGYGSDADVMFVCE
GLNE_MYCPA      LQAALDAMIRANLPDDGP-------QRGKAPAAIAVIGMGRLGGAELGYGSDADVMFVCE
GLNE_MYCLE      LQAALDAVIRAYLPDGD-----------KAPAAIAVIGMGRLGGAELGYGSDADVMFVCE
GLNE_NOCFA      LDAALAAVIRAGEAESGE----------PAPAAFAVIGMGRLGGMELGYGSDADVLFVCE
GLNE_STRAW      LAGTLRAVVREGWGDTL-------------PTRFAVVGMGRFGGYELGYGSDADVLFVHE
GLNE_STRCO      LAGTLRAVVREKWGDVL-------------PTRFAIIGMGRFGGHELGYGSDADVLFVHE
GLNE_CUTAK      IDAALTAVSREVED----------------APPIGIVAMGRWGGQELSYASDADCLFVVG
                :                                    . *  *. *.   ** * : :  

GLNE_AGRFC      YDD--TAQESTGAKPLDVVRYFTRVTQRLIAALSAPTAEGVLYEVDMRLRPSGNKGPVAT
GLNE_RHIME      YDD--EVLESDGAKPLDPVRYFTRVTQRLIAALSAPTAEGILYDVDMRLRPSGNKGPVAT
GLNE_BARHE      HDE--DAEISDGGKPLYIFQYYTRLTQRLVAALSTLTSQGILYAVDLRLRPLGNKGPVAV
GLNE_BARQU      HDE--DAEISDGEKPLYISQYYTRFTKRLIAALSTLTSQGVLYAVDLRLRPLGNKGPVAV
GLNE_BRUME      HDK--DAEESDGEKPLAPSKYYIRLTQRLIAALSAPTAEGVLYEVDMRLRPSGNKGPVAT
GLNE_BRUSU      HDK--DAEESDGEKPLAPSQYYIRLTQRLIAALSAPTAEGVLYEVDMRLRPSGNKGPVAT
GLNE_RHILO      HDA--DAEDSDGDKPLAPSHYYTRMTQRLISAVSAPTAEGVLYELDLRLRPSGNKGPVAT
GLNE_BRADU      FDS--ENPDSDGPKSLQGAHYFARFTQRLISAFTTRTNYGVLYEIDMRLRPSGRAGPVAS
GLNE_RHOPA      FDD--DQPDSDGERSLHGAQYFARFTQRLISAFTTRTNYGVLYDVDMRLRPSGRAGPVAS
GLNE_CAUVC      AD---DPRSMSALKDWSAEVFYARLTQRLTSALSAPTGEGTLYEVDLKLRPSGTKGPVAV
GLNE_PSEPK      GD---PQAETDGAKPIDSAQFFTRLGQRIIHLLTTQTNSGQLYDVDMRLRPSGASGLLVS
GLNE_PSESM      GD---LQTETDGAKPIDSAQFFTRLGQRVIHLLTTQTNSGQLYDVDMRLRPSGASGLLVS
GLNE_PSEAE      GD---PQCETDGGKSIDGAQFFTRLGQKIIHFLTAQTPSGTLYEVDMRLRPSGAAGLLVS
GLNE_ACIAD      FD---EQAETDGSKSITGFEFAMRVAQKFLSLMTTQTLDGRVYEIDTRLRPSGEAGLLVT
GLNE_ECOLI      CP---MDAMTDGEREIDGRQFYLRLAQRIMHLFSTRTSSGILYEVDARLRPSGAAGMLVT
GLNE_SHIFL      CP---MDAMTDGEREIDGRQFYLRLAQRIMHLFSTRTSSGILYEVDARLRPSGAAGMLVT
GLNE_ECOL6      CP---MDAMTDGEREIDGRQFYLRLAQRIMHLFSTRTSSGILYEVDARLRPSGAAGMLVT
GLNE_ECO57      CP---MDAMTDGEREIDGRQFYLRLAQRIMHLFSTRTSSGILYEVDARLRPSGAAGMLVT
GLNE_SALTI      CP---MDVMTNGEREIDGRQFYLRLAQRIMHLFSTRTSSGILYEVDARLRPSGAAGMLVT
GLNE_SALTY      CP---MDVMTNGEREIDGRQFYLRLAQRIMHLFSTRTSSGILYEVDARLRPSGAAGMLVT
GLNE_YERPE      CP---LDVMTDGDRSIDGRQFYLRLAQRIMHLFSTRTSSGILYEVDARLRPSGEAGMLVS
GLNE_YERPS      CP---LDVMTDGDRSIDGRQFYLRLAQRIMHLFSTRTSSGILYEVDARLRPSGEAGMLVS
GLNE_PECAS      CP---SDVMTDGERSIDGRQFYLRLAQRVMHLFSTRTSSGILYEVDARLRPSGAAGMLVS
GLNE_PHOLL      CP---MDVMTDGDRSIDARQFYLRLAQRIMHLFSARTSSGVLYDVDVRLRPSGESGMLVS
GLNE_VIBVU      CP---VNVYTDGKKEIDGRQFYLRLAQRIIHIFSTRTASGILYEVDTRLRPSGASGLLVC
GLNE_VIBVY      CP---VNVYTDGKKEIDGRQFYLRLAQRIIHIFSTRTASGILYEVDTRLRPSGASGLLVC
GLNE_VIBPA      CP---VNVYTDGKKEIDGRQFYLRLAQRIIHIFSTRTASGILYEVDTRLRPSGASGLLVS
GLNE_VIBCH      CP---VEVNTDGEKSIDGRQFYLRLAQRIIHIFSTRTASGILYEVDTRLRPSGASGLLVS
GLNE_PHOPR      CP---ADIYTNGKKEIDGRQFYLRLAQRIVHLFSTRTSSGVLYEIDVRLRPSGASGLLVS
GLNE_SHEON      APENMANSLTNGDRPIEVGHFYLKLAQRILHLFSTRTTSGELYEVDMRLRPSGASGLMVS
GLNE_HAEDU      AP--LEGETSG-RRSISNHQFYLKLAQKINSIFNLNTSAGVLYEVDMRLRPSGDAGLLVS
GLNE_MANHA      AP--EDSQTVGGKKEISSHQFYLKLAQKINSIFNLNTSAGVLYEVDMRLRPSGEAGLLVS
GLNE_MANSM      EI--HSGQTVGGKKVIDSHQFYLRLAQKIISIFSMTTSAGILYEVDLRLRPSGEAGPLCC
GLNE_PASMU      SD--EQSQTCGGKRSIESNQFYLRLAQKIISIFSINTFAGVLYEVDMRLRPSGESGLLCS
GLNE_HAEIN      AV--ES-QTTGGKKVIDSNQFYLRLAQKIVSIFSINTSAGVLYEADMRLRPSGDAGLIGC
GLNE_METCA      GV--ASDAVTDGPRPISAAEFYARVVQRMVSLLTADMPGGALYEVDLRLRPSGSSGLLVS
GLNE_XANAC      HP--REVDASDGKRPLDAGRWFARLAQKVMALLAAETGAGRLYDIDVRLRPDGGKGALVS
