CLUSTAL format seed alignment for MF_00811

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DAPD_COXBU      -----MTDLK---TIIEEAYQNKD-NFTTDTVPKKIHQAIHQTIELLDNGELRIAEKQNG
DAPD_COXBR      -----MTDLK---TIIEEAYQNKD-NFTTDTVPKKIHQAIHQTIELLDNGELRIAEKQNG
DAPD_COXBN      -----MTDLK---TIIEEAYQNKD-SFTTDTVPKKIHQAIHQTIELLDNGELRIAEKQNG
DAPD_BLOFL      MNENNIQKLQ---KIIEHYFIKQQ-NISKNNIDLNLRNTVQEVIDNLNNGILRVSEK-IN
DAPD_BLOPB      -----MNQLR---KIIESAFEKKE-YISNNNIDSTVNNAVREIMDRLDNGTLRISEK-IN
DAPD_BUCAI      -----MKELK---KIIEETYENKN-KINLNNLDYEILQTIFRVIKLLNNGIIRISEK-KD
DAPD_BUCAP      -----MKKYY---DIIENAYLKKN-EVNTKNIDIETKQTIHHVIELLNSGKIRVAEK-KD
DAPD_BUCBP      -----MHTLK---NIINKTFDNKL-NIHQHNVDQKTTDAINQVLHMLNIGKLRVSEK-IN
DAPD_ACIAC      ----MTQQLQ---NIIDTAWENRA-SLSPSAAPREVQDAVEHVIAELDAGKLRVATREGV
DAPD_ACISJ      ----MTQQLQ---TLIDNAWDNRA-SLSPSAAPKEVVDAVEHVIAELNNGRLRVATREGV
DAPD_RHOFT      ----MTQQLQ---SIIDAAWEDRA-NLSSAAAPKEVLDAVEHVISDLNAGRLRVATRESV
DAPD_BORBR      ----MTLDLQ---TTIEQAWENRA-NLSPVDASAEVRDAVEHTIDGLDLGRLRVAEKID-
DAPD_BORPE      ----MTLDLQ---TTIEQAWENRA-NLSPVDASAEVRDAVEHTIDGLDLGRLRVAEKID-
DAPD_BORPA      ----MTLDLQ---TTIEQAWENRA-NLSPVDASAEVRDAVEHTIDGLDLGRLRVAEKID-
DAPD_BORA1      ----MTLDLQ---TTIEKAWESRA-NLSPADASAEVREAVEHTIDALDQGRLRVADKSS-
DAPD_AZOSB      -----MQDLQ---KIIDDAFENRA-SLSPAAAPAAVRDAVAEVIAGLDAGTLRVAEK-KD
DAPD_AROAE      -----MQDLQ---KIIDDAFENRA-NLSPSAAPAAVRDAVASVIAGLDAGRLRVAEK-ID
DAPD_BURCA      ----MSQQLQ---QIIDTAWENRA-ELSPKAAPADVREAVAHAIEQLDKGALRVAEK-ID
DAPD_BURCH      ----MSQQLQ---QIIDTAWENRA-ELSPKAAPADVREAVAHAIEQLDKGALRVAEK-ID
DAPD_BURL3      ----MSQQLQ---QIIDTAWENRA-ELSPKAAPADVREAVAHAIEQLDKGALRVAEK-ID
DAPD_BURVG      ----MSQQLQ---QIIDTAWENRA-ELSPKAAPADVREAVAHAIEQLDKGALRVAEK-ID
DAPD_BURCM      ----MSQQLQ---QIIDTAWENRA-ELSPKAAPADVREAVAHALEQLDKGALRVAEK-ID
DAPD_PARXL      ----MSQQLQ---QIIDTAWENRA-ELSPKAAPADVREAVAHAIEQLDKGLLRVAEK-KD
DAPD_BURMA      ----MSQQLQ---QIIDNAWENRA-ELSPKAASAEIREAVAHAIEQLDRGALRVAEK-ID
DAPD_BURP6      ----MSQQLQ---QIIDNAWENRA-ELSPKAASAEIREAVAHAIEQLDRGALRVAEK-ID
DAPD_BURM9      ----MSQQLQ---QIIDNAWENRA-ELSPKAASAEIREAVAHAIEQLDRGALRVAEK-ID
DAPD_BURM7      ----MSQQLQ---QIIDNAWENRA-ELSPKAASAEIREAVAHAIEQLDRGALRVAEK-ID
DAPD_BURMS      ----MSQQLQ---QIIDNAWENRA-ELSPKAASAEIREAVAHAIEQLDRGALRVAEK-ID
DAPD_BURPS      ----MSQQLQ---QIIDNAWENRA-ELSPKAASAEIREAVAHAIEQLDRGALRVAEK-ID
DAPD_BURP0      ----MSQQLQ---QIIDNTWENRA-ELSPKAASAEIREAVAHAIEQLDRGALRVAEK-ID
DAPD_CUPNH      ----MTQALQ---ALIDQAWEDRT-SLSPKSAPNDIREAVANVISQLDSGALRVAEK-QG
DAPD_CUPPJ      ----MTQALQ---ALIDQAWEDRT-SLSPKSAPADIREAVANVIGQLDAGTLRVAEK-QG
DAPD_CUPMC      ----MTQALQ---ALIDQAWEDRT-SLSPKSAPNDIREAVANVISQLDSGALRVAEK-QG
DAPD_RALSO      ----MSQQLQ---SLIEQAWEDRA-NLSPKAAPNDVRAAVANVIDQLDQGALRVAEK-KD
DAPD_HERAR      ----MTQQLE---QIIDQAWENRA-DFSPKNAPADLRNAVAQVIAQLNEGTLRVAQK-DS
DAPD_JANMA      ----MTQQLE---QIIDQAWENRA-DFSPKNAPADVRNAVAQVIAQLNEGTLRVAQK-DS
DAPD_POLAQ      ----MSQSPQ---SIIEQAWENRA-NLSPESAPADIRSAVNAVLEGLNAGTIRVAERRDV
DAPD_ACIBA      -----MSQLS---TIIEQAFEDRA-NFTAADCPSEIRQAVEEAIAGLDNGTLRVAEK-IN
DAPD_ACIBT      -----MSQLS---TIIEQAFEDRA-NFTAADCPSEIRQAVEEAIAGLDNGTLRVAEK-IN
DAPD_ACIAD      -----MSQLS---TIIEQAFENRA-NFTAADCPADIRQAVEEALSGLDNGTLRVAEK-ID
DAPD_PSYA2      ------MSLQ---QTIEQAFENRN-EYSPATMPQDVRDAINQVLEQLDNGTLRVAEK-KD
DAPD_PSYCK      ------MSLQ---QTIEQAFENRN-EYSPATMPQDVRDAINQVLEQLDNGTLRVAEK-KD
DAPD_PSYWF      ------MSLE---QIIEQAFEKRA-EYSPATMPQEVKDAVNSVLDQLDNGSLRVAEK-KD
DAPD_BRUAB      MTKPDLASLE---KTIEKAFDERD-GINT-ATRGEVREAVEQSLILLDRGEVRVAEKQAD
DAPD_BRUA2      MTKPDLASLE---KTIEKAFDERD-GINT-ATRGEVREAVEQSLILLDRGEVRVAEKQAD
DAPD_BRUC2      MTKPDLASLE---KTIEKAFDERD-GINT-ATRGEVREAVEQSLILLDRGEVRVAEKQAD
DAPD_BRUME      MTKPDLASLE---KTIEKAFDERD-GINT-ATRGEVREAVEQSLILLDRGEVRVAEKQAD
DAPD_BRUO2      MTKPDLASLE---KTIEKAFDERD-GINT-ATRGEVREAVEQSLILLDRGEVRVAEKQAD
DAPD_BRUSU      MTKPDLASLE---KTIEKAFDERD-GINT-ATRGEVREAVEQSLILLDRGEVRVAEKQAD
DAPD_BRUSI      MTKPDLASLE---KTIEKAFDQRD-GINT-ATRGEVREAVEQSLILLDRGEVRVAEKQAD
DAPD_OCHA4      MTKPDLASLE---KTIDKAFDERD-GINT-ATRGEVREAVEQSLVLLDRGEARVAEKQAD
DAPD_RHILO      MSKPDLASLE---KTIEKAFDERD-AIST-ATRGETRDAIQAALDLLDRGTVRVAERQAD
DAPD_RHIME      MTNHDLASLS---QTIETAFEGRD-AVNT-GTRGAVRDAVETALNLLDSGKVRVAERSED
DAPD_SINMW      MTNHDLASLS---QTIETAFENRD-AVNT-GTRGAVRDAVEAALNLLDSGKVRVAERAAD
DAPD_CHESB      MKTSDIAALE---QTVEKAFENRD-SVNT-ETRGEIREAVEAALDLLDSGGMRVAQRGED
DAPD_RHIEC      MSATDLASLE---KTIEAAFDNRD-NVNM-STKGEVRDAVEAALNLLDEGKARVAERGAD
DAPD_RHIL3      MSATDLASLE---KIIEAAFDNRD-NVNT-STKGEVRDAVESALDLLDAGKARVAERSSD
DAPD_AGRFC      MSLTDLTSLE---TIIETAFDNRD-GVNV-STKGEVRDAVNTSLQLLDSGKVRVAEKQAD
DAPD_BRASB      ---MSLSALE---STINSAFDARD-GVST-TTKGEIRDAVESALELLDKGEARVAERGTD
DAPD_BRASO      ---MSLSALE---STINSAFDARD-GVST-STKGEVRDAVESALELLDKGEARVAERAAD
DAPD_BRADU      ---MSLSALE---STINSAFDARD-GIST-STKGEVREAVDQVLETLDKGEARVAERGAD
DAPD_RHOP5      ---MPLSALE---STINAAFDARD-TVSA-ATKGEVRDAVEQALDLLDKGEVRVAAREAS
DAPD_RHOPS      ---MSLSALE---NTINTAFDARD-TISA-ATKGEVRDAVDQALDLLDRGEARVAERDAS
DAPD_RHOPA      ---MPLTALE---STINAAFDARD-TVTA-ATQGEIRQAVEDALDLLDQGKVRVAQRDAS
DAPD_RHOPB      ---MSLSALE---TSINTAFDARD-TVST-ATKGEVRDAVEHALDMLDKGEARVAERGDD
DAPD_NITHX      ---MSLASLE---TTINGAFDARE-TVTA-ATKGEVREAVDHALDLLDKGEVRVAERAAD
DAPD_NITWN      ---MPTASLE---TTINGAFDARE-TITP-ATRGEVRDAVDQALGLLDKGEARVAERAAD
DAPD_BARHE      --MTDLTQLE---MIIEKAFDDRN-SINT-TTKGEILESVEHALNLLDKGEVRVVKRQKN
DAPD_BARQU      --MTNLTQLE---MIIEKAFDDRD-SIKT-TTKGEIRESVEHALNLLDKGEIRVAERQKN
DAPD_BART1      --MTHLTQLE---IIIEKAFDDRD-SINT-TTKGEIRESVEHTLSLLDKGEIRVAERQKN
DAPD_BARBK      --MTDLIQLK---MIIEKAFNNHD-SLNT-ATKGEIRDSVEYTLNLLDKGEIRVAERQEN
DAPD_PARL1      ---MSLSDLK---PVIERAFENRD-QINA-QTKGEVRDAVNEALNALDSGKARVAEK-FQ
DAPD_GLUOX      ---MPNAPLR---TAIEALWERRA-TLSA-RTEGEDRDVVEKVLSALDAGTLRVAEPFAD
DAPD_GRABC      ---MSIDSLR---DSIDRLWENRE-GLSS-ATTGEARDAVEEALRLLDSGQVRVAEPKAE
DAPD_MAGSA      ---MSFAALE---KTIDAAWEARD-GINL-QTKGEVRDAVEAALDALDSGSLRVAAKGDD
DAPD_RHORT      ---MTTPSLQ---TTIEAAWESRE-GVTL-ETRGAVRDAVEAVLDGLDAGIYRVAEKIGE
DAPD_MARMM      ---MTDTHLI---TTIDTAWDNRD-SVST-DTTGEVRDAVETAINLLDSGKARVASRGDD
DAPD_DINSH      ---MSNAQLE---TAIEAAWEARD-TISP-ATTGETREAIEETLNALDSGALRVAERGAD
DAPD_RUEPO      ---MSNQELE---AAIEAAWDARD-SITP-ATTGATREAIEETLAALDGGGLRVAEKQAD
DAPD_ROSDO      ---MSNAELE---TAIEAAWEARD-SISP-ATKGAERDAIEATLAALDGGGLRVAERQAD
DAPD_JANSC      ---MSNAQLE---TAIEAAWEARD-TITP-ATMGETREAIEDTLAALDGGTLRVAEKQDS
DAPD_RHOS4      ---MSYSALE---AAIEAAWEARE-TITP-ATKGETREAIEATLEALDKGSLRVAEKRGA
DAPD_RHOS1      ---MSYSALE---AAIEAAWEARE-TITP-ATKGETREAIEATLEALDKGSLRVAEKRGA
DAPD_RHOS5      ---MSYSALE---AAIEAAWEARD-TITP-ATKGEARDAVEATLEALDKGSLRVAEKRGA
DAPD_PARDP      ---MSNDALE---AAIESAWEIRD-QITP-ATRGEVRDAVEATLEALDKGVLRVAEKRGS
DAPD_NOVAD      ---MTAASLE---AAIEAAWEDRA-NVTP-ASDA-VREVVEAALELLDSGKARVAEKID-
DAPD_ZYMMO      -----MSDLI---KIIDQAFEDRA-NITP-ATKGEVVEAVEEALSLLDSGKRRVAELGDN
DAPD_CAUVC      -----MADLQ---TEIEAAWEARA-DISA-ATTGPVRTAVDEALRLLDSGEARVAEK-ID
DAPD_DECAR      ----MTHPLQ---ATIEELWERRT-ELSP-QSPPTTIAAINSVIGDLDSGKLRVAEKIA-
DAPD_UNKP       -----MQQLQ---NVIESAFERRA-DITPANVDTVTREAVNQVIGLLDSGALRVAEKIDG
DAPD_SERP5      -----MQQLQ---NVIENAFERRA-EITPANADTVTREAVNQVIALLDSGALRVAEKIDG
DAPD_YERPE      -----MQQLQ---NVIETAFERRA-DITPANVDTVTREAITHVIDLLDTGALRVAEKIDG
DAPD_YERPA      -----MQQLQ---NVIETAFERRA-DITPANVDTVTREAITHVIDLLDTGALRVAEKIDG
DAPD_YERP3      -----MQQLQ---NVIETAFERRA-DITPANVDTVTREAITHVIDLLDTGALRVAEKIDG
DAPD_YERPN      -----MQQLQ---NVIETAFERRA-DITPANVDTVTREAITHVIDLLDTGALRVAEKIDG
DAPD_YERPP      -----MQQLQ---NVIETAFERRA-DITPANVDTVTREAITHVIDLLDTGALRVAEKIDG
DAPD_YERPS      -----MQQLQ---NVIETAFERRA-DITPANVDTVTREAITHVIDLLDTGALRVAEKIDG
DAPD_YERE8      -----MQQLQ---NVIETAFERRA-DITPANVDTVTREAINHVIDLLDTGALRVAEKIDG
DAPD_SHIFL      -----MQQLQ---NIIETAFERRA-EITPANADTVTREAVNQVIALLDSGALRVAEKIDG
DAPD_SHIF8      -----MQQLQ---NIIETAFERRA-EITPANADTVTREAVNQVIALLDSGALRVAEKIDG
DAPD_ECO24      -----MQQLQ---NIIETAFERRA-EITPANADTVTREAVNQVIALLDSGALRVAEKIDG
DAPD_ECOHS      -----MQQLQ---NIIETAFERRA-EITPANADTVTREAVNQVIALLDSGALRVAEKIDG
DAPD_ECOLI      -----MQQLQ---NIIETAFERRA-EITPANADTVTREAVNQVIALLDSGALRVAEKIDG
DAPD_ECOLC      -----MQQLQ---NIIETAFERRA-EITPANADTVTREAVNQVIALLDSGALRVAEKIDG
DAPD_SHISS      -----MQQLQ---NIIETAFERRA-EITPANADTVTREAVNQVIALLDSGALRVAEKIDG
DAPD_ECO57      -----MQQLQ---NIIETAFERRA-EITPANADTVTREAVNQVIALLDSGALRVAEKIDG
DAPD_SHIBS      -----MQQLQ---NIIETAFERRA-EITPTNADTVTREAVNQVIALLDSGALRVAEKIDG
DAPD_ECOK1      -----MQQLQ---NIIETAFERRA-EITPANADTVTREAVNQVIALLDSGALRVAEKIDG
DAPD_ECOL5      -----MQQLQ---NIIETAFERRA-EITPANADTVTREAVNQVIALLDSGALRVAEKIDG
DAPD_ECOUT      -----MQQLQ---NIIETAFERRA-EITPANADTVTREAVNQVIALLDSGALRVAEKIDG
DAPD_ECOL6      -----MQQLQ---NIIETAFERRA-EITPANADTVTREAVNQVIALLDSGALRVAEKIDG
DAPD_SHIDS      -----MQQLQ---NIIETAFERRA-EITPANADTITREAVNQVIALLDSGALRVAEKIDG
DAPD_CITK8      -----MQQLQ---NVIESAFERRA-DITPANVDTVTREAVNQVISLLDSGALRVAEKIDG
DAPD_ENT38      -----MQQLQ---NVIESAFERRA-DITPANVDTVTREAVNQVISLLDSGALRVAEKIDG
DAPD_SALAR      -----MQQLQ---NVIETAFERRA-DITPANVDTVTREAVNQVISLLDSGALRVAEKIDG
DAPD_SALTY      -----MQQLQ---NVIETAFERRA-DITPANVDTVTREAVNQVISLLDSGALRVAEKIDG
