CLUSTAL format seed alignment for MF_00807

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

1A1D_ENTCL      -MNLNRFERYPLTFGPSPITPLKRLSQHLGGKVELYAKREDCNSGLAFGGNKTRKLEYLI
1A1D_PSES0      -MNLNRFERYPLTFGPSPITPLKRLSQHLGGKVELYAKREDCNSGLAFGGNKTRKLEYLI
1A1D_PSEPU      -MNLNRFERYPLTFGPSPITPLKRLSEHLGGKVELYAKREDCNSGLAFGGNKTRKLEYLI
1A1D_PSEFL      -MNLNRFKRYPLTFGPSPITPLKRLSEHLGGKVELYAKREDCNSGLAFGGNKTRKLEYLI
1A1D_PSESM      -MNLSKFKRYPLTFGPSPITPLKRLSEHLGGKVDLYAKREDCNSGLAFGGNKTRKLEYLV
1A1D_RALSO      -MNLNKHPRHPLTFGPTPIQPLKRLSAHLGGKVELYAKREDCNSGLAFGGNKTRKLEYLV
1A1D_VARPD      -MNLKKFPRHVLTFGPTPIQPLKRLSAHLGGKVDLYAKREDCNSGLAFGGNKTRKLEYLI
1A1D_BURMA      -MNLQKFSRYPLTFGPTPIQPLKRLSAHLGGKVELYAKRDDCNSGLAFGGNKTRKLEYLI
1A1D_BURPS      -MNLQKFSRYPLTFGPTPIQPLKRLSAHLGGKVELYAKRDDCNSGLAFGGNKTRKLEYLI
1A1D_PSEUD      -MNLQRFPRYPLTFGPTPIQPLARLSKHLGGKVHLYAKREDCNSGLAFGGNKTRKLEYLI
1A1D_RHIRD      --MLEKFERYPLTFGATAIEYLPRLTEALGGDVEIWAKREDCNSGLAMGGNKLRKLEYIV
1A1D_RHILV      MSLLEKFERYPLTFGPTPIEHLPRLTAALGGKVDIYAKRDDCNSGLAMGGNKLRKLEYIV
1A1D_BRADU      --MLEKFARYPLTFGPTPIEKLERLSKHLGGNVEIYAKREDCNSGLAYGGNKLRKLEYII
1A1D_RHILO      --MLEKFERYPLTFGLTPIEKLDRLGKHLGGKVEIYAKREDCNSGLAFGGNKLRKLEYVI
                   *.:. *: **** :.*  * **   ***.*.::***:******* **** *****::

1A1D_ENTCL      PEAIEQGCDTLVSIGGIQSNQTRQVAAVAAHLGMKCVLVQENWVNYSDAVYDRVGNIEMS
1A1D_PSES0      PEAIEQGCDTLVSIGGIQSNQTRQVAAVAAHLGMKCVLVQENWVNYSDAVYDRVGNIEMS
1A1D_PSEPU      PEAIEQGCDTLVSIGGIQSNQTRQVAAVAAHLGMKCVLVQENWVNYSDAVYDRVGNIEMS
1A1D_PSEFL      PEALEQGCDTLVSIGGIQSNQTRQVAAVAAHLGMKCVLVQENWVNYSDAVYDRVGNIEMS
1A1D_PSESM      PEAIEGGYDTLVSIGGIQSNQTRQVAAVAAHLGMKCVLVQENWVNYSDALYDRVGNIEMS
1A1D_RALSO      PEVLAGGYDTLVSIGGIQSNQTRQVAAVAAHLGLKCVLVQENWVNYADAVYDRVGNIELS
1A1D_VARPD      PEALEGGYDTLVSIGGIQSNQTRQVAAVAAHLGLKCVLVQENWVNYSDAVYDRVGNIEMS
1A1D_BURMA      PDALAQGCDTLVSIGGIQSNQTRQVAAVAAHLGMKCVLVQENWVNYHDAVYDRVGNIQMS
1A1D_BURPS      PDALAQGCDTLVSIGGIQSNQTRQVAAVAAHLGMKCVLVQENWVNYHDAVYDRVGNIQMS
1A1D_PSEUD      PEALAQGCDTLVSIGGIQSNQTRQVAAVAAHLGMKCVLVQENWVNYSDAVYDRVGNIQMS
1A1D_RHIRD      PDAIASNADTLVSIGGVQSNHTRMVAAVAAKLGMKCRLVQESWVPHEDAVYDRVGNILMT
1A1D_RHILV      PDAIASGADTLVSIGGVQSNHTRMVAATAAKIGMKCVVIQEKWVPHYDAVYDRVGNILMT
1A1D_BRADU      PDAIASNADTLVSIGGVQSNHTRMIAAVAAKIGMKCRLVQEAWVPHEDAVYDRVGNIMLS
1A1D_RHILO      PDAIASDADTLVTVGGVQSNHTRMVAAVAAKIGMKCLLVHESWVPHEDVVYDRVGNILLS
                *:.:  . ****::**:***:** :**.**::*:** :::* ** : *.:******* ::