GLNE_XANCP      HP--REVEASDGKRPLEAGRWFARLAQKVMTLLGAETGAGRLYDIDVRLRPDGGKGALVS
GLNE_BORBR      DD------------REDAAELYAKLGRRMTSWLSTMTSSGRLYEVDLRLRPDGDAGLLAV
GLNE_BORPA      DD------------REDAAELYAKLGRRMTSWLSTMTSSGRLYEVDLRLRPDGDAGLLAV
GLNE_BORPE      DD------------REDAAELYAKLGRRMTSWLSTMTSSGRLYEVDLRLRPDGNAGLLAV
GLNE_BURMA      DP------------DERAADVYTTFARRLITWLTTATGAGTLFDIDLRLRPNGEAGLLVT
GLNE_BURPS      DP------------DERAADVYTTFARRLITWLTTATGAGTLFDIDLRLRPNGEAGLLVT
GLNE_RALSO      DD------------DERAPEVYAAYARKLITWLTSHTAAGMLFDVDTRLRPNGAAGLMVT
GLNE_NEIMA      DP------------HPDAGDVYSRLARRLTNWLSTATGAGSLYETDLRLRPNGDAGFLAH
GLNE_NEIMB      DP------------HPDAGDVYSRLARRLTNWLSAATGAGSLYETDLRLRPNGDAGFLAH
GLNE_CHRVO      DE------------HPDAPDLYSRLARKLSTWLTSATAAGVLYDIDLRLRPNGSSGLLVS
GLNE_NITEU      DD------------HPDAASIYTKLAQNINLWLTSHTSAGILYETDLRLRPNGTSGLLVN
GLNE_BIFLO      PA--------DDADDGQANAFAKKVVEDLRNILQGPTTLEPKIELDLDLRPEGKNGPLVR
GLNE_LEIXX      PL--------AAGQDA-AHRAATAIVADLNRLTEDSAL---PVDLDIGLRPEGKNGPSVR
GLNE_COREF      PA--------PGVDENEAIAWAISVCESMRSRLAKPSG-DPPLEVDLGLRPEGRSGAVVR
GLNE_CORGL      PV--------AGVEEHEAVTWSIAICDSMRSRLAQPSG-DPPLEVDLGLRPEGRSGAIVR
GLNE_CORDI      PT--------EGVSDEAAVKWAIGVCDSMRSRLAKPSG-DPPLDVDLGLRPEGRSGAVVR
GLNE_MYCBO      PA--------TGVDDARAVKWSTSIAERVRALLGTPSV-DPPLELDANLRPEGRNGPLVR
GLNE_MYCTU      PA--------TGVDDARAVKWSTSIAERVRALLGTPSV-DPPLELDANLRPEGRNGPLVR
GLNE_MYCPA      PA--------PGVDDSAAVRWAASVAEQVRTLLGTPSV-DPPLDVDANLRPEGRNGPLVR
GLNE_MYCLE      PA--------IGVEDAQALRWSGMIAERVCRLLRTPSV-DPPLDVDANLRPEGRNGPLVR
GLNE_NOCFA      PR--------PGVDETKAVKWANTVAERVQRLLGAPST-DPPLHVDAGLRPEGRSGALVR
GLNE_STRAW      PR--------EGVDEQEAARAANAVVSEMRRLLQIPSA-DPPLLIDADLRPEGKSGPTVR
GLNE_STRCO      PR--------DGVAEREAGDAANKVVSEMRRLLQVPSA-DPPLLIDADLRPEGRSGPLVR
GLNE_CUTAK      DG--------PGVGEK-----ALKIVTKLRNLLGKHGA-DPAVVLDADLRPEGRSGPMVR
                                            .                *  *** *  *    

GLNE_AGRFC      RISAFEKYQR------EEAWTWEHMALSRARLICGD-ASLMEDARSIIASILSQKRDVAK
GLNE_RHIME      RITAFAKYQR------TEAWTWEHLALTRARCICGD-ESLVGEAEAIFAEILTEKRDIAK
GLNE_BARHE      SFEFFRKYYR------KEAWIWEHLALTRARGIAGD-LDFLQKLENEVYEIIAFSRNKKD
GLNE_BARQU      SFEFFRKYYR------KEAWIWEYLALTRARGIAGD-PNFLQNLENEVCAIIALPHDKKD
GLNE_BRUME      HIEAFGKYQR------NDAWTWEHMALTRARPIHGD-EAFIARIKVDIEDVLAMPRDVRK
GLNE_BRUSU      HIEAFGKYQR------NDAWTWEHMALTRARPIHGD-EAFIARIKVDIEDVLAMPRDVRK
GLNE_RHILO      HIDAFKKYQR------QEAWTWEHMALSRARAIGGD-TGLCAEVEAEVAAVLGQPRDAAK
GLNE_BRADU      SLASFADYQA------NEAWTWEHMALTRARVVSAS-AEFGERIAGVIRDVLTRRRDPAT
GLNE_RHOPA      RLDAFAAYQE------QEAWTWEHLALTRARVISAP-PEFRSRIEQVIRAVLTRQRDAAI
GLNE_CAUVC      SFAAFEHYYE------REAETWELLALTRARVVWASSPDFKARAEGAIAAALRRPRAWKK
GLNE_PSEPK      SLGAFERYQQ------NEAWTWEHQALVRARVLVGC-KQVGAAFEGVRAKVLGQARDLEK
GLNE_PSESM      SLGAFARYQA------NEAWTWEHQALVRARVLTGS-RDVGEQFEKVRADVLGRERDLDT
GLNE_PSEAE      SLGAFQRYQE------QEAWTWEHQALVRARVLAGC-RRVQASFEAVRAEVLARPRDLDA
GLNE_ACIAD      SLKAFEQYQL------KSAWLWEHQALVRARSIAGE-AQLRQKFESLRCQILTQSRDENE
GLNE_ECOLI      SAEAFADYQK------NEAWTWEHQALVRARVVYGD-PQLTAHFDAVRREIMTLPREGKT
GLNE_SHIFL      SAEAFADYQK------NEAWTWEHQALVRARVVYGD-PQLTAHFDAVRREIMTLPREGKT
GLNE_ECOL6      SAEAFADYQK------NEAWTWEHQALVRARVVYGD-PQLTAHFDAVRREIMTLPREGKT
GLNE_ECO57      STEAFADYQK------NEAWTWEHQALVRARVVYGD-PQLTAHFDAVRREIMTLPREGKT