DAPD_SALPA      -----MQQLQ---NVIETAFERRA-DITPANVDTVTREAVNQVISLLDSGALRVAEKIDG
DAPD_SALPB      -----MQQLQ---NVIETAFERRA-DITPANVDTVTREAVNQVISLLDSGALRVAEKIDG
DAPD_SALCH      -----MQQLQ---NVIETAFERRA-DITPANVDTVTREAVKQVISLLDSGALRVAEKIDG
DAPD_SALTI      -----MQQLQ---NVIETAFERRA-DITPANVDTVTREAVKQVISLLDSGALRVAEKIDG
DAPD_KLEP7      -----MQQLQ---NVIESAFERRA-DITPANVDTVTREAVNQVIALLDSGALRVAEKIDG
DAPD_CROS8      -----MQQLQ---NVIESAFERRA-DITPANVDAVTREAVNQVIALLDSGELRVAEKING
DAPD_PECAS      ----MHQQLQ---NIIETAFERRA-DITPANADTVTREAVNQAINLLDSGALRVAEKIDG
DAPD_PHOLL      -----MQQLQ---SIIESAFENRA-TLTPATVNHETRDAVTQVINLLDSGKLRVAEKIDG
DAPD_SODGM      -----MQSLQ---QNIETAFEQRA-AITPANVDATTRDAVNQVIAALDSGTLRVAEKING
DAPD_SHEAM      -----MEALR---QRIEAAFEARA-NITPSSVEPGVRADVETVINMLDKGEMRVAEKIDG
DAPD_SHESH      -----MEALR---QRIEAAFEARA-EITPNSVEPSVRADVEKAISMLDKGEARVAEKIDG
DAPD_SHELP      -----MEALR---QRIETAFEARA-EITPTTVEPSVRADVEKAIAMLDTGEARVAEKIDG
DAPD_SHEHH      -----MEALR---QRIEAAFEARA-EITPTTVEPSVRADVEKVIAMLDTGEARVAEKIDG
DAPD_SHEPA      -----MEALR---QRIEAAFEARA-EITPATVEPSVRADVEKAIAMLDTGEARVAEKING
DAPD_SHEB5      -----MEALR---QRIEAAFEARA-DITPSTVDASVRDDVQNVINMLDKGEVRVAEKIDG
DAPD_SHEB8      -----MEALR---QRIEAAFEARA-DITPSTVDASVRDDVQNVINMLDKGEVRVAEKIDG
DAPD_SHEB9      -----MEALR---QRIEAAFEARA-DITPSTVDASVRDDVQNVINMLDKGEVRVAEKIDG
DAPD_SHEPC      -----MEALR---QRIEAAFEARA-DITPSTVDANVRSDVQHVINMLDKGEVRVAEKIDG
DAPD_SHESW      -----MEALR---QRIEAAFEARA-DITPSTVDANVRSDVQHVINMLDKGEVRVAEKIDG
DAPD_SHESA      -----MEALR---QRIEAAFEARA-DITPSTVDASVRNDVQNVINMLDKGELRVAEKIDG
DAPD_SHESM      -----MEALR---QRIEAAFEARA-DITPSTVDASVRNDVQNVINMLDKGELRVAEKIDG
DAPD_SHESR      -----MEALR---QRIEAAFEARA-DITPSTVDASVRNDVQNVINMLDKGELRVAEKIDG
DAPD_SHEON      -----MEALR---QRIEAAFEART-DITPSTVDERVRSDVQHVINMLDKGELRVAEKIDG
DAPD_SHEDO      -----MEALR---QRIETAFENRQ-HITPGTVEPSLRADVETVIAMLDKGEARVAEKING
DAPD_SHEFN      -----MEALR---QRIEAAFETRQ-DISPSSVEPSVRADVETVINMLDKGQARVAEKIDG
DAPD_ACTPL      ------MSLQ---AIIEAAFERRA-EITPKTVDAETRAAIEEVIEGLDSGKYRVAEKIDG
DAPD_ACTP2      ------MSLQ---AIIEAAFERRA-EITPKTVDAETRAAIEEVIEGLDSGKYRVAEKIDG
DAPD_HAEIN      -----MSNLQ---AIIEAAFEKRA-EITPKTVDAETRAAIEEVIEGLDSGKYRVAEKIAG
DAPD_HAEIE      -----MSNLQ---AIIEAAFEKRA-EITPKTVDAETRAAIEEVIEGLDSGKYRVAEKIAG
DAPD_HAEI8      -----MSNLQ---AIIEAAFEKRA-EITPKTVDAETHAAIEEVIEGLDSGKYRVAEKIAG
DAPD_HAEDU      ------MSLQ---AVIEAAFERRA-EITPKTVDVETRVAIETVIEKLDSGEYRVAEKIGG
DAPD_ACTSZ      -----MSNLQ---AVIEEAFERRA-DITPKTVDAATRAAIEEVIEGLDSGKFRVAEKIDG
DAPD_MANSM      -----MSNLQ---SIIEAAFERRA-EITPKTVDAQTKAAIEEVIAGLDCGKYRVAEKIDG
DAPD_PASMU      ------MSLQ---HIIEAAFEKRA-EITPKTVDAQTRAAIEEAIEGLDSGKYRVAEKIDG
DAPD_AERHH      -----MTELQ---QIIEAAFERRD-SITPGSVDAATKAAILQAIDLLDSGKARVAEKIAG
DAPD_AERS4      -----MTELQ---QIIEAAFERRD-SITPGSVDAATKSAILQTIDLLDAGKARVAEKIAG
DAPD_NITEU      -----MEQLQ---AVIENAFERRA-EITPRNVEANLKESVAQVINMLDTGKLRVAEKING
DAPD_NITEC      -----MEQLQ---AVIEDAFERRA-EITPRNVEANLKESVAQVINMLDTGKLRVAEKIND
DAPD_NITMU      -----MDQLQ---STIEEAFERRA-EMTPRNVEAKLKESITQVLEMLDSGKLRVAEKTDG
DAPD_HAES1      -----MSNLQ---NIIECAFERVA-EITPTNAEAELRAAVDEAIEGLDKGIYRVAEKNEQ
DAPD_HISS2      -----MSNLQ---NIIECAFERVA-EITPTNAEAELRAAVDEAIEGLDKGIYRVAEKNEQ
DAPD_METFK      -----MSNLQ---TIIEDAFERRA-EITPSTASAEIKDAVFSVLADLDSGKLRVAERTDG
DAPD_THIDA      -----MQELQ---PIIEEAFERRA-DITPRNATPQVKDAVMAVIDLLDMGQLRVAERTDG
DAPD_ALKEH      -----MQDLK---QTIETAFENRG-ELSPASAPAAVREAVEQALAMLDRGEARVAEKRDG
DAPD_METCA      ------MSLE---NIINEAFENRA-QISPGTVGAEVREAVAEALRLLDSGAARVAEKKDG
DAPD_NITOC      -----MNDSQ---AIIEEAFERRA-EISPRKAETLVKDAVEEALHLLDTGEARVAEKQNG
DAPD_COLP3      -----MTDLKHLASVIEQAFEERA-SISPATVSSEIKNAVLDALAALNNGSARVAEKVDG
DAPD_PSEHT      -----MSDLK---TMIENAWDNRD-SISPSTVSVEVKQAIIDALDLLDSGAARVAEKISG
DAPD_IDILO      -----MENIK---QRIIDAFEQRD-QINARTENDDLREAVRYVIDEIDRGELRVAEKVSG
DAPD_NEIM0      ------MSLQ---NIIETAFENRA-DITPTTVTPEVKEAVLETIRQLDSGKLRVAERLGV
DAPD_NEIMF      ------MSLQ---NIIETAFENRA-DITPTTVTPEVKEAVLETIRQLDSGKLRVAERLGV
DAPD_NEIMB      ------MSLQ---NIIETAFENRA-DITPTTVTPEVKEAVLETIRQLDSGKLRVAERLGV
DAPD_NEIMA      ------MSLQ---NIIETAFENRA-DITPTTVTPEVKEAVLETIRQLDSGKLRVAERLGV
DAPD_NEIG1      ------MSLQ---NIIETAFENRA-DITPTTVAPEVKEAVLETIRQLDSGKLRVAERLGV
DAPD_CHRVO      -----MHPIQ---SLIEQAFENRA-EITPATVSPELKAAIEQVITELDNGHLRVAEKNG-
DAPD_LEGPA      -----MNSLQ---DLIEQAFENRQ-NLSLDTASSDLINAINEVLSGLDNGQFRVAEKING
DAPD_LEGPH      -----MNSLQ---DLIEQAFENRQ-NLSLDTASSDLINAINEVLSGLDNGQFRVAEKING
DAPD_LEGPC      -----MNSLQ---ALIEQAFENRQ-NLSLDTASSDLINAINEVLSGLDNGQFRVAEKING
DAPD_LEGPL      -----MNSLQ---ALIEQAFENRQ-NLSLNTASSDLINAINEVLSGLDNGQFRVAEKING
DAPD_XYLFA      ----MDKALV---SPIEDAFARYS-TLTVEEIEDSIRPTVNRVIDGLETGAFRVAEPDNH
DAPD_XYLFT      ----MDKTLV---SAIEDAFARYS-TLTVEEIEDSIRPTVNRVIDGLETGAFRVAEPDNH
DAPD_WOLPM      ---MQLKKTQ---SEIKDIWKNRE-KFNDCNLKKTARIAIKEVIELLDSGKIRVAEKLSS
DAPD_WOLTR      ---MQLEKIQ---SDVEDIWKNRS-KLSNRSVKRAARVIIKKVIKLLDSGKIRVAERLSD
DAPD_WIGBR      ----MINKFK---KTIETSFEKKE-HLKKC-VDPLLKNTIISIINLLDKGKIRVAEKK-N
DAPD_EHRRG      --MVNTSDFK---EIIENAWCD----IANISTNTSITGVIDEIMDLLDQGKVRVSEKI-N
DAPD_RICCN      -----MSSLI---KEIEEAWQIKDKLLQDSSKLITLKQTLNDIIESLNQGTIRVCEKQ-E
DAPD_RICFE      -----MSSLI---KEIEEAWQIKDKLFQDSSKLITLKKTLNDIIESLNQGTIRVCEKK-E
DAPD_RICRS      -----MSSLI---KEVEEAWQIKDKLLQDSSKLITLKQTLNDSIESLNQGTVRVCEKK-E
DAPD_RICAH      -----MSSLI---KEIEEAWQIKGQLLQDSSKLIMLKKTLNDVIASLNQGAIRVCEKK-E
DAPD_RICPR      -----MSYII---KEIEEAWQIKENILHDSSKLIKLKKILNESIASLNQGIIRVCEKQ-G
DAPD_RICTY      -----MSDII---KEIEEAWQIKENILNDSLKLIKLKSILNESIKSLNQGIIRVCEKQ-G
DAPD_RICBR      -----MFTYI---KEIEEAWQIKDKLLQDSVKLSAFKKTLQDVIENLNKGTIRVCEKQ-N
DAPD_PELUB      -----MKEFE---SIINTAWENKDSINGQSDK--SILDAINQTIELVDKGELRVAEKN-G
                               :   :                   :   :  :: *  *:      

DAPD_COXBU      Q-WNTNEWAKMAILLYFKTEPLKT-------FDAGYTF-----FYDK---IPLKYTNNTS
DAPD_COXBR      Q-WNTNEWAKMAILLYFKTEPLKT-------FDAGYTF-----FYDK---IPLKYTNNTS
DAPD_COXBN      Q-WNTNEWAKMAILLYFKTEPLKT-------FDAGYTF-----FYDK---IPLKYTNNTS
DAPD_BLOFL      NKWITHQWIKKAIILFFTITNNKL-------MTWGNAR-----FFDK---CPTKFENKSE
DAPD_BLOPB      GTWITHQWLKKAIMLAFHTMDNQL-------ITWGGGV-----FFDK---FPMKFSGWDH
DAPD_BUCAI      NTWITHEWLKKAVLLYIYIKENKF-------IEGSYTS-----YYDK---VPLKYEKYNE
DAPD_BUCAP      NIWITNQWIKKSILLYMYLNQNNV-------FQGSFSN-----YYDK---IPLKYENYNE
DAPD_BUCBP      GFWITHQWLKKAILLSFLVNKNVL-------FSNKQTC-----FYDK---IKLKYCNYTE
DAPD_ACIAC      GQWTVHQWIKKAVLLSFRLKDNEL-------IEAG-S----LGFYDK---VPTKFAGRSA
DAPD_ACISJ      GQWTVHQWIKKAVLLSFRLKDNEL-------MKAG-D----LGFFDK---VPTKFAHLSA
DAPD_RHOFT      GQWTTHQWIKKAVLLSFRLTDNQV-------MKAG-D----LGFYDK---VPTKFAHLDE
DAPD_BORBR      DQWIVHQWIKKAVLLSFRLHDNAV-------MGQG-P----LQFYDK---VPTKFAGYGE
DAPD_BORPE      DQWIVHQWIKKAVLLSFRLHDNAV-------MGQG-P----LQFYDK---VPTKFAGYGE
DAPD_BORPA      DQWIVHQWIKKAVLLSFRLHDNAV-------MGQG-P----LQFYDK---VPTKFAGYGE
DAPD_BORA1      GEWIVHQWIKKAVLLSFRLQDNEV-------MGEA-P----LTFYDK---VQTKFADFGA
DAPD_AZOSB      GQWVVNQWIKKAVLISFRLRDNEV-------I-PAGG----LNFFDK---VPTKFGDYTP
DAPD_AROAE      GNWTVNQWIKKAVLISFRLADNEV-------M-AGGT----NQYFDK---VPTKFGDYTP
DAPD_BURCA      GNWTVHQWLKKAVLLSFRLEDNAP-------MPAGGY----SQFYDK---VPSKFANYTA
DAPD_BURCH      GNWTVHQWLKKAVLLSFRLEDNAP-------MPAGGY----SQFYDK---VPSKFANYTA
DAPD_BURL3      GNWTVHQWLKKAVLLSFRLEDNAP-------MPAGGY----SQFYDK---VPSKFANYTA
DAPD_BURVG      GNWTVHQWLKKAVLLSFRLEDNAP-------MPAGGY----SQFYDK---VPSKFANYTA
DAPD_BURCM      GNWTVHQWLKKAVLLSFRLEDNAP-------MPAGGY----SQFYDK---VPSKFANYTA
DAPD_PARXL      GDWVVNQWLKKAVLLSFRLEDNAP-------MPAGGY----SQFYDK---VPSKFASYTA
DAPD_BURMA      GAWTVHQWLKKAVLLSFRLEDNAP-------MPAGGY----SQFYDK---VPSKFANYTA
DAPD_BURP6      GAWTVHQWLKKAVLLSFRLEDNAP-------MPAGGY----SQFYDK---VPSKFANYTA
DAPD_BURM9      GAWTVHQWLKKAVLLSFRLEDNAP-------MPAGGY----SQFYDK---VPSKFANYTA
DAPD_BURM7      GAWTVHQWLKKAVLLSFRLEDNAP-------MPAGGY----SQFYDK---VPSKFANYTA
DAPD_BURMS      GAWTVHQWLKKAVLLSFRLEDNAP-------MPAGGY----SQFYDK---VPSKFANYTA
DAPD_BURPS      GAWTVHQWLKKAVLLSFRLEDNAP-------MPAGGY----SQFYDK---VPSKFANYTA
DAPD_BURP0      GAWTVHQWLKKAVLLSFRLEDNAP-------MPAGGY----SQFYDK---VPSKFANYTA
DAPD_CUPNH      KDWIVNQWIKKAVLLSFRLEDNAP-------MSAGGF----AQFYDK---VPTKFANWSA
DAPD_CUPPJ      KDWIVNQWVKKAVLLSFRLEDNAP-------MSAGGF----AQFYDK---VPTKFANWSG
DAPD_CUPMC      KDWVVNQWIKKAVLLSFRLEDNAP-------MSAGGF----AQFYDK---VPTKFANWTG
DAPD_RALSO      GQWIVNQWVKKAVLLSFRLEDNAP-------MTAGGF----THFYDK---VPSKFASYTA
DAPD_HERAR      GAWVVNQWVKKAVLLSFRLEDNIA-------MPSGEY----MQFYDK---VPTKFANYTA
DAPD_JANMA      GAWVVNQWVKKAVLLSFRLEDNIT-------MPSGDH----MQFYDK---VPTKFANYTA
DAPD_POLAQ      GKWEVNQWVKKAVLLSFRLEDNKP-------MGAGGY----TQFYDK---VPSKFENYTA
DAPD_ACIBA      GEWVVHQWLKKAVLLSFKLNDNKP-------IESCD-----LRFYDK---VETKFSGWTE
DAPD_ACIBT      GEWVVHQWLKKAVLLSFKLNDNKP-------IESCD-----LRFYDK---VETKFSGWTE
DAPD_ACIAD      GEWIVHQWLKKAVLLSFKLNDNKP-------IESGD-----LAFYDK---VDTKFAGWTE
DAPD_PSYA2      GEWVVNQWAKKAVLLSFRLNDNYV-------QAAGEH----IQFYDK---VPTKFADWTE
DAPD_PSYCK      GEWVVNQWAKKAVLLSFRLNDNYV-------QAAGEH----VQFYDK---VPTKFANWTE
DAPD_PSYWF      GEWIVNQWAKKAVLLSFRLNDNYP-------MQTGEH----VQFYDK---VPTKFANWTE
DAPD_BRUAB      GNWHVNQWLKKAVLLSFRLNPMEV-------IKGGPGQ---SSWWDK---VPSKFDGWTA
