CLUSTAL format seed alignment for MF_00808

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PSBT_ARIMA      MEALVYTFLLISTLGIIFFAIFFRDPPRISTKKMK---
PSBT_NEPOL      MEALVYTFLLISTLGIIFFGIFFREPPRIVK-------
PSBT_WELMI      MEALVYTFLLISTLGIIFFAIFFREPPKVPTKGGK---
PSBT_COLOB      MEALVYTFLLIGTLGIIFFAIFFREPPRLPVKGKK---
PSBT_EUGGR      MEALVYTFLLIGTLGVIFFAIFFRESPRINK-------
PSBT_CYAPA      MEALVYTFLLVTTLGILFFSIIFRDPPRINQ-------
PSBT_GNEGN      MEALVYTFLLVSTLGILFFAIFFREPPRVTPKGGK---
PSBT_PSINU      MEALVYTFLLVATLGIIFFAIFFRDPPKVPNK------
PSBT_ZAMFU      MEALVYTFLLVSTLGIIFFAIFFREPPKVPDRGSK---
PSBT_WHEAT      MEALVYTFLLVSTLGIIFFAIFFREPPKVPPTPTKRIK
PSBT_GUITH      METLVYTFLLIGTLAVLFAAVFFRDPPRIAKK------
PSBT_TRICV      MEALVYTFLLIGTLMVIFFAVFFRETPRILRK------
PSBT_PORPU      MEALVYVFLLTGTLMVIFFAIFFREPPRIAK-------
PSBT_KLEBI      MEALVYTFLLVGTLGIIFFAIFFREPPKITSNKK----
PSBT_MESVI      MEALVYTFLLVGTLGIIFFAIFFREPPRIIK-------
PSBT_SPIMX      MEALVYTFLLVGTLGIIFFAIFFREPPKLPEASKSKK-
PSBT_NOSS1      MESVAYILILTLAIGVLFFAIAFREPPRIEKKEEK---
PSBT_SYNY3      MESVAYILVLTMALAVLFFAIAFREPPRIEK-------
PSBT_MASLA      MESVAYILIFTLTIGTLFFAVAFREPPRIERKEK----
PSBT_PROMA      MEAFTYTLLMTLGVVTLFFAVAFRDPPKFDK-------
PSBT_PROMM      MDAFAYTLLMTLVVATLFFAVAFRDPPKIGKDSGK---
PSBT_PROMP      MEAFAYVLILTLAVVTLFFAVAFRDPPKFDRK------
PSBT_SYNPX      MESFAYVLILTLAIATLFFAIAFRDPPKIGK-------
PSBT_THEEB      METITYVFIFACIIALFFFAIFFREPPRITKK------
PSBT_SYNP6      MESLVYIFVFVVALGVLFFAIAFREPPRIGK-------
                *::..* :::   :  :* .: **:.*:.