GLNE_SALTI      SADAFADYQQ------HEAWTWEHQALVRARVVYGD-PQLTSQFDAVRRTIMTTARDGKT
GLNE_SALTY      SADAFADYQQ------HEAWTWEHQALVRARVVYGD-PQLTSQFDAVRRTIMTTARDGKT
GLNE_YERPE      TIEAFADYQR------NEAWTWEHQALVRARIVYGS-PKLHQQFDAIRQQILCRHREDPQ
GLNE_YERPS      TIEAFADYQR------NEAWTWEHQALVRARIVYGS-PKLHQQFDAIRQQILCRHREDPQ
GLNE_PECAS      TVEAFDDYQR------NEAWTWEHQALVRARMVYGE-SGVQQTFESIRRSILCAERDADT
GLNE_PHOLL      TIGAFADYQR------NQAWTWEHQALVRARMVFGD-ENLHRDFERIRHQTLCTRREPAL
GLNE_VIBVU      PVDAFEEYQH------NDAWTWEHQALVRARMIYGD-EHLASEFHRVRHQVLAKPREQAK
GLNE_VIBVY      PVDAFEEYQH------NDAWTWEHQALVRARMIYGD-EHLASEFHRVRHQVLAKPREQAK
GLNE_VIBPA      PTDAFDDYQH------QDAWTWEHQALVRARMIYGD-EPLAIAFHNTRHDVLCKPRDEQT
GLNE_VIBCH      PTDAFDEYQR------QEAWTWEHQALVRARMIYGD-APLQQAFANTRHQILCLPREEHK
GLNE_PHOPR      TVESFDEYQQ------KEAWTWEHQALVRARMIYGD-VPLFDAFSDVRKRILTQPRDTQS
GLNE_SHEON      EIARFGEYQA------QEAWTWEHQALVRSRFVFGD-NSLAVKFSQIRACVLEQSRDKDE
GLNE_HAEDU      TFQAYQYYQQ------HEAWTWETQALVRGRCVYGS-ASLIDEFSRIRRTTLCLARTRGR
GLNE_MANHA      TFNAYEHYQK------NEAWTWESQALVRTRCVFGA-ENLKQAFEKIRQSTLAQPRASGQ
GLNE_MANSM      SFKAFEDYQM------NEAWTWEKQSLVRSRAVYGE-PALREKFELIRTGILASPRDLTQ
GLNE_PASMU      SISAFKAYQL------HDAWTWEKQALVRSRAIYGE-ARLQTEFNAIRAEVLSAPRDLAT
GLNE_HAEIN      SLSAFSHYQL------NDAWTWEKQALVRARPVFGE-SSLKAKFEHIRQQVLSASRDIEQ
GLNE_METCA      KADAYENYQL------HQAWTWERQALVRARFVAGD-PKVGARFDAIRRNVLCRERDSRQ
GLNE_XANAC      SLASYREYQR------DRAWTWEHQALVRARAVAGD-AALCDAFAQVRRDTLMRVRDTAQ
GLNE_XANCP      SLASYRDYQR------DRAWTWEHQALVRARAVAGD-AALCEAFVQVRRETLTRVRDPAL
GLNE_BORBR      SLEAFEQYQR------SHAWPWEHQALTRARYAAGD-TEAGARFERIRADILVMPRDVQA
GLNE_BORPA      SLEAFEQYQR------SHAWPWEHQALTRARYAAGD-TEAGARFERIRADILVMPRDVQA
GLNE_BORPE      SLEAFEQYQR------SHAWPWEHQALTRARYAAGD-TEAGARFERIRADILVMPRDVQA
GLNE_BURMA      DLDAFRRYQLREGDAANTAWVWEHQALTRARYSAGD-ARIGAAFEAIRVQVLTTPRDAAV
GLNE_BURPS      DLDAFRRYQLREGDAANTAWVWEHQALTRARYSAGD-ARIGAAFEAIRVQVLTTPRDAAV
GLNE_RALSO      HFEAFRRYQMREGD--NAAWVWEHQALTRARFCAGD-PEIGARFEALRIAVLRQPREAGP
GLNE_NEIMA      SIAAFEKYQR------ENAWTWEHQSLTRARFICGT-PEIQTAFDRIRTEILTAERDQTA
GLNE_NEIMB      SIAAFEKYQR------ENAWTWEHQSLTRARFICGT-SEIQTAFDRIRTEILTAERDQTA
GLNE_CHRVO      SISAFRQYQE------NQAWVWEHQALTRARFVAGD-AGIGSQFEAERHAILTLERDPAK
GLNE_NITEU      SIEAFTQYQY------EQAWVWEHQALTRARFVVGD-REAGEMFEQMRKNMLCQPRDLVK
GLNE_BIFLO      SYASCEEYYE------SWASTWERQALLRARYAAGD-AELARDFLINIADPLRYPTTELT
GLNE_LEIXX      SLDSYRAYYA------RWSLAWEAQALLRARGVAGD-SALIGDF-ETLADEVRYPAS-IG
GLNE_COREF      TIESYENYYA------KWGETWEVQALLRASWVAGD-RELGTRF-LETIDKFRYPAGGAS
GLNE_CORGL      TVDSYVKYYE------KWGETWEIQALLRAAWVAGD-RELGIKF-LESIDRFRYPVDGAT
GLNE_CORDI      TLESYKQYYE------RWGEVWEIQALLRADFIAGD-QELGARF-LEMIEPLRYPEAGVS
GLNE_MYCBO      TLGSYAAYYE------QWAQPWEIQALLRAHAVAGD-AELGQRF-LRMVDKTRYPPDGVS
GLNE_MYCTU      TLGSYAAYYE------QWAQPWEIQALLRAHAVAGD-AELGQRF-LRMVDKTRYPPDGVS
GLNE_MYCPA      TLASYAACYE------QWAQPWEIQALLRAHAVAGD-AELGHRF-LLMADKTRYPADGVS
GLNE_MYCLE      TLGAYAAYYA------QWAQPWEIQALLRAHAVAGD-ADLGQRF-LLMADKMRYPPDGVS
GLNE_NOCFA      TLSAYQAYYG------QWAQSWEVQALLRAHQVAGD-QELGVRF-LHAVDKVRYPAGGVS
GLNE_STRAW      TLTSYEAYYR------RWSLVWESQALLRAEFVAGD-EELGQRF-IELIDPFRYPAEGLG
GLNE_STRCO      TLKSYEAYYR------RWSLGWESHALLRAEFVAGD-EELGRRF-IELIDPLRYPEGGLG
GLNE_CUTAK      SLESYRKYYG------KWSSTWESQALLRASHGAGD-RELTNEL-LEYVDQVRYPADGLT
                                  .  **  :* *     .                         