DAPD_BRUA2      GNWHVNQWLKKAVLLSFRLNPMEV-------IKGGPGQ---SSWWDK---VPSKFDGWTA
DAPD_BRUC2      GNWHVNQWLKKAVLLSFRLNPMEV-------IKGGPGQ---SSWWDK---VPSKFDGWTA
DAPD_BRUME      GNWHVNQWLKKAVLLSFRLNPMEV-------IKGGPGQ---SSWWDK---VPSKFDGWTA
DAPD_BRUO2      GNWHVNQWLKKAVLLSFRLNPMEV-------IKGGPGQ---SSWWDK---VPSKFDGWTA
DAPD_BRUSU      GNWHVNQWLKKAVLLSFRLNPMEV-------IKGGPGQ---SSWWDK---VPSKFDGWTA
DAPD_BRUSI      GNWHVNQWLKKAVLLSFRLNPMEV-------IKGGPGQ---SSWWDK---VPSKFDGWTA
DAPD_OCHA4      GNWQVNQWLKKAVLLSFRLNPMEV-------IKGGPGQ---SSWWDK---VPSKFDGWTA
DAPD_RHILO      GKWHVNQWLKKAVLLSFRLNPMEI-------IKGGPGQ---AVWWDK---VPSKFDGWSA
DAPD_RHIME      GTWTVNQWLKKAVLLSFRLNPMEL-------VRGGPGE---AVWWDK---VASKFDGWSV
DAPD_SINMW      GTWTVNQWLKKAVLLSFRLNPMEL-------VRGGPGE---AVWWDK---VASKFDGWSV
DAPD_CHESB      GQWTVNQWLKKAVLLSFRLNPMQI-------IKGGPGD---AVWWDK---VSSKFDGWSS
DAPD_RHIEC      GVWTVNQWLKKAVLLSFRLNDMQV-------VKGGSGN---STWWDK---VPSKFENWGE
DAPD_RHIL3      GAWTVNQWLKKAVLLSFRLNDMDV-------VKGGSGN---STWWDK---VPSKFENWGE
DAPD_AGRFC      GNWKVNQWLKKAVLLSFRLNDMEI-------VTGGPGE---STWWDK---VPSKFENWGE
DAPD_BRASB      GTWSVNQWLKKAVLLSFRLNDMSV-------IPGGPGQ---ASWWDK---VPSKFEGWGE
DAPD_BRASO      GKWSVNQWLKKAVLLSFRLNDMSV-------IPGGPGQ---ASWWDK---VPSKFEGWGE
DAPD_BRADU      GKWKVNQWLKKAVLLSFRLNDMGV-------IPGGPGQ---ATWWDK---VPSKFEGWGE
DAPD_RHOP5      GAWVVNQWLKKAVLLSFRLNDMTT-------ISGGPGG---ASWWDK---VPSKFYGWGE
DAPD_RHOPS      GTWTVNQWLKKAVLLSFRLNDMHT-------IAGGPGG---ATWWDK---VPSKFEGWGE
DAPD_RHOPA      GAWTVNQWLKKAVLLSFRLNDMGV-------IAGGPGG---ANWWDK---VPSKFEGWGE
DAPD_RHOPB      GKWTVNQWLKKAVLLSFRLNDMST-------ISGGPGG---ATWWDK---VPSKFSGWGE
DAPD_NITHX      GKWTVNQWLKKAVLLSFRLNDMSV-------IPGGPGK---AVWWDK---VPSKFEGWDE
DAPD_NITWN      GKWQVNQWLKKAVLLSFRLNDMSV-------IPGGPGN---AAWWDK---VPSKFEGWDE
DAPD_BARHE      GKWHVHQWLKKAVLLSFRLNPMQI-------MTGGVNG---TSWWDK---VPSKFSHWQE
DAPD_BARQU      GQWHVHQWLKKAVLLFFRLNPMQI-------IAGGVNG---TYWWDK---VPSKFSNWQE
DAPD_BART1      GQWYVHQWLKKAVLLSFRLNPMQI-------ITGGING---THWWDK---VPSKFSGWKE
DAPD_BARBK      GQWHVHEWLKKAVLMSFRLNPMHI-------ISGGANE---SFWWDK---IPSKFSGWQE
DAPD_PARL1      GSWEVHQWLKMAVLLSFRLNDMST-------IAGGPGEN--TNWWDK---VPSKFEGWGE
DAPD_GLUOX      G-WTVHEWLKKAVLLSFRLNDSRV-------MERGCGG---EPAFDK---VPLKFDGWDQ
DAPD_GRABC      GGWSVNQWLKKAVLLSFRLTDS-T-------PAPGFGP---VASYDK---VPLKFEGWDQ
DAPD_MAGSA      GKWVVNQWLKKAVLLSFRLSD-NK-------VMGDGPG---TTWFDK---VPTKFEGWDD
DAPD_RHORT      -TWVVHQWLKMAVLLSFRLNDMTP-------VSGAPGG---ATWWDK---VPSKFAGWGE
DAPD_MARMM      GHWVVHQWLKKAVLLGFRLNPMDL-------IEGGIAG---AKWWDK---VPSKFEGWGE
DAPD_DINSH      GSWHVNQWAKKAVLLGFRIKDMEA-------QSGGPQG---GGWWDK---VDSKFLGWNS
DAPD_RUEPO      GSWHVNQWAKKAVLLGFRIKDMEI-------QSGGPQG---GGWWDK---VDSKFAGWGE
DAPD_ROSDO      GNWHVNQWAKKAVLLGFRIKDMEM-------QSGGAQG---GGWWDK---VDSKFAGWGE
DAPD_JANSC      GDWHVNQWAKKAVLLGFRLKDMEM-------QGGSAQG---GSWWDK---VDSKWATWGD
DAPD_RHOS4      -DWHVNQWAKKAVLLGFRLKDMEV-------QTGGPQA---GTWWDK---VDSKFAQWGE
DAPD_RHOS1      -DWHVNQWAKKAVLLGFRLKDMEV-------QTGGPQA---GTWWDK---VDSKFAQWGE
DAPD_RHOS5      -DWHVNQWAKKAVLLGFRLKDMDV-------QTGGPQG---GTWWDK---VDSKFAQWGE
DAPD_PARDP      -DWHVNQWAKKAVLLGFRLKDMEV-------HMGGPQG---GTWWDK---VDSKFAHWGE
DAPD_NOVAD      GQWQVNQWLKKAVLLSFRLNDNAV-------IDHGAGG---APAFDK---VPSKFSGWGE
DAPD_ZYMMO      GEWVVNQWLKKAVLLSFRLTGNAP-------MNGG---------YDK---VPLKFTNWSE
DAPD_CAUVC      GEWFTHQWLKKAVLLSFRLNPNTV-------MRSGALGGGVGPWWDK---VPNKFDGWDA
DAPD_DECAR      GEWFTHQWIKKAVLLSFRVRDNRV-------QEAGDIR-----FYDK---VDTKFEGWTE
DAPD_UNKP       Q-WVTHQWLKKAVLLSFRINDNKV-------MDGAETR-----YYDK---VPMKFADYDE
DAPD_SERP5      Q-WVTHQWLKKAVLLSFRINDNKV-------MDGAETR-----YYDK---VPMKFADYDE
DAPD_YERPE      Q-WVTHQWLKKAVLLSFRINDNQV-------MEGAETR-----YYDK---VPMKFAGYDE
DAPD_YERPA      Q-WVTHQWLKKAVLLSFRINDNQV-------MEGAETR-----YYDK---VPMKFAGYDE
DAPD_YERP3      Q-WVTHQWLKKAVLLSFRINDNQV-------MEGAETR-----YYDK---VPMKFAGYDE
DAPD_YERPN      Q-WVTHQWLKKAVLLSFRINDNQV-------MEGAETR-----YYDK---VPMKFAGYDE
DAPD_YERPP      Q-WVTHQWLKKAVLLSFRINDNQV-------MEGAETR-----YYDK---VPMKFAGYDE
DAPD_YERPS      Q-WVTHQWLKKAVLLSFRINDNQV-------MEGAETR-----YYDK---VPMKFAGYDE
DAPD_YERE8      Q-WVTHQWLKKAVLLSFRINDNQV-------MEGAETR-----YYDK---VPMKFAGYDE
DAPD_SHIFL      Q-WVTHQWLKKAVLLSFRINDNQV-------IEGAESR-----YFDK---VPMKFADYDE
DAPD_SHIF8      Q-WVTHQWLKKAVLLSFRINDNQV-------IEGAESR-----YFDK---VPMKFADYDE
DAPD_ECO24      Q-WVTHQWLKKAVLLSFRINDNQV-------IEGAESR-----YFDK---VPMKFADYDE
DAPD_ECOHS      Q-WVTHQWLKKAVLLSFRINDNQV-------IEGAESR-----YFDK---VPMKFADYDE
DAPD_ECOLI      Q-WVTHQWLKKAVLLSFRINDNQV-------IEGAESR-----YFDK---VPMKFADYDE
DAPD_ECOLC      Q-WVTHQWLKKAVLLSFRINDNQV-------IEGAESR-----YFDK---VPMKFADYDE
DAPD_SHISS      Q-WVTHQWLKKAVLLSFRINDNQV-------IEGAESR-----YFDK---VPMKFADYDE
DAPD_ECO57      Q-WVTHQWLKKAVLLSFRINDNQV-------IEGAESR-----YFDK---VPMKFADYDE
DAPD_SHIBS      Q-WVTHQWLKKAVLLSFRINDNQV-------IEGAESR-----YFDK---VPMKFADYDE
DAPD_ECOK1      Q-WVTHQWLKKAVLLSFRINDNQV-------IEGAESR-----YFDK---VPMKFANYDE
DAPD_ECOL5      Q-WVTHQWLKKAVLLSFRINDNQV-------IEGAESR-----YFDK---VPMKFANYDE
DAPD_ECOUT      Q-WVTHQWLKKAVLLSFRINDNQV-------IEGAESR-----YFDK---VPMKFANYDE
DAPD_ECOL6      Q-WVTHQWLKKAVLLSFRINDNQV-------IEGAESR-----YFDK---VPMKFANYDE
DAPD_SHIDS      Q-WVTHQWLKKAVLLSFRINDNQV-------IEGAESR-----YFDK---VPMKFANYDE
DAPD_CITK8      Q-WVTHQWLKKAVLLSFRINDNQV-------IDGAESR-----YFDK---VPMKFADYDE
DAPD_ENT38      Q-WVTHQWLKKAVLLSFRINDNQV-------IDGAESR-----YFDK---VPMKFADYDE
DAPD_SALAR      Q-WVTHQWLKKAVLLSFRINDNQV-------IDGAESR-----YFDK---VPMKFADYDE
DAPD_SALTY      Q-WVTHQWLKKAVLLSFRINDNQV-------IDGAESR-----YFDK---VPMKFADYDE
DAPD_SALPA      Q-WVTHQWLKKAVLLSFRINDNQV-------IDGAESR-----YFDK---VPMKFADYDE
DAPD_SALPB      Q-WVTHQWLKKAVLLSFRINDNQV-------IDGAESR-----YFDK---VPMKFADYDE
DAPD_SALCH      Q-WVTHQWLKKAVLLSFRINDNQV-------IDGAESR-----YFDK---VPMKFADYDE
DAPD_SALTI      Q-WVTHQWLKKAVLLSFRINDNQV-------IDGAESR-----YFDK---APMKFADYDE
DAPD_KLEP7      Q-WVTHQWLKKAVLLSFRINDNQV-------IDGAESR-----YFDK---VPMKFADYDE
DAPD_CROS8      E-WVTHQWLKKAVLLSFRINDNQV-------IEGAESR-----YFDK---VPMKFANYDE
DAPD_PECAS      Q-WVTHQWLKKAVLLSFRINDNQL-------IEGGETR-----FFDK---VPMKFADYDE
DAPD_PHOLL      Q-WVTHQWLKMAVLLSFRINENQI-------IDGTESR-----YFDK---VPMKFSDYDQ
DAPD_SODGM      E-WVTHQWLKKAVLLSFRIADNQL-------IEGGETR-----FFDK---VPMKFAGWDS
DAPD_SHEAM      Q-WHVNQWLKKAVLLSFRIFDNGV-------IEGGETK-----YFDK---VPMKFADYDE
DAPD_SHESH      Q-WHVHQWLKKAVLLSFRIFDNGV-------IDGGETK-----YFDK---VPMKFADYDE
DAPD_SHELP      Q-WNVHQWLKKAVLLSFRIFDNQV-------IDGAETK-----FFDK---VPMKFADYDE
DAPD_SHEHH      Q-WHVHQWLKKAVLLSFRIFDNQV-------IDGAETK-----YFDK---VPMKFADYDE
DAPD_SHEPA      E-WHVHQWLKKAVLLSFRIFDNGV-------IEGAETK-----YFDK---VPMKFADYDE
DAPD_SHEB5      Q-WHVHQWLKKAVLLSFRIFDNVV-------IDGAETK-----YFDK---VPLKFAEYDE
DAPD_SHEB8      Q-WHVHQWLKKAVLLSFRIFDNVV-------IDGAETK-----YFDK---VPLKFAEYDE
DAPD_SHEB9      Q-WHVHQWLKKAVLLSFRIFDNVV-------IDGAETK-----YFDK---VPLKFAEYDE
DAPD_SHEPC      Q-WHVHQWLKKAVLLSFRIFDNAV-------IDGAETK-----YFDK---VPLKFAEYDE
DAPD_SHESW      Q-WHVHQWLKKAVLLSFRIFDNAV-------IDGAETK-----YFDK---VPLKFAEYDE
DAPD_SHESA      Q-WHVHQWLKKAVLLSFRIFDNAV-------IDGAETK-----YFDK---VPLKFAEYDE
DAPD_SHESM      Q-WHVHQWLKKAVLLSFRIFDNAV-------IDGAETK-----YFDK---VPLKFAEYDE
DAPD_SHESR      Q-WHVHQWLKKAVLLSFRIFDNAV-------IDGAETK-----YFDK---VPLKFAEYDE
DAPD_SHEON      L-WHVHQWLKKAVLLSFRIFDNAV-------IDGAETK-----YFDK---VPLKFAEYDE
DAPD_SHEDO      Q-WQVHQWLKKAVLLSFRIFDNGV-------IDGGDTK-----YFDK---VPQKFADYDE
DAPD_SHEFN      E-WHVHQWLKKAVLLSFRIFDNGV-------IEGGDTK-----YFDK---VPQKFADYDE
DAPD_ACTPL      E-WVTHQWLKKAVLLSFRINDNQI-------IDGAETK-----YYDK---VALKFADYTE
DAPD_ACTP2      E-WVTHQWLKKAVLLSFRINDNQI-------IDGAETK-----YYDK---VALKFADYTE
DAPD_HAEIN      E-WVTHQWLKKAVLLSFRINDNQI-------IDGAETK-----YYDK---VALKFADYTE
DAPD_HAEIE      E-WVTHQWLKKAVLLSFRINDNQI-------IDGAETK-----YYDK---VALKFADYTE
DAPD_HAEI8      E-WVTHQWLKKAVLLSFRINDNQI-------IDGAETK-----YYDK---VALKFADYTE
DAPD_HAEDU      E-WVTHQWLKKAVLLSFRINDNQI-------IDGAETK-----YYDK---VALKFADYTE
DAPD_ACTSZ      E-WVTHQWLKKAVLLSFRINENEI-------IDGAETK-----YYDK---VALKFADYSE
DAPD_MANSM      D-WVTHQWLKKAVLLSFRINDNQL-------IDGAETK-----YYDK---VALKFADYTE
DAPD_PASMU      E-WVTHQWLKKAVLLSFRINDNEL-------VAGSETN-----YYDK---VPMKFAEYDA
DAPD_AERHH      E-WVVHQWLKKAVLLYFRINDNGI-------IKGDDAQ-----YYDK---VPLKFSDYSA
DAPD_AERS4      E-WVVHQWLKKAVLLYFRINDNGI-------IKGDDAQ-----YYDK---VPLKFSDYTA
DAPD_NITEU      E-WVVHQWIKKAVLLSFRMEDNSF-------IKGGFSN-----YFDK---IPSKFADYSS
DAPD_NITEC      E-WVTRQWVKKAVLLSFRMEDNYF-------IKGGFSN-----YFDK---IPSKFADYSS
DAPD_NITMU      E-WKTHQWIKKAVLLSFRIEDNSF-------IKGGFSN-----YFDK---VPSKFADYSS
DAPD_HAES1      GEWIVNQWLKKAVLLSFRLNDNVV-------VDGAETK-----YYDK---VPVKFADYDV
DAPD_HISS2      GEWIVNQWLKKAVLLSFRLNDNVV-------VDGAETK-----YYDK---VPVKFADYDV
DAPD_METFK      QNWVTHQWIKKAVLLSFRLEDNVL-------LDDGVTK-----YFDK---VPPKFANYTE
DAPD_THIDA      QNWTTNQWVKKAVLLSFRLEDNAF-------IKGGYTN-----YYDK---VPSKFADFNS
DAPD_ALKEH      D-WVVNEWLKKAVLLSFRLNDNEI-------IRGGATN-----FFDK---VPLKFADTNS
DAPD_METCA      G-WVVNQWLKKAVLLSFRINDNRV-------MDGGETR-----YFDK---VEPKFGGFGP