1A1D_ENTCL      RIMGADVRLDAAGFDIGIRPSWEKAMSDVVEQGGKPFPIPAGCSEHPYGGLGFVGFAKKL
1A1D_PSES0      RIMGADVRLDAAGFDIGIRPSWEKAMSDVVEQGGKPFPIPAGCSEHPYGGLGFVGFAEEV
1A1D_PSEPU      RIMGADVRLDAAGFDIGIRPSWEKAMSDVVERGGKPFPIPAGCSEHPYGGLGFVGFAEEV
1A1D_PSEFL      RIMGADVRLDAAGFDIGIRPSWEKAMNDVVERGGKPFPIPAGCSEHPYGGLGFVGFAEEV
1A1D_PSESM      RIMGADVRLDSAGFDIGIRPSWEKAMADVVESGGKPFPIPAGCSEHPYGGLGFVRFADEV
1A1D_RALSO      RILGADVRLDAAGFDIGIRPSWEQAMEDVRRAGGKPFPIPAGCSEHPLGGLGFVGFAEEV
1A1D_VARPD      RIMGADVRLDAAGFDIGIRQSWEQAMADVRAAGGKPFPIPAGCSEHPRGGLGSVGFAEEV
1A1D_BURMA      RMMGADVRLVPDGFDIGFRKSWEDALADVRARGGKPYAIPAGCSDHPLGGLGFVGFAEEV
1A1D_BURPS      RMMGADVRLVPDGFDIGFRKSWEDALADVRARGGKPYAIPAGCSDHPLGGLGFVGFAEEV
1A1D_PSEUD      RILGADVRLVPDGFDIGFRRSWEDALESVRAAGGKPYAIPAGCSDHPLGGLGFVGFAEEV
1A1D_RHIRD      RLMGADSRIVDDGFDIGIRQSWEDAIQSVIDEGGKPYAIPAGASVHKYGGLGYVAFAEEV
1A1D_RHILV      KLMGADSRLVEDGFDIGIRKSWEDAIQSVEDAGGKPYAIPAGASVHKFGGLGYVGFAEEV
1A1D_BRADU      RIMGADVRLVDDGFDIGIRKSWEQAIEEVKAAGGKPYAIPAGASVHKYGGLGYVGFAEEV
1A1D_RHILO      RILGAEVRLVDDGFDIGIRRSWEKALYEVKARGGRPYAIPAGASVHPNGGLGYVGFAEEV
                :::**: *:   *****:* ***.*: .*   **:*:.****.* *  **** * **.::

1A1D_ENTCL      RQQEKELGFKFNYIVVCSVTGSTQAGMVVGFAADGRSKNVIGVDASAKPEQTKAQILRIA
1A1D_PSES0      RQQEKELGFKFDYIVVCSVTGSTQAGMVVGFAADGRSKNVIGIDASAKPEQTKAQILRIA
1A1D_PSEPU      RQQEKELGFKFDYIVVCSVTGSTQAGMVVGFAADGRSKNVIGVDASAKPEQTKAQILRIA
1A1D_PSEFL      REQEKQLGFKFDYIVVCSVTGSTQAGMVVGFAADGRSKNVIGIDASAKPEKTKAQILRIA
1A1D_PSESM      RQQEEELGFKFDYIVVCSVTGSTHAGMLVGFAADGRAQRVIGIDASAKPDKTREQVLRIA
1A1D_RALSO      RQQEAEFGFRFDYIVVCSVTGSTQAGMVVGFAADGRADRVIGIDASAKPEQTREQILRIA
1A1D_VARPD      RQQEAELGFKFDYLVVCSVTGSTQAGMVVGFAADGRADRVIGIDASAKPQQTFEQILRIA
1A1D_BURMA      RAQEAELGFQFDYVVVCSVTGSTQAGMVVGFAADGRADRVIGVDASAKPAQTREQILRIA
1A1D_BURPS      RAQEAELGFQFDYVVVCSVTGSTQAGMVVGFAADGRADRVIGVDASAKPAQTREQILRIA
1A1D_PSEUD      RAQEAELGFKFDYVVVCSVTGSTQAGMVVGFAADGRADRVIGVDASAKPAQTREQITRIA
1A1D_RHIRD      ARQEADLGFKFDYIIVCVVTGSTQAGMIVGFAAQDRADRVIGIDASGTPEQTRSQVRQIV
1A1D_RHILV      AAQEKDLGFIFDYIIVCVVTGSTQGGMIVGFAALDRADRVIGIDASGTLQQTRDQVRKIV
1A1D_BRADU      RKQEAELGFKFDYIVVCTVTGSTHAGMLVGFAADGRARKVIGIDGSFTPAQTKAQVLSIA
1A1D_RHILO      RAQEEQLGFAFDYMVVCTVTGSTHAGMLVGFAKDGRQRNVIGIDASATPAKTKAQVLSIA
                  ** ::** *:*::** *****:.**:****  .*  .***:*.* .  :*  *:  *.