GLNE_AGRFC      VSTDVLDMRSLIEQEKPP--------------ENNWDFKLINGGLIDLEFIAQYLALIGP
GLNE_RHIME      IRKDVEEMRGLIDKEKPP--------------KDIWDFKLIPGGLVDIEFIAQYLALVAP
GLNE_BARHE      VIKAVCEMHVLIGKGKPP--------------ENRWDLKRMPGGIMHLEFIAQFALIT--
GLNE_BARQU      VAKAVREMRTLIEKEKPP--------------ENRWDLKMMSGGIMDVEFIAQFALIT--
GLNE_BRUME      LAGDVREMRELIAQEKPP--------------RDDWDLKLKPGGIIDLEFIAQFATLAG-
GLNE_BRUSU      LAGDVREMRELIAQEKPP--------------RDDWDLKLKPGGIIDLEFIAQFATLAG-
GLNE_RHILO      VKTEAADMRAMIEKEKPA--------------RDLWDIKLIPGGLIDLEFIAQVAVITG-
GLNE_BRADU      IANDVADMRRAIAQEKGE--------------TDYWDLKYAAGGMIDIDFIAQYLQLVHA
GLNE_RHOPA      IANDVAEMRRAIAQEKGE--------------DDVWDLKYAAGGMVDIDFIAQYLQLVHA
GLNE_CAUVC      TAADVIEMRQLMERERPG--------------KGDWDLKLDPGGLVDIEFAAQFLQLAH-
GLNE_PSEPK      LRGEVSEMRAKMRDNLGTKATAAGTAANAFDAGVPFDIKQDAGGIVDIEFMVQYAALAWS
GLNE_PSESM      LRAEVSEMRAKMRDNLGTRLTAAGRAANAFEASVPFDLKQDAGGIVDIEFMVQYAALAWS
GLNE_PSEAE      LRTEVSEMRAKMRDNLGTRATAAGTASNAFEATAAFDLKHDAGGIVDIEFMVQYAVLAWS
GLNE_ACIAD      VRDEVLKMRQKMKDHLGS--------SNEQKKHGIFHLKQDAGGIVDIEFMAQYMVLAWS
GLNE_ECOLI      LQTEVREMREKMRAHLGN------------KHRDRFDIKADEGGITDIEFITQYLVLRYA
GLNE_SHIFL      LQTEVREMREKMRAHLGN------------KHRNRFDIKADEGGITDIEFITQYLVLRYA
GLNE_ECOL6      LQTEVREMREKMRAHLGN------------KHRDRFDIKADEGGITDIEFITQYLVLRYA
GLNE_ECO57      LQTEVREMREKMRAHLGN------------KHRDRFDIKADEGGITDIEFITQYLVLRYA
GLNE_SALTI      LQTEVREMREKMRAHLGN------------KHRDRFDIKADEGGITDIEFIAQYLVLRYA
GLNE_SALTY      LQTEVREMREKMRAHLGN------------KHRDRFDIKADEGGITDIEFIAQYLVLRYA
GLNE_YERPE      LQQEVREMREKMRNHLGS------------KQRDIFDIKADAGGITDIEFIAQYLVLRYA
GLNE_YERPS      LQQEVREMREKMRNHLGS------------KQRDIFDIKADAGGITDIEFIAQYLVLRYA
GLNE_PECAS      LRTEVREMREKMRQHLAN------------KDKSRFDIKTDAGGITDIEFITQYLVLRYA
GLNE_PHOLL      LRQQVREMREKMHKHLGS------------HHSDQFDIKADPGGITDIEFIAQYLVLRYA
GLNE_VIBVU      LQKEVADMRAKMRDHLGG------------KKSDRFMLKQDQGGITDIEFLAQYLVLNYS
GLNE_VIBVY      LQKEVADMRAKMRDHLGG------------KKSDRFMLKQDQGGITDIEFLAQYLVLNYS
GLNE_VIBPA      LKKEVVEMREKMRDHLGG------------KKSGRFMIKQDVGGITDIEFLAQYLVLNYS
GLNE_VIBCH      LKQEVVEMRIKMRDHLGG------------KKAGRFMLKQDEGGITDIEFLAQYLVLRFS
GLNE_PHOPR      LQVDVVSMRHKMRVHLGS------------KKNGMFGLKQDKGGITDIEFLAQYLVLQHS
GLNE_SHEON      LKKAVREMRQKMRDHLLK------------VSEGEFDLKQSPGGITDIEFIAQYLVLANA
GLNE_HAEDU      LRQEISQMRHKMYQHLTK------------TSTGQFNLKTDQGGITDIEFIAQSIVLEYA
GLNE_MANHA      LRQEICEMRQKMYQHLSS------------HSAEQFHIKQDQGGITDIEFIAQYLVLAHS
GLNE_MANSM      LKIDVREMREKMYRHFAG------------ADDNKFNIKKDQGGITDIEFIAQYLVLAHA
GLNE_PASMU      LQQDVVAMRQKMYAHLAH------------PDSDTFNIKTDRGGITDIEFIAQYLVLAHA
GLNE_HAEIN      LKQDVVEMRKKMFAHLSH------------SKHSEFNLKTDRGGITDIEFIAQYLMLANA
GLNE_METCA      VRLDVRSMREKMREHLAD------------RRPGVFDLKQGVGGIADIEFIVQFGVLISA
GLNE_XANAC      LHEDVRKMRARMRAELDR------------SDAGRLDLKQGAGGLVDLEFVLQAGVLGLA
GLNE_XANCP      LHEDVRKMRARMRSELDR------------SDAGRLDLKQGAGGLVDLEFLLQAGVLGQA
GLNE_BORBR      LRGEVLGMRDKISAGHPN-------------RSELFDVKHDRGGMVDVEFVTQYLVLCHA
GLNE_BORPA      LRGEVLGMRDKISAGHPN-------------RSELFDVKHDRGGMVDVEFVTQYLVLCHA
GLNE_BORPE      LRGEVLGMRDKISAGHPN-------------RSELFDVKHDRGGMVGVEFVTQYLVLCHA
GLNE_BURMA      LAKEIVEMREKVLAGHPN-------------TTERFDLKHDRGGMVDIEFAVQYWVLLHA
GLNE_BURPS      LAREIVEMREKVLAGHPN-------------TTERFDLKHDRGGMVDIEFAVQYWVLLHA
GLNE_RALSO      LRDEIAAMRERVLEGHAN-------------PTPLFDLKHDRGGMVDIEFTVQFLVLLHS
GLNE_NEIMA      LSGEIIEMREKMFPTHPP-------------ADS--NVKYARGGVVDVEFIVQYLILAHA