DAPD_NITOC      E-WIVNEWLKKAVLLSFRLSDNVF-------IKGGYTN-----YFDK---VPSKYADYSS
DAPD_COLP3      S-WHVNQWLKKAVLLSFRIWDNQV-------IDGAEST-----FFDK---VPMKYEGYTQ
DAPD_PSEHT      E-WVVHQWLKKAVLLSFRIRENQA-------MDDGVNQ-----FYDK---VPLKFSDYTP
DAPD_IDILO      E-WVVHQWLKKAVLLSFRLNDNDL-------IEGGETR-----FWDK---VPAKFADYDS
DAPD_NEIM0      GEWKVNEWAKKAVLLSFRIQDNEV-------LNDGVNK-----YFDK---VPTKFADWSE
DAPD_NEIMF      GEWKVNEWAKKAVLLSFRIQDNEV-------LNDGVNK-----YFDK---VPTKFADWSE
DAPD_NEIMB      GEWKVNEWAKKAVLLSFRIQDNEV-------LNDGVNK-----YFDK---VPTKFADWSE
DAPD_NEIMA      GEWKVNEWAKKAVLLSFRIQDNEV-------LNDGVNK-----YFDK---VPTKFADWSE
DAPD_NEIG1      GEWKVNEWAKKAVLLSFRIQDNEV-------LNDGVNK-----YFDK---VPTKFADWSE
DAPD_CHRVO      AEWVVNQWVKKAVLLSFRIRDNAV-------QDDGVNR-----YFDK---VDTKFADWSQ
DAPD_LEGPA      E-WTVHQWLKKAVLLSFKLFPNQI-------IDAGFCK-----FYDK---IPLKYTDCSN
DAPD_LEGPH      E-WTVHQWLKKAVLLSFKLFPNQI-------IDAGFCK-----FYDK---IPLKYTDCSN
DAPD_LEGPC      E-WTVHQWLKKAVLLSFKLFPNQI-------IDAGFCQ-----FYDK---IPLKYTDCSN
DAPD_LEGPL      E-WTVHQWLKKAVLLSFKLFPNQI-------IDAGFCK-----FYDK---IPLKYTDSSN
DAPD_XYLFA      GGWKVNEWLKKAVLLYFRVHDTMI-------VDAQPAP-----FWDK---IESRFSGYDA
DAPD_XYLFT      GGWKVNEWLKKAVLLYFRVHDTTI-------VDAQPAP-----FWDK---VESRFSGYDA
DAPD_WOLPM      GEWVVHKWIKQAILLHFLTEENK--------IIDNTNC-----WFDK---IGNKFSEWNE
DAPD_WOLTR      GKWIVHTWIKQAISLYFLTEESK--------MIDHTGW-----WFDK---VNNKFDGWNE
DAPD_WIGBR      GTWITNQWIKKSILIYFCIFKNKL-------IISENMN-----FFDK---ISMKFEKWDH
DAPD_EHRRG      GQWIVNEWIKKAILLSFRIYDMKFVYTNCHDSIIGNFS-----WFDK---IPLKFGQWNA
DAPD_RICCN      NSWHVNEWVKKAILLYFITTESQL-------YNNNYNS-----WYDK--VAPKFSADTDK
DAPD_RICFE      NSWEVNEWVKKAILLYFITTESQL-------YNNNYNS-----WYDK--VAPKFSADTDK
DAPD_RICRS      NSWHVNEWVKKAILLYFITTESQL-------YNNNYNS-----WYDK--VAPKFSADTDK
DAPD_RICAH      NSWEVNEWVKKAILLYFITTESQL-------YNNNYNS-----WYDK--VAPKFSVDTDE
DAPD_RICPR      NQWKVNEWVKKAILLYFITTESQL-------YNNNYNS-----WYDK--VAPKFPADTDK
DAPD_RICTY      NQWKVNEWVKKAILLYFITTESQL-------YNNNYNS-----WYDK--VAPKFPADTDK
DAPD_RICBR      SSWQVNDWVKKAILLYFMTTESQL-------YNNNYNS-----WYDK--VAPKFPFDAEL
DAPD_PELUB      NEWVVNQWVKKAIMLSFRTHDMDS-------LSGPYSS-----WYDKSHLLKGKTANWTK
                  * .. * * :: : :                           :**             

DAPD_COXBU      Q--PQSGVRVVPHAIVRKGAYLAPNTVLMPSYINIGAYVDSGTLIDTWATVGSCAQIGKN
DAPD_COXBR      Q--PQSGVRVVPHAIVRKGAYLAPNTVLMPSYINIGAYVDSGTLIDTWATVGSCAQIGKN
DAPD_COXBN      Q--PQSGVRVVPHAIVRKGAYLAPNTVLMPSYINIGAYVDSGTLIDTWATVGSCAQIGKN
DAPD_BLOFL      EYFKNRKIRIIPPATVRYGAYIANNTVIMPSYVNIGAYIDTGTMIDTWATIGSCAHIGKN
DAPD_BLOPB      TRFENKKLRIIPPATVRYGAYIADNTVIMPSYINLGAYIDVGTMIDTWATVGSCAQIGKY
DAPD_BUCAI      KQFKKEKVRIVPPATIRYGAFINYNTIIMPSYINIGAYIDQGTMIDTWATIGSCAQIGKN
DAPD_BUCAP      KKFKEERIRVVPPATIRYGSFINSNTIIMPSYVNIGAYVDQGTMIDTWTTVGSCAQIGKN
DAPD_BUCBP      EKFKNEKIRIVPPATVRHGAFIGKNTILMPCYVNTGAYIDEGTMIDTWATVGSCAQIGKN
DAPD_ACIAC      AEMAATGVRVVPPAVARRGSFIAKGAILMPSYVNIGAYVDEGTMVDTWATVGSCAQVGKH
DAPD_ACISJ      DEMAATGVRVVPPAVARRGSFIAKGAILMPSYVNIGAYVDEGTMVDTWATVGSCAQVGKN
DAPD_RHOFT      EAMKASGVRVVPPAVARRGSYLAKGVILMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKH
DAPD_BORBR      AAFKAGGYRVVPPAVARRGAFIARNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_BORPE      AAFKAGGYRVVPPAVARRGAFIARNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_BORPA      AAFKAGGYRVVPPAVARRGAFIARNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_BORA1      AAFKAGGYRVVPPAVARRGSFIGRNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_AZOSB      EQFQQGGFRVVPPAVARKGSYIAKNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_AROAE      EQFREGGFRVVPPAVARRGSFIGRNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_BURCA      EDFAAGGFRVVPPAIARRGSFIAKNVVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_BURCH      EDFAAGGFRVVPPAIARRGSFIAKNVVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_BURL3      EDFAAGGFRVVPPAIARRGSFIAKNVVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_BURVG      EDFAAGGFRVVPPAIARRGSFIAKNVVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_BURCM      EDFAAGGFRVVPPAIARRGSFIAKNVVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_PARXL      EDFAAGGFRVVPPAIARRGSFIAKNVVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_BURMA      EDFAAGGFRVVPPAIARRGSFIAKNVVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_BURP6      EDFAAGGFRVVPPAIARRGSFIAKNVVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_BURM9      EDFAAGGFRVVPPAIARRGSFIAKNVVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_BURM7      EDFAAGGFRVVPPAIARRGSFIAKNVVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_BURMS      EDFAAGGFRVVPPAIARRGSFIAKNVVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_BURPS      EDFAAGGFRVVPPAIARRGSFIAKNVVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_BURP0      EDFAAGGFRVVPPAIARRGSFIAKNVVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_CUPNH      DDFAKAGFRVVPPAVARRGSFIAKNAVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_CUPPJ      DDFAKAGFRVVPPAVARRGSFIAKNAVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_CUPMC      DDFAKAGFRVVPPAVARRGSYIARNAVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_RALSO      DDFARGGFRVVPPAVARRGSFIGKNAVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_HERAR      EDFAKGGFRVVPPAVARHGSFIGKNVVMMPSFVNIGAYVDEGSMVDAWATVGSCAQIGKN
DAPD_JANMA      EDFAKGGFRVVPPAVARHGSFIGKNVVMMPSFVNIGAYVDEGSMVDAWATVGSCAQIGKN
DAPD_POLAQ      ADFAAGGFRVVPPAVARRGSFIGKNAVLMPSYVNIGAYVGEGTMVDTWATVGSCAQIGKN
DAPD_ACIBA      EQFKAAGVRVVPPAVARRGSFQAKNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_ACIBT      EQFKAAGVRVVPPAVARRGSFQAKNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_ACIAD      EQFKEAGVRVVPPAVARRGSYQAKNVVLMPSYVNIGAYVDENTMVDTWATVGSCAQIGKN
DAPD_PSYA2      AQFKEAGVRVVPPAVARKGSYIAPGAVLMPSYVNIGAYVDQGAMVDTWATVGSCAQIGKN
DAPD_PSYCK      AQFKEAGVRVVPPAVARKGSYIAPGAVLMPSYVNIGAYVDQGAMVDTWATVGSCAQIGKN
DAPD_PSYWF      QQFVEAGVRVVPPAVARRGSFIAKGVVLMPSYTNIGAYVDEGAMIDTWATVGSCAQIGKN
DAPD_BRUAB      NEFEKAGFRAVPNCIVRHSAYIAPNAILMPSFVNLGAYVDKGAMIDTWATVGSCAQIGKN
DAPD_BRUA2      NEFEKAGFRAVPNCIVRHSAYIAPNAILMPSFVNLGAYVDKGAMIDTWATVGSCAQIGKN
DAPD_BRUC2      NEFEKAGFRAVPNCIVRHSAYIAPNAILMPSFVNLGAYVDKGAMIDTWATVGSCAQIGKN
DAPD_BRUME      NEFEKAGFRAVPNCIVRHSAYIAPNAILMPSFVNLGAYVDKGAMIDTWATVGSCAQIGKN
DAPD_BRUO2      NEFEKAGFRAVPNCIVRHSAYIAPNAILMPSFVNLGAYVDKGAMIDTWATVGSCAQIGKN
DAPD_BRUSU      NEFEKAGFRAVPNCIVRHSAYIAPNAILMPSFVNLGAYVDKGAMIDTWATVGSCAQIGKN
DAPD_BRUSI      NEFEKAGFRAVPNCIVRHSAYIAPNAILMPSFVNLGAYVDKGAMIDTWATVGSCAQIGKN
DAPD_OCHA4      NEFEKAGFRAVPNCIVRHSAYIAPNAILMPSFVNLGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_RHILO      VDFEKAGFRAVPSSIVRRSAYVAPGAVLMPSFVNVGAYVDTGTMVDTWASVGSCAQIGKN
DAPD_RHIME      NEFEKAGFRAVPNCVVRRSAYIAPNAVLMPSFVNLGAYVGEGTMVDTWATVGSCAQIGKN
DAPD_SINMW      NEFEKAGFRAVPNCVVRRSAYIAPNAVLMPSFVNLGAYVGEGTMVDTWATVGSCAQIGKN
DAPD_CHESB      NEFEKAGFRAVPNCIVRRSAYIAPGAVLMPSFVNLGAYVGRNTMVDTWATVGSCAQIGEN
DAPD_RHIEC      NQFRASGFRAVPNCVVRRSAYIAPNAILMPSFVNLGAYVGEGTMVDTWATVGSCAQIGKH
DAPD_RHIL3      NHFRAAGFRAVPNCVVRRSAYIAPNAILMPSFVNLGAYVGEGTMVDTWATVGSCAQIGKH
DAPD_AGRFC      NQFRAAGFRAVPNAVVRRSAYVAKNVVLMPSFVNLGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_BRASB      NRFREAGFRAVPGAIVRRSAFIAKNVVLMPSFVNLGAYVDEATMVDTWSTVGSCAQIGKR
DAPD_BRASO      NRFREAGFRAVPGAIVRRSAFIARNVVLMPSFVNLGAYVDESTMVDTWSTVGSCAQIGKR
DAPD_BRADU      NRFRDAGFRAVPGAVVRRSAFIAKNVVLMPSFVNLGAYVDESTMVDTWATVGSCAQIGKR
DAPD_RHOP5      NRFRDAGFRAVPGAIVRRSAFIGKNVVLMPSFVNLGAYVDEATMVDTWSTVGSCAQIGKR
DAPD_RHOPS      SRFREAGFRAVPGAIVRRSAFIAKNAVLMPSFVNLGAYVDEATMVDTWSTVGSCAQIGKR
DAPD_RHOPA      NRFREAGFRAVPGAIVRRSAFIAKNAVLMPSFVNLGAYVDESTMVDTWATVGSCAQIGKR
DAPD_RHOPB      NRFRDAGFRAVPGAIVRRSAFIAKNVVLMPSFVNLGAYVDEATMVDTWVTVGSCAQIGKR
DAPD_NITHX      NRFRDAGFRAVPGAIVRRSAYIAKNAVLMPSFVNLGAYVDESTMVDTWCTVGSCAQIGKR
DAPD_NITWN      NRFRDAGFRAVPGAIVRRSAFIARNVVLMPSFVNLGAYVDESTMVDTWCTVGSCAQIGKR
DAPD_BARHE      ADFKKADFRSVPGAIVRHSAYIAPNVILMPSFVNLGAFVDEGTMVDTWATVGSCAQIGKH
DAPD_BARQU      TDFKKANFRSVPGTIVRHSAYIAPNVILMPSFVNLGAFIDEGTMVDTWATVGSCAQIGKH
DAPD_BART1      DDFQKAGFRSVPGAIVRHSAYVAPNVILMPSFINLGAFVDEGTMVDTWTTVGSCAQIGKH
DAPD_BARBK      TDFKKANFRSVPGAIVRHSAYIASNVILMPSFVNLGAYVDEETMIDTWATVGSCAQIGKH
DAPD_PARL1      AEFRKAGFRAVPGAIVRRSAYIAPNVVLMPSFVNLGAHVDEGTMVDTWVTVGSCAQIGKN
DAPD_GLUOX      FRFAEAGFRAVPGAIVRRSAFIAPNVVLMPSFVNVGARVDSGTMIDTWATVGSCAQIGKN
DAPD_GRABC      ARFAQGGFRVVPGAVVRRSAYIAPGVVLMPSFVNVGAYVDSGTMIDTWATVGSCAQVGKN
DAPD_MAGSA      SRFRAAGFRAVPGAVVRRSAYIAPGVVLMPSFVNLGAHVGSGTMVDTWATVGSCAQIGKN
DAPD_RHORT      DRFRAAGFRAVPGAIVRRSAHIAPGVVLMPSFVNLGARVESGAMIDTWATVGSCAQIGRN
DAPD_MARMM      AEFKAAGFRAVPPCAVRRGAFIAPGAVLMPSYVNLGAYVGEGTMIDTWASVGSCAQVGAN
DAPD_DINSH      GAWEKAGFRAVPSCVVRKSAYIAPGVVLMPSFVNLGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_RUEPO      SQWKAAGFRAVPNCVVRKSAYIAPGVVLMPSFVNLGAYVDSGTMVDTWATVGSCAQIGRN
DAPD_ROSDO      ADWKDAGFRAVPNCVVRKSAYIAPGVVLMPSFVNLGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_JANSC      NEWGAAGFRAVPNCVVRKSAYIAPGVVLMPSFVNLGAYVDSGTMVDTWATVGSCAQIGKN
DAPD_RHOS4      AQWKAAGFRAVPNCVVRRSAYIARGVVLMPSFVNLGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_RHOS1      AQWKAAGFRAVPNCIVRRSAYIARGVVLMPSFVNLGAYVDESTMVDTWATVGSCAQIGKN