1A1D_ENTCL      RHTAELVELGREITEEDVVLDTRFAYPEYGLPNEGTLEAIRLCGSLEGVLTDPVYEGKSM
1A1D_PSES0      RHTAELVELGREITEEDVVLDTRFAYPEYGLPNEGTLEAIRLCGSLEGVLTDPVYEGKSM
1A1D_PSEPU      RHTAELVELGREITEEDVVLDTRFAYPEYGLPNEGTLEAIRLCGSLEGVLTDPVYEGKSM
1A1D_PSEFL      RHTAELVELGREITEDDVVLDTPFAYPEYGLPNEGTLEAIRLCGSLEGVLTDPVYEGKSM
1A1D_PSESM      QNTAKLVDLGREITAEDVVLDTRYAYPEYGLPNDGTLEAIRLCARLEGVLTDPVYEGKSM
1A1D_RALSO      RDTAKLVELGRDITEDDVVLDTRYGGPEYGLPNEGTLEAIRLCARQEGMLTDPVYEGKSM
1A1D_VARPD      KNTAELVELGRDITEKDVVLDRRFGGPEYGLPNEGTLEAIRLSARFEGMLTDPVYEGKSM
1A1D_BURMA      KHTADRVELGRDITSADVVLDERFGGPEYGLPNEGTLEAIRLCAKLEGVLTDPVYEGKSM
1A1D_BURPS      KHTADRVELGRDITSADVVLDERFGGPEYGLPNEGTLEAIRLCAKLEGVLTDPVYEGKSM
1A1D_PSEUD      RQTAEKVGLERDIMRADVVLDERFAGPEYGLPNEGTLEAIRLCARTEGMLTDPVYEGKSM
1A1D_RHIRD      DNTAELVELGRPVREDEIVILNDYAYPAYGVPSNETNEAIRLAARTEAMITDPVYEGKSM
1A1D_RHILV      DATSELVNLGRSVREDEIVINPDYAYPAYGVPSEETNEAIRLAARTEAMITDPVYEGKSM
1A1D_BRADU      QNTAKLVELGKDIVADDVVLIEDYAYPAYGVPSEETKEAIRLTARLEAMITDPVYEGKSM
1A1D_RHILO      RHTATLVELGSELAEDDVVLLEDYAHPRYGIPSEETKEAIRLCARLEGMITDPVYEGKSM
                  *:  * *   :   ::*:   :. * **:*.: * ***** .  *.::**********

1A1D_ENTCL      HGMIEMVRRGEFPEGSKVLYAHLGGAPALNAYSFLFRDG
1A1D_PSES0      HGMIEMVRRGEFPEGSKVLYAHLGGAPALNAYSFLFRNG
1A1D_PSEPU      HGMIEMVRRGEFPDGSKVLYAHLGGAPALNAYSFLFRNG
1A1D_PSEFL      HGMIEMVRRGEFPEGSKVLYAHLGGAPALNAYSFLFRNG
1A1D_PSESM      HGMIDMVRNGEFPEGSKVLYAHLGGVPALNAYSFLFKDG
1A1D_RALSO      HGMIDRVRGGEFPEGSRVLYAHLGGVPALNAYSFLFRNG
1A1D_VARPD      HGMIEKVRLGEFPAGSKVLYAHLGGVPALNAYSFLFRNG
1A1D_BURMA      HGMIEKVRLGEFPAGSKVLYAHLGGVPALNAYSFLFRDG
1A1D_BURPS      HGMIEKVRLGEFPAGSKVLYAHLGGVPALNAYSFLFRDG
1A1D_PSEUD      HGMIEMVRNGEFPEGSRVLYAHLGGVPALNGYSFIFRDG
1A1D_RHIRD      QGMIDLTRKGFFPKGSKVLYAHLGGAPALNGYSYTYRNG
1A1D_RHILV      QGMIDLARKGFFPEGSKVLYAHLGGAPALNGYSYYYKDG
1A1D_BRADU      QGLIDLTQKGYFEKGAKVLYAHLGGAPALNGYGYAFRNG
1A1D_RHILO      QGMIDLVQKGFFPAGSRILYAHLGGAPAINGYGYTFRNG
                :*:*: .: * *  *:::*******.**:*.*.: :::*