GLNE_NEIMB      LAGEIIEMREKMFPTHPP-------------ADS--NVKYARGGVVDVEFIVQYLILAHA
GLNE_CHRVO      LRDEVMAMRQRMLDSHPA-------------HDG--DVKNARGGIIDIEFIVQYLILAHA
GLNE_NITEU      LKREILMMRSKMLEAHPN-------------PTPLFDIKHDRGGIIDVEFIVQYLVLGYA
GLNE_BIFLO      EAELQNIRKLKARMEAER---------LPRGVRRERHLKLGKGGLSDVEWTVQLMQLQHA
GLNE_LEIXX      EQAVREVKRIKARIENER---------LPQGADPARHLKLGRGSLSDVEWFVQLVQLQHA
GLNE_COREF      DAQIREVRRMKARVDNER---------LPRGADRNTHTKLGRGALADIEWTVQLLTMLHA
GLNE_CORGL      QAQLREVRRIKARVDNER---------LPRGADRNTHTKLGRGALTDIEWTVQLLTMMHA
GLNE_CORDI      QKVIREVRRMKARVDNER---------LPRGADRNTHTKLGRGALTDVEWTVQLLTMMHA
GLNE_MYCBO      ADSVREIRRIKARIESER---------LPRGADPNTHTKLGRGGLADIEWTVQLLQLQHA
GLNE_MYCTU      ADSVREIRRIKARIESER---------LPRGADPNTHTKLGRGGLADIEWTVQLLQLQHA
GLNE_MYCPA      PEAVREIRRIKARVDAER---------LPRGADPNTHTKLGRGGLADIEWTVQLLQLLHA
GLNE_MYCLE      AEAVREIRRMKARVEAER---------LPRGADPHTHTKLGRGGLADIEWTVQLMQLRHA
GLNE_NOCFA      EDAVREIRRIKARVDSER---------LPRGADPATHTKLGRGGLADIEWTVQLLQLRHA
GLNE_STRAW      DDAVREIRRLKARMEAER---------LPRGADPTLHTKLGRGGLSDVEWTVQLLQLQHG
GLNE_STRCO      EDAVREIRRLKARMESER---------LPRGADPKLHAKLGPGGLSDVEWTVQLLQLRHG
GLNE_CUTAK      GSQLAEIRKLKARMESER---------IPRGVDPRRHLKLGPGGLSDIEWTAQIIQLQHA
                        :                             *   *.:  :::  *   :   

GLNE_AGRFC      VKGLGAHEPGRNTAEALQALAA-PVMESQAFDDCMAAMGLYTEISQIVRLCIDGA-----
GLNE_RHIME      ARGVTSPPAGTHTLEALKALGA-GMMNANDLDTAAEALVLFTELSQLVRLCIDGD-----
GLNE_BARHE      --HVIVFQIGATTADILTQLPN-SFLNQSFISDLHHAYGLYTNLSQIIRLCLNDA-----
GLNE_BARQU      --HVVAFQIGASTADILAHLPN-SVLNQSCIVDLHRAYSLYTNLNQMIRLCLNDA-----
GLNE_BRUME      --YVKKTPRPFATEEVLANLDP-FFADPAMVDGLVEAHRFYTNLSQAIRLCLNDS-----
GLNE_BRUSU      --YVKKTPRPFATEEVLANLDP-FFADPAMVDGLVEAHRFYTNLSQAIRLCLNDS-----
GLNE_RHILO      --QVGAGPRATGTAEILSRLAP-GFADAGARQELGAAFALYLALTQMTRLCLTGS-----
GLNE_BRADU      --HHKPDILDVSTLQVLDNAARLGVLPQSEAEILRAAARLYHDLTQILRLCVSDR-----
GLNE_RHOPA      --HEAPDILHVNTLSALDNATRLGLLAQADAEVLRPAARLYQNLTQILRLCVSEK-----
GLNE_CAUVC      --AAADGPLRQNTGEALAALREAGLADAGALSRLEAAWRLEQDLSQLIKVALEDG-----
GLNE_PSEPK      H-DHPAILRWTDNIRILEELEQANLMPASDAVLLREVYKAFRSASHRQALQK--------
GLNE_PSESM      R-EHPALLQHTDNIRILEGLEEAGLLPDVDASLLREAYKAYRSAAHRQALQK--------
GLNE_PSEAE      G-EHPALLEFTDNIRILEGLERAGLIASEDVRLLQEAYKAYRAAAHRLALQK--------
GLNE_ACIAD      G-ANPDLAHFSDNVRILEDAAQAGCLSSEDATALMHAYLRERAESHRLALAN--------
GLNE_ECOLI      H-EKPKLTRWSDNVRILELLAQNDIMEEQEAMALTRAYTTLRDELHHLALQE--------
GLNE_SHIFL      H-EKPKLTRWSDNVRILELLAQNDIMEEQEAMALTRAYTTLRDELHHLALQE--------
GLNE_ECOL6      H-EKPKLTRWSDNVRILELLAQNDIMEEQEAMALTRAYTTLRDELHHLALQE--------
GLNE_ECO57      H-EKPKLTRWSDNVRILELLAQNDIMEEQEAMALTRAYTTLRDELHHLALQE--------
GLNE_SALTI      H-EKPKLTRWSDNVRILELLAQNGIMDEHEAQALTVAYTTLRDELHHLALQE--------
GLNE_SALTY      H-EKPKLTRWSDNVRILELLAQNGIMDEHEAQALTVAYTTLRDELHHLALQE--------
GLNE_YERPE      A-SEPRLTRWSDNVRIFESMAHYDIMSPEEAAALTRAYVTMRDEIHHLALQE--------
GLNE_YERPS      A-SEPRLTRWSDNVRIFESMAHYDIMSPEEAAALTRAYVTMRDEIHHLALQE--------
GLNE_PECAS      A-QEPRLTHWSDNVRILELMAQYGVMEESEANALKLAYVTMRNELHHLALQE--------
GLNE_PHOLL      A-ENERLVRWSDNVRIFQLMAAYEIMDEDEAAGLTQAYVSMRDELHHLTLQT--------
GLNE_VIBVU      A-EKPKLTRWCDNVRIFETLIAQGVMEEAQAMLLTQAYTTMRDEIHRRNLLN--------
GLNE_VIBVY      A-EKPKLTRWCDNVRIFETLIAQGVMEEAQAMLLTQAYTTMRDEIHRRNLLN--------
GLNE_VIBPA      H-EKPKLTRWCDNVRIYETLIAQGVMEEDQAMQLIRAYTAMRNEIHHRNLLN--------
GLNE_VIBCH      H-QQPKLTRWSDNVRIFESLMNHQVMSESQALALTHAYTSMRDQIHRRNLLN--------