DAPD_RHOS5      AQWKAAGFRAVPNCIVRRSAYIAKGVVLMPSFVNLGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_PARDP      AQWQAAGFRAVPNCVVRRSAYIAKGVVLMPSFVNLGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_NOVAD      NRFREAGFRVVPGAVARKGAHIGKGVVLMPSFVNIGAFVDEGTMVDTWATVGSCAQIGKN
DAPD_ZYMMO      DQFKQAGFRAVPGAVVRRGAFISKGAVLMPSFVNIGAYVGENTMVDTWATVGSCAQIGAN
DAPD_CAUVC      PQFEAGGFRAVPGAIVRRGAHIGKNVILMPSFVNIGGYVDEGTMVDTWVTVGSCAQIGKN
DAPD_DECAR      EQFRQGGFRVVPGTIVRKGSYVAKNAVLMPSFVNIGAYVDESTMVDTWVTVGSCAQIGKN
DAPD_UNKP       ARFQKEGFRVVPPATVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_SERP5      ARFQKEGFRVVPPATVRQGAFIARNTVLMPSYVNIGAYVDEGSMVDTWATVGSCAQIGKN
DAPD_YERPE      ARFQREGFRVVPPATVRKGAFIARNTVLMPSYVNIGAFVDEGTMVDTWATVGSCAQIGKN
DAPD_YERPA      ARFQREGFRVVPPATVRKGAFIARNTVLMPSYVNIGAFVDEGTMVDTWATVGSCAQIGKN
DAPD_YERP3      ARFQREGFRVVPPATVRKGAFIARNTVLMPSYVNIGAFVDEGTMVDTWATVGSCAQIGKN
DAPD_YERPN      ARFQREGFRVVPPATVRKGAFIARNTVLMPSYVNIGAFVDEGTMVDTWATVGSCAQIGKN
DAPD_YERPP      ARFQREGFRVVPPATVRKGAFIARNTVLMPSYVNIGAFVDEGTMVDTWATVGSCAQIGKN
DAPD_YERPS      ARFQHEGFRVVPPATVRKGAFIARNTVLMPSYVNIGAFVDEGTMVDTWATVGSCAQIGKN
DAPD_YERE8      ARFQREGFRVVPPATVRKGAFIARNTVLMPSYVNIGAFVDEGTMVDTWATVGSCAQIGKN
DAPD_SHIFL      ARFQKEGFRVVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_SHIF8      ARFQKEGFRVVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_ECO24      ARFQKEGFRVVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_ECOHS      ARFQKEGFRVVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_ECOLI      ARFQKEGFRVVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_ECOLC      ARFQKEGFRVVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_SHISS      ARFQKEGFRVVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_ECO57      ARFQKEGFRVVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_SHIBS      ARFQKEGFRVVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_ECOK1      ARFQKEGFRVVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_ECOL5      ARFQKEGFRVVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_ECOUT      ARFQKEGFRVVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_ECOL6      ALFQKEGFRVVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_SHIDS      ARFQKEGFRVVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_CITK8      ARFQKEGFRVVPPAAVRQGAFIARNTVLMPSYVNIGAFVDEGTMVDTWATVGSCAQIGKN
DAPD_ENT38      ARFVKEGFRVVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGSMVDTWATVGSCAQIGKN
DAPD_SALAR      ARFQKEGFRVVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_SALTY      ARFQKEGFRVVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_SALPA      ARFQKEGFRVVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_SALPB      ARFQKEGFRVVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_SALCH      ARFQKEGFRVVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_SALTI      ARFQKEGFRVVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_KLEP7      ARFQKEGFRVVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_CROS8      ARFQKEGFRVVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_PECAS      ARFQREGVRVAPPASVRRGAYIARNTVLMPSYVNIGAYVDEGTMVDTWVTVGSCAQIGKN
DAPD_PHOLL      TRFEKEGFRVVPPAAARQGAFIARNCVLMPSYVNIGAYVDEGTMVDTWTTVGSCAQIGKN
DAPD_SODGM      ERFQREGFRVVPPASVRQGAYIARNTVLMPSYVNIGAYVDESTMVDTWATVGSCAQIGKN
DAPD_SHEAM      ARFRAEAIRVVPPAAVRKGSFIGKNTVLMPSYVNLGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_SHESH      ARFKEEAIRVVPPATVRKGSFIGKNTVLMPSYVNLGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_SHELP      ARFKQEAIRVVPPAAVRKGSFIGKNTVLMPSYVNLGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_SHEHH      ARFRKEAIRVVPPAAVRKGSFIGKNTVLMPSYVNLGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_SHEPA      ARFRKEAIRVVPPAAVRKGSFIGKNTVLMPSYVNLGAFVDEGTMVDTWATVGSCAQIGKN
DAPD_SHEB5      ARFKAEAIRVVPSATVRKGSFIGKNTVLMPSYVNLGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_SHEB8      ARFKAEAIRVVPSATVRKGSFIGKNTVLMPSYVNLGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_SHEB9      ARFKAEAIRVVPSATVRKGSFIGKNTVLMPSYVNLGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_SHEPC      ARFKAEAIRVVPSATVRKGSFIGKNTVLMPSYVNLGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_SHESW      ARFKAEAIRVVPSATVRKGSFIGKNTVLMPSYVNLGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_SHESA      ARFKAEAIRVVPSATVRKGSFIGKNTVLMPSYVNLGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_SHESM      ARFKAEAIRVVPSATVRKGSFIGKNTVLMPSYVNLGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_SHESR      ARFKAEAIRVVPSATVRKGSFIGKNTVLMPSYVNLGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_SHEON      ARFKAEAIRVVPSATVRKGSFIGKNTVLMPSYVNLGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_SHEDO      ARFKAEAIRVVPPATVRKGSFIGKNTVLMPSYVNLGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_SHEFN      ARFKAEGIRVVPPATVRKGSFIGKNTVLMPSYVNLGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_ACTPL      ERFAQEGFRVVPSATVRKGAYISKNCVLMPSYVNIGAYVGEGTMVDTWATVGSSRQIGKN
DAPD_ACTP2      ERFAQEGFRVVPSATVRKGAYISKNCVLMPSYVNIGAYVGEGTMVDTWATVGSCAQIGKN
DAPD_HAEIN      ERFTEEGFRVVPSATVRKGAYISKNCVLMPSYVNIGAYVGEGTMVDTWATVGSCAQIGKN
DAPD_HAEIE      ERFTEEGFRVVPSATVRKGAYISKNCVLMPSYVNIGAYVGEGTMVDTWATVGSCAQIGKN
DAPD_HAEI8      ERFTEEGFRVVPSATVRKGAYISKNCVLMPSYVNIGAYVGEGTMVDTWATVGSCAQIGKN
DAPD_HAEDU      SRFAEEGFRVVPSATVRKGAYIAKNCVLMPSYVNIGAYVGEGTMVDTWATVGSCAQIGKN
DAPD_ACTSZ      ERFAQEGFRVVPSATVRKGAYISKNTVLMPSYVNIGAYVGEGTMVDTWATVGSCAQIGKN
DAPD_MANSM      ERFQQEGFRVVPSATVRKGAYIAKNTVLMPSYVNIGAFVDEGTMVDTWVTVGSCAQIGKN
DAPD_PASMU      ARFQQEGFRVVPPAAVRKGAYIAKNTVLMPSYVNIGARVDEGTMVDTWATVGSCAQIGKN
DAPD_AERHH      EQFKAAGVRVVPPATARKGSFIAPNTVLMPSYVNIGAFVDEGTMVDTWATVGSCAQIGKN
DAPD_AERS4      EQFKEAGVRVVPPATARKGSFIAPNTVLMPSYVNIGAFVDEGTMVDTWATVGSCAQIGKN
DAPD_NITEU      RDFRDGGFRVVPPAAVRKGSFIASNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_NITEC      RDFRDGGFRVVPPAAVRKGAFIANNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQVGKN
DAPD_NITMU      RDFRNGGFRVVPPATVRKGAFIASNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_HAES1      ERFKTEGFRAVPGAVVRKGSHISKGVVLMPSFVNIGAYVGEGTMVDTWATVGSCAQIGKN
DAPD_HISS2      ERFKTEGFRAVPGAVVRKGSHISKGVVLMPSFVNIGAYVGEGTMVDTWATVGSCAQIGKN
DAPD_METFK      ADFKAGGFRVVPNAIVRRGSFIAKNAVLMPSYVNIGAYVGEGTMVDTWATVGSCAQIGKN
DAPD_THIDA      KDFREGGFRVVPPAAARKGSYIGKNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_ALKEH      EQMRASGVRVVPPAMARRGAYIGPGAVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_METCA      EEFRAAGVRVVPPAAVRRGAYIAPGVILMPSYVNIGAYVDSGTMVDTWATVGSCAQIGKN
DAPD_NITOC      RDFRQDEVRIVPPASVRKGAFIAPSVVLMPSYVNIGAYVDRGTMVDTWATVGSCAQIGKN
DAPD_COLP3      AMFEADGVRVVPGASVRTGSFIGKNVVVMPSFVNIGAFVDEGCMVDAWATVGSCAQIGKN
DAPD_PSEHT      EQFKQGGMRVVPNAVARKGSFVGKNVVLMPSYVNIGAYVDDGTMVDTWATVGSCAQIGKN
DAPD_IDILO      ARFRAEGMRVVPPAMVRKGAFIGRNVVVMPSYVNIGAHVGEGTMVDTWATVGSCAQIGKN
DAPD_NEIM0      DEFKNAGFRAVPGAVARRGSFVAKNVVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKN
DAPD_NEIMF      DEFKNAGFRAVPGAVARRGSFVAKNVVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKN
DAPD_NEIMB      DEFKNAGFRAVPGAVARRGSFVAKNVVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKN
DAPD_NEIMA      DEFKNAGFRAVPGAVARRGSFVAKNVVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKN
DAPD_NEIG1      DEFKNAGFRAVPGAVARRGSFVAKNAVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKN
DAPD_CHRVO      ARFQEAGFRVVPGAVARKGSFIAKNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKN
DAPD_LEGPA      EQFQQSGVRVVPHAMVRRGAYIAKNTVLMPSYVNIGAYIDEGVMVDTWATVGSCAQIGKN
DAPD_LEGPH      EQFQQSGVRVVPHAMVRRGAYIAKNTVLMPSYVNIGAYIDEGVMVDTWATVGSCAQIGKN
DAPD_LEGPC      EQFSQSGVRVVPHGMVRRGAYIAKNTVLMPSYVNIGAYIDEGVMVDTWATVGSCAQIGKN
DAPD_LEGPL      EQFQQSGVRVVPHAMVRRGAYIAKNTVLMPSYVNIGAYIDEGVMVDTWATVGSCAQIGKN
DAPD_XYLFA      AKFRAAGVRVVPGAIARRGSYFGKDVVLMPSFTNIGAYVGEGTMIDTWATVGSCAQLGAH
DAPD_XYLFT      VKFRAAGVRVVPGAIARRGSYFGKDVVLMPSFTNIGAYVGEGTMIDTWATVGSCAQLGAH
DAPD_WOLPM      EKFRRLKIRAVPGCFVRRSAYIGTNVVLMPSFINVGAYVDSGTMIDTWSTIGSCAQIGKN
DAPD_WOLTR      EEFHQSKIRAVPGCFVRQSAYVGTNVVLMPSFINVGAYISSGTMIDTWSTIGSCAQIGKN
DAPD_WIGBR      DDFCKHKIRAVPCSFVRKGSFIAKNSVIMPSYINIGAYIGENSTIDTWSTIGSCAQIGKN
DAPD_EHRRG      DNFKQAKIRVVPGAIVRKSAYIAPGAVLMPSFVNVGAYVGEGTMVDTWASVGSCAQVGKN
DAPD_RICCN      NTFKEAAIRKVPGAVVRTGTYIAKNVVIMPSFINIGAYIDEGTMIDTWATIGSCAQIGKN
DAPD_RICFE      NIFKEAAIRKVPGAVVRTGTYIAKNVVIMPSFINIGAYIDEGTMIDTWATIGSCAQIGKN
DAPD_RICRS      NTFKEAAIRTVPGAIVRTGAYIAKNVVIMPSFINIGAYIDEGTMIDTWATIGSCAQIGKN
DAPD_RICAH      NIFKEAAIRKVPGAVVRTGTYIAKNVVIMPSFINIGAYIDEGTMIDTWATIGSCAQIGKH
DAPD_RICPR      NIFKEAAIRKVPGAIVRTGTYIAKNVVIMPSFINIGAYIDEGTMIDTWATIGSCAQIGKN
DAPD_RICTY      NIFKEAAIRKVPGAIVRTGTYIAKNVVIMPSFINIGAYIDEGTMIDTWATIGSCAQIGKN
DAPD_RICBR      NKFKEAGIRKVPGSFVRTGTYIAKNVVIMPSFINIGAYIDEGTMIDTWATIGSCAQIGKN
DAPD_PELUB      EDHIKAGFRMVPNSPVRKGSFIGKNAVLMPCFVNIGAYVDEGTMVDTWASVGSCAQIGKN
                        *  *    * .:.   . ::**.: * *. :     :*:* ::**. ::*  

DAPD_COXBU      VHLSGGAGIGGVLEPLQAHPTIIEDDCFIGARSEIVEGVMVEKGSVISMGVFVGQSTPIY
DAPD_COXBR      VHLSGGAGIGGVLEPLQAHPTIIEDDCFIGARSEIVEGVMVEKGSVISMGVFVGQSTPIY