GLNE_PHOPR      H-TEPYLTRWSDNVRIFDTMAECEVLSLSQASALKQAYCVMRDDIHRLNLLG--------
GLNE_SHEON      H-EYPELSIWSDNVRIFGVLAELELLPLMSAQHLTQSYCWLRDENHRLTLQQ--------
GLNE_HAEDU      H-CYPEMAKWSDNVRIFTAAIECGILSQHIGEGLKNAYTRIRNRIHQLNLLQ--------
GLNE_MANHA      H-QHPKMAVWSDNVRIFDSAVECGILSSEQSEQLQHCYTALRNKIHHLKLLR--------
GLNE_MANSM      P-ENPNLAYWSDNVRIFDIMAEHGIITLNEAEKLKNCYTGLRNQIHHLNLLG--------
GLNE_PASMU      P-QNPALTRWSDNVRIFEIMAESAVISQEICDQLKQCYVDLRNRIHHLNLLG--------
GLNE_HAEIN      P-KKPQLTKWSDNVRIFDDMAEAKIISQTDCDTLKQCYVDLRNTIHHLNLLG--------
GLNE_METCA      A-KHCEITRWTDTVRLLDSLRAINFLELGQADRLRCAYCDYRGRVHRLALQE--------
GLNE_XANAC      A-QQPQLLDACDTPALIDALARTHWLPDESAAPLHQAHATLVDAGLSCTLDR--------
GLNE_XANCP      A-QHPALLLACATPALIDALVQVQWLPAESAAPLHHAHATLVEAGLSCTLDR--------
GLNE_BORBR      A-THRVLVNNLGNIALLRLAGEAGLIPAPLALAAGDAYRTLRRAQHQLRLKG--V-----
GLNE_BORPA      A-THRVLVNNLGNIALLRLAGEAGLIPAPLALAAGDAYRTLRRAQHQLRLKG--V-----
GLNE_BORPE      A-THRVLVNNLGNIALLRLAGEAGLIPAPLALAAGDAYRTLRRAQHQLRLKG--V-----
GLNE_BURMA      A-RHPEMIRNTGNIALLREVSRFGLMSEEEAETVGAAYRTYRKLQHRLRLDG--M-----
GLNE_BURPS      A-RHPEMIRNTGNIALLREVSRFGLMSEEEAETVGAAYRTYRKLQHRLRLDG--M-----
GLNE_RALSO      A-AYAELTRNAGNIALLRMAGELGLIDAARAARVADAYRDFRARQHKLRLDG--Q-----
GLNE_NEIMA      R-QYPQLLDNYGNIALLNIAADCGLIDKTLAGQSRTAYRFYRRQQHNTKLR---D-----
GLNE_NEIMB      R-QYPQLLDNYGNIALLNISADCGLIDKTLAGQSRTAYRFYRRQQHNTKLR---D-----
GLNE_CHRVO      K-TLPALTGNTGNIALLAVAAEAGLIDRRLAEDARAAYRLYRRLQHSARLN---D-----
GLNE_NITEU      H-RYPQLTGNIGNIALLKLAGELGLTSAGKATAALTAYRELRRTQHQLRLSGTPE-----
GLNE_BIFLO      G--DIKDLRVNGTLEALDVLEAKKLISAIDAIQLRKAWTLCTAARNGSYLWSGRANQADI
GLNE_LEIXX      A--AHPALRTPSTLDALAVAAGEGFVSGEDAARLRAAWVFASRARSAMTLWTNKT--ADV
GLNE_COREF      H--EHPELHNTSTLEVLEVVEEKGIINPLQAQTLREAWLTATAARNALVLVKGKR--ADQ
GLNE_CORGL      H--EIPELHNTSTLEVLEVLEKHQIINPVQVQTLREAWLTATAARNALVLVRGKR--LDQ
GLNE_CORDI      H--EFQDLHNPSTLDSLDVIEKHAVIEPEKVEVLRQAWLTATRARNAIVLVRGKR--VDQ
GLNE_MYCBO      H--QVPALHNTSTLQSLDVIAAADLVPAADVELLRQAWLTATRARNALVLVRGKP--TDQ
GLNE_MYCTU      H--QVPALHNTSTLQSLDVIAAADLVPAADVELLRQAWLTATRARNALVLVRGKP--TDQ
GLNE_MYCPA      H--EVPALHNTSTLECLDAIAEAGLVPADEVDLLRQAWLTATRARNALVLVRGKP--TDQ
GLNE_MYCLE      H--ELPALHKTSTLESLDAIAAANLIPEADVDLLRQAWLTATRARNALVLVRGKT--TDQ
GLNE_NOCFA      H--EVESLHNTATLETLAAIEKAELLAAEDVALLRDSWLLATKARNALVLVRGKP--SDQ
GLNE_STRAW      W--VEPGLRTTRTRPALAAACAAGLLTGEDAAILDEAWVLATRVRNAVMLVRGRA--GDT
GLNE_STRCO      H--EIAGLRTTRTRTALAAARDAGLISEEHTATLDEAWVLATRVRNAVMLVRGRA--GDT
GLNE_CUTAK      G--HDPALRTTSTIDALNAALAAGYIDEGQHAKLCDSWLAASRLRNAIMVVRGRP--SDV
                            .                                    :          

GLNE_AGRFC      ----FNPKEAPAGLIDLVCRAGDCPDIPTLEGEVKRLSKAVRKAFVAVVKNGG-------
GLNE_RHIME      ----FDPKEAPAGLVDLVCRAGDYPDLTHLEADIRRLSKAVRRIFQGVVAAA--------
GLNE_BARHE      ----LDLNNMPPGLSDLLLSSVGEPDLLRVEKLIEETGQLVYSIFKQVMKY---------
GLNE_BARQU      ----FDPHDMPPGLSDLLLSSVGEPDLLRVEKLIEETAQSVCSIFKQIMKH---------
GLNE_BRUME      ----AGLDQFPPGMRELLCRVAGLPDIERIEYELLEHYRLVRAAFDKLVGHGAD------
GLNE_BRUSU      ----AGLDQFPPGMRELLCRVAGLPDIERIEYELLEHYRLVRAAFDKLVGHGAD------
GLNE_RHILO      ----FERDDVPPGLSDLLLAVTDLPDFGVLEAHLKETSQKVRKDFDLLLRAGRP------
GLNE_BRADU      ----FKPETAGTDLQRVMARAGDAPDFSSLEARVKETQSEVRRVFRALLEGTSPASAR--
GLNE_RHOPA      ----FNPDTAGDDLLRVMVRAGDAPDFSSLQARVKETQSDVRAIFSRLIGGEDA------
GLNE_CAUVC      ----ADVEVEPKAFKALLAKAGGVTQFKSLKPKLAKAKAEARAAYEAVVKG---------
GLNE_PSEPK      ----EAGVIDAAQFADERREV-----RRIWGELGLS------------------------
GLNE_PSESM      ----QAGVVGGDQFHAQRREV-----MRIWAQMGLS------------------------
GLNE_PSEAE      ----EAGVVSGEHFQTERREV-----IRIWRELRLG------------------------
GLNE_ACIAD      ----QSMQVNAAQWRHTREVV-----CKLWQRLIDPASTMALESE---------------
GLNE_ECOLI      ----LPGHVSEDCFTAERELV-----RASWQKWLVEE-----------------------
GLNE_SHIFL      ----LPGHVSEDCFTAERDLV-----RASWQKWLVEE-----------------------
GLNE_ECOL6      ----LPGHVSEDCFTAERELV-----RASWQKWLVEE-----------------------
GLNE_ECO57      ----LPGHVPEDCFTAERELV-----RASWQKWLVEE-----------------------
GLNE_SALTI      ----LPGHVAQTCFSKERALV-----QASWRKWLVAV-----------------------
GLNE_SALTY      ----LPGHVAQTCFSKERALV-----QASWRKWLVAV-----------------------
GLNE_YERPE      ----QSSKVAADSFIAEREQV-----AASWHKWLAANDANVS------------------
GLNE_YERPS      ----QSSKVAADSFIAEREQV-----AASWHKWLAANDANVS------------------
GLNE_PECAS      ----LSGRVSKDRFVAEREQV-----LVSWNKWLMGA-----------------------
GLNE_PHOLL      ----HSSRVSIHCFSEQQERV-----RRSWQQWLGE------------------------
GLNE_VIBVU      ----LDADVALDKFVALRQGV-----SKAWQEWLESSTI---------------------
GLNE_VIBVY      ----LDADVALDKFVALRQGV-----SKAWQEWLESSTI---------------------
GLNE_VIBPA      ----LDADVVEDKFVAEREWV-----KQAWNQWFA-------------------------
GLNE_VIBCH      ----QSADVRDSQFVVEREQV-----IQAWQQWLG-------------------------
GLNE_PHOPR      ----LPVYVDESQFVTERETV-----QQIWQEYLVPSSDE--------------------
GLNE_SHEON      ----KSGKLAYADVAAHAERI-----LAIYQAILE-------------------------
GLNE_HAEDU      ----LPSIVNDTEFVSERAFV-----TKIWQQIFTDNE----------------------
GLNE_MANHA      ----KDSVVDASEFTTERAFV-----REMWQRLLA-------------------------
GLNE_MANSM      ----EPPIVSKEEFADERRFI-----HQIWQKLFFE------------------------
GLNE_PASMU      ----ELSIVPQTEFQTERQFI-----QTIWHRLFEHNDKYEE------------------
GLNE_HAEIN      ----KSSVVEDSEFVKERSFI-----QAFWDRLFVS------------------------
GLNE_METCA      ----MPALAASSEFPGHRTAV-----EAVWKQIIEAPVF---------------------
GLNE_XANAC      ----RPRLIAPTPAIQQARGI-----IFNAARGQGLTFPLGKDETAL-------------
GLNE_XANCP      ----RPRLVVSTPPIRDACQI-----VAAIADAQQLRFQPGKGA----------------
GLNE_BORBR      ----DKARVPPGQLAAERATV-----CELWQTVLQDGTIAQAEVK---------------
GLNE_BORPA      ----DKARVPPGQLAAERATV-----CELWQTVLQDGTIAQAEVK---------------
GLNE_BORPE      ----DKARVPPGQLAAERATV-----CELWQTVLQDGTIAQAEVK---------------
GLNE_BURMA      ----EKARVEPERVAAERQAV-----AALWARVFGA------------------------
GLNE_BURPS      ----EKARVEPERVAAERQAV-----AALWARVFGA------------------------
GLNE_RALSO      ----SAARVPAGTCAHEAAHV-----RALWEQVFGSIDAASPTP----------------
GLNE_NEIMA      ----AKKTEVTGELLAHYGNV-----RKLWREVFGEEAATA-------------------
GLNE_NEIMB      ----AAKTEVTGELLAHYGNV-----RKLWREVFGEEAATV-------------------
GLNE_CHRVO      ----RKTVEVDESLRTAYARG-----RELWRQVFEQALDFS-------------------
GLNE_NITEU      ----PAGTALSRDVSQKFARVANNHLSDARQAVFQLWEDIFGT-----------------
GLNE_BIFLO      LPDDIYSLGGIAVYLGYGAHRGQ-HFENDLLAVMRKCRDVCQRLFYGKTEGEAAAATTAT
GLNE_LEIXX      LPFDRVVLDGVARLLEYPPGAAS-RMEEDYLAVTRRARAVFEREFYGPPQRPATTA----
GLNE_COREF      LPPPGRHLAQVAGAAGWDPDEYQ-EYLDHYLKVTRKSRQVVEEVFWGLDSVEARREL---
GLNE_CORGL      LPTPGPHLAQVAGASGWDPNEYQ-EYLENYLKVTRKSRQVVDEVFWGVDSMEQREF----
GLNE_CORDI      LPQQGTQLAAVAGAAGWEPSDSQ-QYLDHYLKVTRRARQVVDEVFWGVDSIEHDY-----
GLNE_MYCBO      LPGPGRQLNAVAVAAGWRNDDGG-EFLDNYLRVTRRAKAVVRKVFGS-------------
GLNE_MYCTU      LPGPGRQLNAVAVAAGWRNDDGG-EFLDNYLRVTRRAKAVVRKVFGS-------------
GLNE_MYCPA      LPGPGRQLNAVAVAAGWPTDEGG-EFLDNYLRVTRRAKAVVCKVFGS-------------