DAPD_COXBN      VHLSGGAGIGGVLEPLQAHPTIIEDDCFIGARSEIVEGVMVEKGSVISMGVFVGQSTPIY
DAPD_BLOFL      THISGGVGIGGVLEPIQANPTIIEDNCFIGARSEIAEGVIIEENSVLAMGVFISQSTKIY
DAPD_BLOPB      VHLSGGVGIGGVLEPIQTNPTIIEDNCFIGSRSEIVEGVIVEKGAVISMGVFIGQSTKIY
DAPD_BUCAI      VHISGGVGIGGVLEPLQNNPTIIEDNCFIGARSEIVEGVVIEKGCVISMGVFIGQSTKIY
DAPD_BUCAP      VHLSGGVGIGGVLEPLQNNPTIIEDNCFIGARSEIVEGVIIEEGSVISMGVFIGQSTKIY
DAPD_BUCBP      VHLSGGVGIGGVLEPLQNNPTIIEDNCFIGARSEIVEGVIIESNSVISMGVFIGQSTKIY
DAPD_ACIAC      VHLSGGVGLGGVLEPLQANPTIIEDNCFIGARSEIVEGVIVEENSVISMGVYIGQSTPIY
DAPD_ACISJ      VHLSGGVGLGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEENSVISMGVYIGQSTPIY
DAPD_RHOFT      VHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTPIY
DAPD_BORBR      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVVVEENSVLAMGVFLSQSTKIY
DAPD_BORPE      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVVVEENSVLAMGVFLSQSTKIY
DAPD_BORPA      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVVVEENSVLAMGVFLSQSTKIY
DAPD_BORA1      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVVVEENSVLAMGVFLSQSTKIF
DAPD_AZOSB      VHLSGGVGIGGVLEPVQAGPVIIEDNVFVGARSEVVEGVIIEENAVLSMGVYIGQSTKIY
DAPD_AROAE      VHLSGGVGIGGVLEPVQAGPVIIEDNVFVGARSEVVEGVIIEENAVLSMGVYIGQSTKIY
DAPD_BURCA      VHLSGGVGIGGVLEPLQANPVIIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIY
DAPD_BURCH      VHLSGGVGIGGVLEPLQANPVIIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIY
DAPD_BURL3      VHLSGGVGIGGVLEPLQANPVIIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIY
DAPD_BURVG      VHLSGGVGIGGVLEPLQANPVIIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIY
DAPD_BURCM      VHLSGGVGIGGVLEPLQANPVIIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIY
DAPD_PARXL      VHLSGGVGIGGVLEPLQANPVIIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIY
DAPD_BURMA      VHLSGGVGIGGVLEPLQANPVIIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIY
DAPD_BURP6      VHLSGGVGIGGVLEPLQANPVIIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIY
DAPD_BURM9      VHLSGGVGIGGVLEPLQANPVIIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIY
DAPD_BURM7      VHLSGGVGIGGVLEPLQANPVIIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIY
DAPD_BURMS      VHLSGGVGIGGVLEPLQANPVIIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIY
DAPD_BURPS      VHLSGGVGIGGVLEPLQANPVIIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIY
DAPD_BURP0      VHLSGGVGIGGVLEPLQANPVIIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIY
DAPD_CUPNH      VHLSGGVGIGGVLEPLQANPVIIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIY
DAPD_CUPPJ      VHLSGGVGIGGVLEPLQANPVIIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIY
DAPD_CUPMC      VHLSGGVGIGGVLEPLQANPVIIEDNCFIGARSEVVEGVIIEENSVISMGVYLGQSTKIY
DAPD_RALSO      VHLSGGVGIGGVLEPLQANPVIIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIY
DAPD_HERAR      VHLSGGVGIGGVLEPMQANPTIIEDNCFIGARSEIVEGVIVEENSVISMGVYIGQSTKIY
DAPD_JANMA      VHLSGGVGIGGVLEPMQANPTIIEDNCFIGARSEIVEGVIVEENSVISMGVYIGQSTKIY
DAPD_POLAQ      VHLSGGVGIGGVLEPIQAGPVIIEDNCFIGARSEVVEGVVIEENAVLSMGVYIGQSTKIY
DAPD_ACIBA      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTRIY
DAPD_ACIBT      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTRIY
DAPD_ACIAD      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEIVEGVIVEEGAVISMGVYIGQSTRIY
DAPD_PSYA2      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEIVEGVIVEEGAVISMGVYIGQSTRIY
DAPD_PSYCK      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEIVEGVIVEEGAVISMGVYIGQSTRIY
DAPD_PSYWF      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTKIY
DAPD_BRUAB      VHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIV
DAPD_BRUA2      VHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIV
DAPD_BRUC2      VHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIV
DAPD_BRUME      VHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIV
DAPD_BRUO2      VHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIV
DAPD_BRUSU      VHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIV
DAPD_BRUSI      VHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIV
DAPD_OCHA4      VHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIV
DAPD_RHILO      VHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGQSTKIV
DAPD_RHIME      VHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIV
DAPD_SINMW      VHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIV
DAPD_CHESB      VHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIV
DAPD_RHIEC      VHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIIREGSVLGMGVYIGKSTKIV
DAPD_RHIL3      VHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIIREGSVLGMGVFIGKSTKIV
DAPD_AGRFC      VHLSGGVGIGGVLEPLQAGPTIIEDNCFIGARSEVVEGCIVREGAVLGMGVFIGKSTKIV
DAPD_BRASB      VHISGGVGIGGVLEPLQAGPVIIEDDCFIGARSEVAEGVVVRKGAVLAMGVFLGASTKVI
DAPD_BRASO      VHISGGVGIGGVLEPLQAGPVIIEDDCFIGARSEVAEGVIVRKGAVLAMGVFLGASTKIV
DAPD_BRADU      VHISGGAGIGGVLEPLQAEPVIIEDDCFIGARSEVAEGVIVRKGAVLAMGVFLGASTKIV
DAPD_RHOP5      VHISGGVGIGGVLEPLQAGPVIIEDDCFIGARAEVAEGVIVRRGAVLAMGVFLGASTKIV
DAPD_RHOPS      VHISGGVGIGGVLEPLQAGPVIIEDDCFIGARSEVAEGVIVRRGAVLAMGVFLGASTKIV
DAPD_RHOPA      VHISGGAGIGGVLEPLQAGPVIIEDDCFIGARSEVAEGVIVRKGAVLAMGVFLGASTKIV
DAPD_RHOPB      VHISGGVGIGGVLEPLQAGPVIIEDDCFIGARSEVAEGVIVRRGAVLSMGVFLGASTKII
DAPD_NITHX      VHISGGAGIGGVLEPLQAGPVIIEDDCFIGARSEVAEGVIVRKGAVLSMGVFLGASTKIV
DAPD_NITWN      VHISGGAGIGGVLEPLQAGPVIIEDDCFIGARSEVAEGVIVRKGAVLSMGVFLGASTKIV
DAPD_BARHE      VHLSGGVGIGGVLEPLQANPTIIEDHCFIGARSEVVEGCIIREGSVLGMGVFIGKSTKII
DAPD_BARQU      VHLSGGVGLGGVLEPLQANPTIIEDHCFIGARSEVVEGCIIREGAVLGMGVFIGKSTKII
DAPD_BART1      VHLSGGVGIGGVLEPLQANPTIIEDHCFIGARSEVVEGCIIREGAVLGMGVFIGQSTKII
DAPD_BARBK      VHLSGGVGIGGVLEPLQASPTIIEDHCFIGARSEVVEGCIIREGSVLGMGVFIGKSTKII
DAPD_PARL1      CHLSGGVGIGGVLEPLQANPVIIEDNCFIGARSEVVEGVIVGEGAVLSMGVFISASTKII
DAPD_GLUOX      CHISGGAGIGGVLEPLQAAPVIIEDDCFIGARSEVAEGVIVEKGSVLSMGVFLGASTKIV
DAPD_GRABC      CHISGGTGIGGVLEPLQAGPVVIEDNVFIGARSEVAEGVVVEQGSVISMGVFIGASTKII
DAPD_MAGSA      VHISGGAGIGGVLEPLQAGPVIIEDNCFIGARAEVAEGVIVETGAVLSMGVYIGASTKIV
DAPD_RHORT      VHLSGGAGIGGVLEPLQAGPVIIEDNCFIGARSEVAEGVLVETGAVLSMGVFIGASTRVI
DAPD_MARMM      CHISAGTGIGGVLEPLQADPVIIEDNCFIGARSEVVEGVIVREGSVLAMGVYITRSTKIV
DAPD_DINSH      VHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGQSTKIV
DAPD_RUEPO      VHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGVIVREGAVLGMGVYIGQSTKIV
DAPD_ROSDO      VHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIV
DAPD_JANSC      VHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGQSTKIV
DAPD_RHOS4      VHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIV
DAPD_RHOS1      VHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIV
DAPD_RHOS5      VHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIV
DAPD_PARDP      VHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIV
DAPD_NOVAD      VHISGGAGIGGVLEPLQAGPVIIEDGAFIGARSEVAEGVIVGEGAVLSMGVYLGASTKIV
DAPD_ZYMMO      VHISGGAGIGGVLEPLQAGPVIIGDNAFIGARSEVAEGVTVGEGAVLSMGVFIGASTRII
DAPD_CAUVC      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVVVGEGSVLSMGVFISASTKIV
DAPD_DECAR      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVVIGENSVLSMGVYIGQSTPIY
DAPD_UNKP       VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTRIY
DAPD_SERP5      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTRIY
DAPD_YERPE      VHLSGGVGIGGVLEPLQANPTIIEDNCFVGARSEVVEGVIVEEGSVISMGVFIGQSTRIY
DAPD_YERPA      VHLSGGVGIGGVLEPLQANPTIIEDNCFVGARSEVVEGVIVEEGSVISMGVFIGQSTRIY
DAPD_YERP3      VHLSGGVGIGGVLEPLQANPTIIEDNCFVGARSEVVEGVIVEEGSVISMGVFIGQSTRIY
DAPD_YERPN      VHLSGGVGIGGVLEPLQANPTIIEDNCFVGARSEVVEGVIVEEGSVISMGVFIGQSTRIY
DAPD_YERPP      VHLSGGVGIGGVLEPLQANPTIIEDNCFVGARSEVVEGVIVEEGSVISMGVFIGQSTRIY
DAPD_YERPS      VHLSGGVGIGGVLEPLQANPTIIEDNCFVGARSEVVEGVIVEEGSVISMGVFIGQSTRIY
DAPD_YERE8      VHLSGGVGIGGVLEPLQANPTIIEDNCFVGARSEVVEGVIVEEGSVISMGVFIGQSTRIY
DAPD_SHIFL      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIY
DAPD_SHIF8      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIY
DAPD_ECO24      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIY
DAPD_ECOHS      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIY
DAPD_ECOLI      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIY
DAPD_ECOLC      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIY
DAPD_SHISS      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIY
DAPD_ECO57      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIY
DAPD_SHIBS      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIY
DAPD_ECOK1      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIY
DAPD_ECOL5      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIY
DAPD_ECOUT      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIY
DAPD_ECOL6      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIY
DAPD_SHIDS      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTKIY
DAPD_CITK8      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIY
DAPD_ENT38      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIY
DAPD_SALAR      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTKIY
DAPD_SALTY      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTKIY
DAPD_SALPA      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTKIY
DAPD_SALPB      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTKIY
DAPD_SALCH      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTKIY
DAPD_SALTI      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTKIY
DAPD_KLEP7      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTKIY
DAPD_CROS8      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTKIY
DAPD_PECAS      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVVVEEGSVISMGVFISQSTRIY
DAPD_PHOLL      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEIVEGVIIEEGSVISMGVYIGQSTKIY
DAPD_SODGM      VHLSGGAGIGGVLEPLQANPTIIEDNCFIGARSEMVEGVIVEEGSVISMGVFIGQSTKIY
DAPD_SHEAM      VHLSGGVGIGGVLEPLQAGPTIIEDNCFIGARSEIVEGVVVEEGSVISMGVYIGQSTRIY
DAPD_SHESH      VHLSGGVGIGGVLEPLQAGPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTRIY
DAPD_SHELP      VHLSGGVGIGGVLEPLQAGPTIIEDNCFIGARSEIVEGVVVEEGSVISMGVYIGQSTRIY
DAPD_SHEHH      VHLSGGVGIGGVLEPLQAGPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIY
DAPD_SHEPA      VHLSGGVGIGGVLEPLQAGPTIIEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTRIF
DAPD_SHEB5      VHLSGGVGIGGVLEPLQAGPTIIEDNCFIGARSEIVEGVVVEEGSVISMGVYIGQSTRIY
DAPD_SHEB8      VHLSGGVGIGGVLEPLQAGPTIIEDNCFIGARSEIVEGVVVEEGSVISMGVYIGQSTRIY
DAPD_SHEB9      VHLSGGVGIGGVLEPLQAGPTIIEDNCFIGARSEIVEGVVVEEGSVISMGVYIGQSTRIY
DAPD_SHEPC      VHLSGGVGIGGVLEPLQAGPTIIEDNCFIGARSEIVEGVVVEEGSVISMGVYIGQSTRIY
DAPD_SHESW      VHLSGGVGIGGVLEPLQAGPTIIEDNCFIGARSEIVEGVVVEEGSVISMGVYIGQSTRIY
DAPD_SHESA      VHLSGGVGIGGVLEPLQAGPTIIEDNCFIGARSEIVEGVVVEEGSVISMGVYIGQSTRIY
DAPD_SHESM      VHLSGGVGIGGVLEPLQAGPTIIEDNCFIGARSEIVEGVVVEEGSVISMGVYIGQSTRIY
DAPD_SHESR      VHLSGGVGIGGVLEPLQAGPTIIEDNCFIGARSEIVEGVVVEEGSVISMGVYIGQSTRIY
DAPD_SHEON      VHLSGGVGIGGVLEPLQAGPTIIEDNCFIGARSEIVEGVVVEEGSVISMGVYIGQSTRIY
DAPD_SHEDO      VHLSGGVGIGGVLEPLQAGPTIIEDNCFIGARSEIVEGVVVEEGSVISMGVYIGQSTRIF
DAPD_SHEFN      VHLSGGVGIGGVLEPLQAGPTIIEDNCFIGARSEIVEGVVVEEGSVISMGVYIGQSTRIF
DAPD_ACTPL      VHLSGGVGIGGVLEPLQANPTIIGDNCFIGARSEVVEGVIVEDGCVISMGVFIGQSTRIY
DAPD_ACTP2      VHLSGGVGIGGVLEPLQANPTIIGDNCFIGARSEVVEGVIVEDGCVISMGVFIGQSTRIY
DAPD_HAEIN      VHLSGGVGIGGVLEPLQANPTIIGDNCFIGARSEVVEGVIVEDGCVISMGVFIGQSTKIY
DAPD_HAEIE      VHLSGGVGIGGVLEPLQANPTIIGDNCFIGARSEVVEGVIVEDGCVISMGVFIGQSTKIY
DAPD_HAEI8      VHLSGGVGIGGVLEPLQANPTIIGDNCFIGARSEVVEGVIVEDGCVISMGVFIGQSTKIY
DAPD_HAEDU      VHLSGGVGIGGVLEPLQANPTIIGDNCFIGARSEVVEGVIVEEGCVISMGVFIGQSTRIY
DAPD_ACTSZ      VHLSGGVGIGGVLEPLQANPTIIGDNCFIGARSEVVEGVIVEDGCVISMGVFIGQSTKIY
DAPD_MANSM      VHLSGGVGIGGVLEPLQANPTIIGDNCFIGARSEIVEGVIVEDGCVISMGVFIGQSTKIY
DAPD_PASMU      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIY
DAPD_AERHH      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVFIGQSTRIY
DAPD_AERS4      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVFIGQSTRIY
DAPD_NITEU      VHLSGGVGIGGVLEPVQASPTIIEDNCFIGARSEIVEGVVVGENSVISMGVYIGQSTKIY
DAPD_NITEC      VHLSGGVGIGGVLEPVQASPTIIEDNCFIGARSEIVEGVIVGENSVISMGVYIGQSTRIY
DAPD_NITMU      VHLSGGVGIGGVLEPVQANPTIIEDNCFIGARSEVVEGVIVGENSVISMGVYIGQSTRIY
DAPD_HAES1      VHLSGGVGIGGVLEPLQANPTIIGDNCFIGARSEIVEGVIVEEGCVISMGVFIGQSTKIY
DAPD_HISS2      VHLSGGVGIGGVLEPLQANPTIIGDNCFIGARSEIVEGVIVEEGCVISMGVFIGQSTKIY
DAPD_METFK      VHLSGGVGIGGVLEPVQAGPTIIGDNCFIGARSEVVEGVIVEDNCVISMGVYIGQSTKIY
DAPD_THIDA      VHLSGGVGIGGVLEPVQANPTIIGDNCFIGARSEVVEGVIVEDNCVISMGVYIGQSTKIY
DAPD_ALKEH      VHLSGGVGIGGVLEPLQAAPTIIEDNCFIGARSEVVEGVIVEEGAVISMGVYIGQSTKIY
DAPD_METCA      VHLSGGVGIGGVLEPLQAGPTIIEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTKIY
DAPD_NITOC      VHLSGGVGIGGVLEPLQAKPTIIEDNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTRIY
DAPD_COLP3      VHLSGGVGIGGVLEPLQAGPTIIEDNCFIGARSEIVEGVIVEEGAVISMGVYIGQSTRIF
DAPD_PSEHT      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEIVEGVIVEEGAVISMGVYISQSTRIY
DAPD_IDILO      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEIVEGVIVEEGAVISMGVYIGQSTRIY
DAPD_NEIM0      VHLSGGVGIGGVLEPLQAAPTIIEDNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIF
DAPD_NEIMF      VHLSGGVGIGGVLEPLQAAPTIIEDNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIF
DAPD_NEIMB      VHLSGGVGIGGVLEPLQAAPTIIEDNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIF
DAPD_NEIMA      VHLSGGVGIGGVLEPLQASPTIIEDNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIF
DAPD_NEIG1      VHLSGGVGIGGVLEPLQAAPTIIEDNCFIGARSEIVEGAIVEEGSVISMGVFIGQSTKIF
DAPD_CHRVO      VHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEIVEGVIVGEGSVISMGVYIGQSTKIY
DAPD_LEGPA      VHISGGAGIGGVLEPLQANPTIIEDNCFIGARSEIVEGVIVEKNSVISMGVFLGQSTKIY
DAPD_LEGPH      VHISGGAGIGGVLEPLQANPTIIEDNCFIGARSEIVEGVIVEKNSVISMGVFLGQSTKIY
DAPD_LEGPC      VHISGGAGIGGVLEPLQANPTIIEDNCFIGARSEIVEGVIVEKNSVISMGVFLGQSTKIY
DAPD_LEGPL      VHISGGAGIGGVLEPLQANPTIIEDNCFIGARSEIVEGVIVEKNSVISMGVFLGQSTKIY
DAPD_XYLFA      CHLSGGAAIGGVLEPLQASPAIIEDHCFIGARSEIVEGVIVGHHSVISMGVFISQSTRIY
DAPD_XYLFT      CHLSGGAAIGGVLEPLQASPAIIEDHCFIGARSEVVEGVIVGHHSVIGMGVFISQSTRIY
DAPD_WOLPM      CHISGGVGIGGVLEPIQASPVIIEDNCFIGARSEVAEGVVVREGSVLGIGVFIGASTKII
DAPD_WOLTR      CHVSGGVGIGGVLEPIQASPVIIEDNCFIGARSEVAEGVIIREGSVLGMGVFIGASTKII
DAPD_WIGBR      VHISGGVGIGGVLEPVQNNPTIIEDNCFIGARSEIVEGVVVESGSVISMGVFIGKSTKIY
DAPD_EHRRG      CHISGGAGIGGVLEPLTASPVIIEDNCFIGARSEIVEGVIVEEGAVVSMGVYIGASTKII
DAPD_RICCN      CHISGGTGIGGVLEPLQAKPVIIEDNCFIGARSEIAEGVIVEEGAVISMGVFIGSSTKIV
DAPD_RICFE      CHISGGTGIGGVLEPLQAKPVIIEDNCFIGARSEIAEGVIVEEGAVISMGVFIGSSTKII
DAPD_RICRS      CHISGGTGIGGVLEPLHAKPVIIEDNCFIGARSEIAEGVIVEEGAVISMGVFIGSSTKIV
DAPD_RICAH      CHISGGTGIGGVLEPLQAKPVIIEDNCFIGARSEIAEGVIVEEGAVISMGVFIGSSTKII
DAPD_RICPR      CHISGGAGIGGVLEPLQAKPVIIEDNCFVGARSEIAEGVIVEEGSVISMGVFIGSSTKIV
DAPD_RICTY      CHISGGSGIGGVLEPLQAKPVIIEDNCFVGARSEIAEGIIVEEGSVISMGVFIGSSTKIV
DAPD_RICBR      CHISGGTGIGGVLEPLQAKPVIIEDNCFIGARSEIAEGVIVEEGAVVSMGVFIGASTKIV
DAPD_PELUB      CHISGGAGIGGVLEPMQANPTIIEDNCFIGARSEIVEGVIVGEGSVLSMGVFIGQSTKIV
                 *:*.* .:******:   *.:* *  *:*:*:*:.**  :   .*:.:**::  ** : 

DAPD_COXBU      NRQTQEITYGRIPAGSVVIPGSLP-------SKDGHYNRYSAIIVKQVDKKTRSKVSLNE
DAPD_COXBR      NRQTQEITYGRIPAGSVVIPGSLP-------SKDGHYNRYSAIIVKQVDKKTRSKVSLNE
DAPD_COXBN      NRQTQEITYGRIPAGSVVIPGSLP-------SKDGHYNRYSAIIVKQVDEKTRSKVSLNE
DAPD_BLOFL      NRSTGHVHYGYVPSGSVVIPGSLP-------SEDGKSSTYCAIIVKTVDSRTKNKIQINN
DAPD_BLOPB      DRASGNIYYGRVPAGSVVIPGSLP-------SKDGRVNTYCAVIVKTVDSKTKNKVKINN
DAPD_BUCAI      DRENGKIFYGRVPAHSVVVSGTLP-------SENRNYNLYAAIIVKKVDAKTLGKTEINQ
DAPD_BUCAP      NRETGEILYGRVPANSVVVSGSLP-------SKDRKYNLYAAVIVKRVDSKTLNKVEINQ
DAPD_BUCBP      DRNNKKILYGKVPSGSVVVPGSLP-------SKN-NCNLYCVVIVKQVNAQTLSKTGINK
DAPD_ACIAC      DRATDTVSYGRVPAGSVVVSGSLP-------KGDGKYSMYAAIIVKKVDAKTRSTTSLND
DAPD_ACISJ      DRTTGEITYGRVPAGSVVVSGNLP-------KDGGRYSMYAAIIVKKVDAKTRSTTSLND
DAPD_RHOFT      DRATDTVSYGRIPSGSVVISGSLP-------KNEGKYSLYAAIIVKRVDAQTRAKTSLND
DAPD_BORBR      DRATGKVSYGRVPSGSVVVPGSLP-------SEDGSHSLACAVIVKRVDAQTRAKTSIND
DAPD_BORPE      DRATGKVSYGRVPSGSVVVPGSLP-------SEDGSHSLACAVIVKRVDAQTRAKTSIND
DAPD_BORPA      DRATGKVSYGRVPSGSVVVPGSLP-------SEDGSHSLTCAVIVKRVDAQTRAKTSIND
DAPD_BORA1      DRATGTITYGRVPSGSVVVPGSLP-------SADGSHSLACAVIVKRVDAQTRAKTSIND
DAPD_AZOSB      DRETGSITYGRVPAGAVVVPGSLP-------SADGKYSLYCAVIVKKVDAQTRAKTGINE
DAPD_AROAE      DRATGEVTYGRVPSGAVVVPGSLP-------SADGKYSLYCAVIVKRVDAQTRAKTGINE
DAPD_BURCA      DRETGEVSYGRIPAGSVVVAGNLP-------SKDGSHSLYCAVIVKKVDAKTRAKVGLNE
DAPD_BURCH      DRETGEVSYGRIPAGSVVVAGNLP-------SKDGSHSLYCAVIVKKVDAKTRAKVGLNE
DAPD_BURL3      DRETGEVSYGRIPAGSVVVAGNLP-------SKDGSHSLYCAVIVKKVDAKTRAKVGLNE
DAPD_BURVG      DRETGEVSYGRIPAGSVVVAGNLP-------SKDGSHSLYCAVIVKKVDAKTRAKVGLNE
DAPD_BURCM      DRETGEVSYGRIPAGSVVVAGNLP-------SKDGSHSLYCAVIVKKVDAKTRAKVGLNE
DAPD_PARXL      DRETGEVTYGRIPAGSVVVAGNLP-------SKDGTHSLYCAVIVKKVDARTRAKVGLNE
DAPD_BURMA      DRETGEVTYGRIPAGSVVVAGNLP-------AKDGTHSLYCAVIVKKVDAKTRAKVGLNE
DAPD_BURP6      DRETGEVTYGRIPAGSVVVAGNLP-------AKDGTHSLYCAVIVKKVDAKTRAKVGLNE
DAPD_BURM9      DRETGEVTYGRIPAGSVVVAGNLP-------AKDGTHSLYCAVIVKKVDAKTRAKVGLNE
DAPD_BURM7      DRETGEVTYGRIPAGSVVVAGNLP-------AKDGTHSLYCAVIVKKVDAKTRAKVGLNE
DAPD_BURMS      DRETGEVTYGRIPAGSVVVAGNLP-------AKDGTHSLYCAVIVKKVDAKTRAKVGLNE
DAPD_BURPS      DRETGEVTYGRIPAGSVVVAGNLP-------AKDGTHSLYCAVIVKKVDAKTRAKVGLNE
DAPD_BURP0      DRETGEVTYGRIPAGSVVVAGNLP-------AKDGTHSLYCAVIVKKVDAKTRAKVGLNE
DAPD_CUPNH      DRETGEIHYGRVPAGSVVVAGNLP-------SKDGKYSLYCAVIVKKVDAQTRAKTSLND
DAPD_CUPPJ      DRETGEIHYGRVPAGSVVVAGNLP-------SKDGKYSLYCAVIVKKVDAQTRAKTSLND
DAPD_CUPMC      DRETGEIHYGRVPAGSVVVAGNLP-------SKDGKYSLYCAVIVKKVDAQTRAKTSLND
DAPD_RALSO      DRETGEVHYGRVPAGSVVVPGNLP-------SKDGTYSLYCAVIVKKVDAQTRAKTSLNE
DAPD_HERAR      DRATGEVTYGRIPAGSVVVSGNLP-------SADGKYSLYCAVIVKRVDAKTRAKTGINE
DAPD_JANMA      DRATGEVTYGRIPAGSVVVSGNLP-------SADGKYSLYCAVIVKRVDAKTRAKTGINE
DAPD_POLAQ      DRETGEVHYGRVPAGSVVVPGSLP-------SACGKYSLYAAIIVKKVDAQTRAKTAINE
DAPD_ACIBA      DRETGEIHYGRVPAGSVVVPGNLP-------SADGKYSLYAAIIVKKVDAQTRAKTSLND
DAPD_ACIBT      DRETGEIHYGRVPAGSVVVPGNLP-------SADGKYSLYAAIIVKKVDAQTRAKTSLND