GLNE_MYCLE      LPGPGRQLNAVAVAAGWPSDDGS-EFLDNYLRVTRRAKTFVRKVFGS-------------
GLNE_NOCFA      LPGPGRLLSAVATVAGWPNNDGGSEFLDHYLRITRRARAVVERVFGS-------------
GLNE_STRAW      FPSDGRELAAVGRYLGYGPGHVG-DMLDDYRRITRRARAVVDEQFYGA------------
GLNE_STRCO      FPTDPRELAAVGRYLGHGSGHAG-DMLDEYRRTARRARTVVEDLFYA-------------
GLNE_CUTAK      IPSDSTDLDVIAKASGMGQGASE-HLVEDHLRHCRRASRVVDAVFWNQ------------
                                                                            

GLNE_AGRFC      --------------------------------
GLNE_RHIME      --------------------------------
GLNE_BARHE      --------------------------------
GLNE_BARQU      --------------------------------
GLNE_BRUME      --------------------------------
GLNE_BRUSU      --------------------------------
GLNE_RHILO      --------------------------------
GLNE_BRADU      --------------------------------
GLNE_RHOPA      --------------------------------
GLNE_CAUVC      --------------------------------
GLNE_PSEPK      --------------------------------
GLNE_PSESM      --------------------------------
GLNE_PSEAE      --------------------------------
GLNE_ACIAD      --------------------------------
GLNE_ECOLI      --------------------------------
GLNE_SHIFL      --------------------------------
GLNE_ECOL6      --------------------------------
GLNE_ECO57      --------------------------------
GLNE_SALTI      --------------------------------
GLNE_SALTY      --------------------------------
GLNE_YERPE      --------------------------------
GLNE_YERPS      --------------------------------
GLNE_PECAS      --------------------------------
GLNE_PHOLL      --------------------------------
GLNE_VIBVU      --------------------------------
GLNE_VIBVY      --------------------------------
GLNE_VIBPA      --------------------------------
GLNE_VIBCH      --------------------------------
GLNE_PHOPR      --------------------------------
GLNE_SHEON      --------------------------------
GLNE_HAEDU      --------------------------------
GLNE_MANHA      --------------------------------
GLNE_MANSM      --------------------------------
GLNE_PASMU      --------------------------------
GLNE_HAEIN      --------------------------------
GLNE_METCA      --------------------------------
GLNE_XANAC      --------------------------------
GLNE_XANCP      --------------------------------
GLNE_BORBR      --------------------------------
GLNE_BORPA      --------------------------------
GLNE_BORPE      --------------------------------
GLNE_BURMA      --------------------------------
GLNE_BURPS      --------------------------------
GLNE_RALSO      --------------------------------
GLNE_NEIMA      --------------------------------
GLNE_NEIMB      --------------------------------
GLNE_CHRVO      --------------------------------
GLNE_NITEU      --------------------------------
GLNE_BIFLO      ASAATQQPQTAPRPRMHVIAPRLERNRRRAQR
GLNE_LEIXX      --------------------------------
GLNE_COREF      --------------------------------
GLNE_CORGL      --------------------------------
GLNE_CORDI      --------------------------------
GLNE_MYCBO      --------------------------------
GLNE_MYCTU      --------------------------------
GLNE_MYCPA      --------------------------------
GLNE_MYCLE      --------------------------------
GLNE_NOCFA      --------------------------------
GLNE_STRAW      --------------------------------
GLNE_STRCO      --------------------------------
GLNE_CUTAK      --------------------------------