DAPD_ACIAD      DRETGEIHYGRVPAGSVVVPGSLP-------SKDGKYSLYAAIIVKKVDAQTRAKTSLND
DAPD_PSYA2      DRETGEIHRGRVPAGSVVVPGSLP-------SEDGTHSLYAAIIVKKVDAQTRAKTSVNE
DAPD_PSYCK      DRETGEIHRGRVPAGSVVVPGSLP-------SEDGTHSLYAAIIVKKVDAQTRAKTSVNE
DAPD_PSYWF      DRETGEITYGRVPAGSVVVSGSLP-------SKDGSHSLYCAVIVKKVDAQTRSKTSINE
DAPD_BRUAB      DRATGEVFYGEVPPYSVVVAGTMP--GKNVPGENWGPSLYCAVIVKRADEKTRSKTSINE
DAPD_BRUA2      DRATGEVFYGEVPPYSVVVAGTMP--GKNVPGENWGPSLYCAVIVKRADEKTRSKTSINE
DAPD_BRUC2      DRATGEVFYGEVPPYSVVVAGTMP--GKNVPGENWGPSLYCAVIVKRADEKTRSKTSINE
DAPD_BRUME      DRATGEVFYGEVPPYSVVVAGTMP--GKNVPGENWGPSLYCAVIVKRADEKTRSKTSINE
DAPD_BRUO2      DRATGEVFYGEVPPYSVVVAGTMP--GKNVPGENWGPSLYCAVIVKRADEKTRSKTSINE
DAPD_BRUSU      DRATGEVFYGEVPPYSVVVAGTMP--GKNVPGENWGPSLYCAVIVKRADEKTRSKTSINE
DAPD_BRUSI      DRATGEVFYGEVPPYSVVVAGTMP--GKNVPGENWGPSLYCAVIVKRADEKTRSKTSINE
DAPD_OCHA4      DRATGEVFYGEVPPYSVVVAGTMP--GKNVPGENWGPSLYCAVIVKRVDEKTRSKTSINE
DAPD_RHILO      DRATGEIFYGEVPPNSVVVAGSLP--GKPFPNNEPGPGLYCAVIVKRVDAKTRSKTSINE
DAPD_RHIME      DRATGEVMYGEVPPYSVVVAGSMAS-GSTMANGQPAPNLYCAVIVKRVDEKTRSKTGINE
DAPD_SINMW      DRATGEVMYGEVPPYSVVVAGSMPS-GSAMGNGQPAPNLYCAVIVKRVDEKTRSKTGINE
DAPD_CHESB      DRETGQIFYGEVPPYSVVVAGTMP--GKTMANGEPGPNLYCAVIVKRVDEKTRSKTSIND
DAPD_RHIEC      DRATGEVMYGEVPPYSVVVAGSMASANATMANGLPAPHLYCAVIVKRVDEQTRSKTGINE
DAPD_RHIL3      DRATGEVTYGEVPPYSVVVAGSMPSGNATMGNGQPAPHLYCAVIVKRVDEKTRSKTGINE
DAPD_AGRFC      DRATGEITYGEVPPYSVVVAGTMP--GKPFPNGEPGPSLYCAVIVKRVDEKTRSKTGINE
DAPD_BRASB      DRETGETFVGEVPEYAVVVPGALP--GKPMKNGQIGPSTACAVIVKRVDERTRSKTSINE
DAPD_BRASO      DRETGETFVGEVPEYAVVVPGALP--GKPMKNGQIGPSTACAVIVKRVDERTRSKTSINE
DAPD_BRADU      DRDTGEVFIGEVPEYSVVVPGALP--GKPMKNGHIGPSTACAVIVKRVDERTRSKTSINE
DAPD_RHOP5      DRTTGEIFIGEVPEYSVVVPGALP--GKPMANGEPGPATACAVIVKRVDERTRSKTSINE
DAPD_RHOPS      DRETGEVFIGEVPEYAVLVPGALP--GKPLKNGTPGPSTACAVIVKRVDERTRSKTSINE
DAPD_RHOPA      DRETGEVFVGEVPEYAVLVPGTLP--GKPMKNGAPGPATACAVIVKRVDERTRSKTSINE
DAPD_RHOPB      DRDSGEIFVGEVPEYSVVVPGNLP--GRPLKNGQPGPSTACAVIVKRVDERTRSKTSINE
DAPD_NITHX      DRETGEIFMGEVPEYAVVVPGALP--GKPLKNGQPGPSTACAVIVKRVDERTRSKTGINE
DAPD_NITWN      DRTTGEIFMGEVPEYAVVVPGALP--GKPLSNGQLGPSTACAVIVKRVDERTRSKTGINE
DAPD_BARHE      DRTTGEIFIGEVPPYSVVVPGSLP--GKPLPNGEIGPNLYCAVIVKRVDQKTREKTSIND
DAPD_BARQU      DRTTGEVFIGEVPAYSVVVPGSLP--GKPLPNGEVGPNLYCAVIVKRVDQKTREKTSIND
DAPD_BART1      DRTTGEIFIGEVPAYSVVVPGSLP--GKPLPNGEAGPNLYCAVIVKRVDQKTREKTSINE
DAPD_BARBK      DRSTGEVFIGEVPAYSVVVPGSLP--GKPLPNGEAGPNLYCAVIVKRVDQKTREKTSIND
DAPD_PARL1      DRATGEVHIGKVPPYSVVVPGSLP--GKANPDGSPAPSLYCCVIVKTVDAQTRAKTAINE
DAPD_GLUOX      DRATGEIFMGRVPAYSVVVPGTLP------PKEPGMPSLACAVIVKRVDERTRSKTSIND
DAPD_GRABC      DRATGEVLYGRVPAYSVVVPGSLPG--KPLPDGTPGPSLACAVIVKRVDERTRSKTSINE
DAPD_MAGSA      DRETGEIFMGRVPAYSVVVSGTMPG--KPFPDGTPGPGLYCAVIVKRVDERTRSKVGINE
DAPD_RHORT      DRETGEVFMGRVPAYSVVVPGSLPG--KPLPDGTPGPGLACAVIVKRVDERTRSKVSIND
DAPD_MARMM      DRASGEISYGEVPAYSVVVPGALP-------DPKGGPSLYCAVIVKRVDAQTRAKTSIND
DAPD_DINSH      DRETGEVMYGEVPPYSVVVAGSMP--------SKNGVNLYCAVIVKRVDERTRSKTGINE
DAPD_RUEPO      DRETGEVMYGEVPPYSVVVSGSMP--------STGGVSLYCAVIVKRVDERTRSKTGINE
DAPD_ROSDO      DRETGEFTYGEVPAGSVVVAGSMP--------SKNGVNLYCAVIVKKVDAQTRSKTSINE
DAPD_JANSC      DRETGDVMYGEVPSGSVVVAGSLP--------SKNGVNLYCAVIVKRVDERTRSKTSINE
DAPD_RHOS4      DRETGEVMYGEVPAGSVVVAGSMP--------SKGGVNLYCAVIVKRVDAQTRSKTSINE
DAPD_RHOS1      DRETGEVMYGEVPAGSVVVAGSMP--------SKGGVNLYCAVIVKRVDAQTRSKTSINE
DAPD_RHOS5      DRETGEVMYGEVPAGSVVVAGSMP--------SKGGVNLYCAVIVKRVDAQTRSKTSINE
DAPD_PARDP      DRETGEVMYGEVPAGSVVVAGSMP--------SKNGVNLYCAVIVKRVDAQTRSKTSINE
DAPD_NOVAD      DRQTGEVHIGRVPPYAVVVPGAMP--GKPLPDGTPGPSLYCAVIVKTVDAQTRSKTGINE
DAPD_ZYMMO      DRATGEIHMGKVPPYAVVVPGSLP--GKPLPDGRPGPSLYCAVIVKTADERTRSKTSINQ
DAPD_CAUVC      DRKTGAVHIGKVPPYSVVVPGNLP-------DPNGGPGLYCAVIVKTVDAQTRSKTSIND
DAPD_DECAR      DRETGEVTYGRVPPGSVVISGTLP-------KADGKYSLYAAIIVKKVDAQTRSKTSINE
DAPD_UNKP       DRETGEIHYGRVPAGSVVVSGNLP-------SKDGSYSLYCAVIVKKVDAKTRGKVGINE
DAPD_SERP5      DRETGEVHYGRVPAGSVVVSGNLP-------SKDGSYSLYCAVIVKKVDAKTRGKVGINE
DAPD_YERPE      DRETGEVHYGRVPAGSVVVSGNLP-------SKDGSYSLYCAVIVKKVDAKTRSKVGINE
DAPD_YERPA      DRETGEVHYGRVPAGSVVVSGNLP-------SKDGSYSLYCAVIVKKVDAKTRSKVGINE
DAPD_YERP3      DRETGEVHYGRVPAGSVVVSGNLP-------SKDGSYSLYCAVIVKKVDAKTRSKVGINE
DAPD_YERPN      DRETGEVHYGRVPAGSVVVSGNLP-------SKDGSYSLYCAVIVKKVDAKTRSKVGINE
DAPD_YERPP      DRETGEVHYGRVPAGSVVVSGNLP-------SKDGSYSLYCAVIVKKVDAKTRSKVGINE
DAPD_YERPS      DRETGEVHYGRVPAGSVVVSGNLP-------SKDGSYSLYCAVIVKKVDAKTRSKVGINE
DAPD_YERE8      DRETGEIHYGRVPAGSVVVSGNLP-------SKDGSYSLYCAVIVKKVDAKTRGKVGINE
DAPD_SHIFL      DRETGEIHYGRVPAGSVVVSGNLP-------SKDGKYSLYCAVIVKKVDAKTRGKVGINE
DAPD_SHIF8      DRETGEIHYGRVPAGSVVVSGNLP-------SKDGKYSLYCAVIVKKVDAKTRGKVGINE
DAPD_ECO24      DRETGEIHYGRVPAGSVVVSGNLP-------SKDGKYSLYCAVIVKKVDAKTRGKVGINE
DAPD_ECOHS      DRETGEIHYGRVPAGSVVVSGNLP-------SKDGKYSLYCAVIVKKVDAKTRGKVGINE
DAPD_ECOLI      DRETGEIHYGRVPAGSVVVSGNLP-------SKDGKYSLYCAVIVKKVDAKTRGKVGINE
DAPD_ECOLC      DRETGEIHYGRVPAGSVVVSGNLP-------SKDGKYSLYCAVIVKKVDAKTRGKVGINE
DAPD_SHISS      DRETGEIHYGRVPAGSVVVSGNLP-------SKDGKYSLYCAVIVKKVDAKTRGKVGINE
DAPD_ECO57      DRETGDIHYGRVPAGSVVVSGNLP-------SKDGKYSLYCAVIVKKVDAKTRGKVGINE
DAPD_SHIBS      DRETGEIHYGHVPAGSVVVSGNLP-------SKDGKYSLYCAVIVKKVDAKTRGKVGINE
DAPD_ECOK1      DRETGEIHYGRVPAGSVVVSGNLP-------SKDGKYSLYCAVIVKKVDAKTRGKVGINE
DAPD_ECOL5      DRETGEIHYGRVPAGSVVVSGNLP-------SKDGKYSLYCAVIVKKVDAKTRGKVGINE
DAPD_ECOUT      DRETGEIHYGRVPAGSVVVSGNLP-------SKDGKYSLYCAVIVKKVDAKTRGKVGINE
DAPD_ECOL6      DRETGEIHYGRVPAGSVVVSGNLP-------SKDGKYSLYCAVIVKKVDAKTRGKVGINE
DAPD_SHIDS      DRETGEVHYGRVPAGSVVVSGNLP-------SKDGKYSLYCAVIVKKVDAKTRGKVGINE
DAPD_CITK8      DRETGEIHYGRVPAGSVVVSGNLP-------SKDGKYSLYCAVIVKKVDAKTRGKVGINE
DAPD_ENT38      DRETGEVHYGRVPAGSVVVSGNLP-------SKDGKYSLYCAVIVKKVDAKTRSKVGINE
DAPD_SALAR      DRETGEVHYGRVPAGSVVVSGNLP-------SKDGKYSLYCAVIVKKVDAKTRGKVGINE
DAPD_SALTY      DRETGEVHYGRVPAGSVVVSGNLP-------SKDGKYSLYCAVIVKKVDAKTRGKVGINE
DAPD_SALPA      DRETGEVHYGRVPAGSVVVSGNLP-------SKDGKYSLYCAVIVKKVDAKTRGKVGINE
DAPD_SALPB      DRETGEVHYGRVPAGSVVVSGNLP-------SKDGKYSLYCAVIVKKVDAKTRGKVGINE
DAPD_SALCH      DRETGEVHYGRVPAGSVVVSGNLP-------SKDGKYSLYCAVIVKKVDAKTRGKVGINE
DAPD_SALTI      DRETGEVHYGRVPAGSVVVSGNLP-------SKDGKYSLYCAVIVKKVDAKTRGKVGINE
DAPD_KLEP7      DRETGEVFYGRVPAGSVVVSGNLP-------SKDGKYSLYCAVIVKKVDAKTRGKVGINE
DAPD_CROS8      DRETGEVFYGRVPAGSVVVSGNLP-------SKDGSYSLYCAVIVKKVDAKTRGKVGINE
DAPD_PECAS      DRETGEIHYGRVPAGSVVVSGNLP-------SKDGSHSMYCAIIVKKVDAKTRGKVGINE
DAPD_PHOLL      DRETGEIHYGRVPAGSVVVSGNLP-------SKDGSYSLYCAVIVKKVDAKTQGKVGINE
DAPD_SODGM      DRETGEVHYGRVPAGSVVVSGNLP-------SKDGRYSLYCAVIVKKVDAKTRGKVGINE
DAPD_SHEAM      DRETGEIHYGRVPAGSVVVSGTLP-------SSCGKYNLYAAIIVKKVDEKTRGKVGINE
DAPD_SHESH      DRETGEVHYGRVPAGSVVVSGTLP-------SKCGTYNLYAAIIVKKVDAKTRGKVGINE
DAPD_SHELP      DRETGEIHYGRVPAGSVVVSGTLP-------SQCGKYNLYAAIIVKKVDAKTRGKVGINE
DAPD_SHEHH      DRETGEVHYGRVPAGSVVVAGNLP-------SKCGTYSLYAAIIVKKVDEKTRGKVGINE
DAPD_SHEPA      DRETGEVHYGRVPAGSVVVAGNLP-------SKCGTYSLYAAIIVKKVDAKTRGKVGINE
DAPD_SHEB5      DRETGEVHYGRVPAGSVVVSGNLP-------SACGKYSLYAAIIVKKVDAKTRGKVGINE
DAPD_SHEB8      DRETGEVHYGRVPAGSVVVSGNLP-------SACGKYSLYAAIIVKKVDAKTRGKVGINE
DAPD_SHEB9      DRETGEVHYGRVPAGSVVVSGNLP-------SACGKYSLYAAIIVKKVDAKTRGKVGINE
DAPD_SHEPC      DRETGEVHYGRVPAGSVVVSGNLP-------SACGKYSLYAAIIVKKVDAKTRGKVGINE
DAPD_SHESW      DRETGEVHYGRVPAGSVVVSGNLP-------SACGKYSLYAAIIVKKVDAKTRGKVGINE
DAPD_SHESA      DRETGEIHYGRVPAGSVVVSGNLP-------SACGKYSLYAAIIVKKVDAKTRGKVGINE
DAPD_SHESM      DRETGEIHYGRVPAGSVVVSGNLP-------SACGKYSLYAAIIVKKVDAKTRGKVGINE
DAPD_SHESR      DRETGEIHYGRVPAGSVVVSGNLP-------SACGKYSLYAAIIVKKVDAKTRGKVGINE
DAPD_SHEON      DRETGEVHYGRVPAGSVVVSGNLP-------SACGKYSLYAAIIVKKVDAKTRSKVGINE
DAPD_SHEDO      DRETGEVHYGRVPAGSVVVSGNLP-------SACGKYSLYAAIIVKKVDAKTRAKVGINE
DAPD_SHEFN      DRETGEVHYGRVPAGSVVVSGNLP-------SACGTYSLYAAIIVKKVDAKTRGKVGINE
DAPD_ACTPL      DRETGEIHYGRVPAGSVVVSGSLP-------SKCGKYSLYCAVIVKKVDAKTLGKVGINE
DAPD_ACTP2      DRETGEIHYGRVPAGSVVVSGSLP-------SKCGKYSLYCAVIVKKVDAKTLGKVGINE
DAPD_HAEIN      DRETGEIHYGRVPAGSVVVSGSLP-------SKCGKYSLYCAVIVKKVDAKTLGKVGINE
DAPD_HAEIE      DRETGEIHYGRVPAGSVVVSGSLP-------SKCGKYSLYCAVIVKKVDAKTLGKVGINE
DAPD_HAEI8      DRETGEIHYGRVPAGSVVVSGSLP-------SKCGKYSLYCAVIVKKVDAKTLGKVGINE
DAPD_HAEDU      DRETGEIHYGRVPAGSVVVSGSLP-------SKCGKYSLYCAVIVKKVDAKTLGKVGINE
DAPD_ACTSZ      DRETGEIHYGRVPAGSVVVSGSLP-------SKDGKYSLYCAVIVKKVDAKTLGKVGINE
DAPD_MANSM      DRETGEVHYGRVPAGSVVVSGSLP-------SKDGSHSLYCAVIVKKVDAKTLGKVGLNE
DAPD_PASMU      DRETGEVTYGRVPAGSVVVSGSLP-------SKCGKYSLYCAVIVKKVDAKTLGKVGINE
DAPD_AERHH      DRETGEIHYGRVPAGSVVVSGSLP-------SKCGKYSLYAAVIVKKVDAKTRAKVGINA
DAPD_AERS4      DRETGEIHYGRVPAGSVVVSGSLP-------SKCGKYSLYAAVIVKKVDAKTRAKVGINA
DAPD_NITEU      NRETGEITYGRIPPGSVVVSGNLP-------AENGRYSLYCAVIVKQVDAKTRSKTGINE
DAPD_NITEC      NRETGEVTYGRIPSGSVVVSGSLP-------ADNGRYSLYCAVIVKQVDAKTRSKTGINE
DAPD_NITMU      NRETGEISYGRIPPGSVVVSGSLP-------SADGKYSLYCAVIVKQVDAKTRAKTGINE
DAPD_HAES1      DRETGEIFYGRVPAGSVVVSGSLP-------SKCGKYNLYCAVIVKKVDAKTLGKVGINE
DAPD_HISS2      DRETGEIFYGRVPAGSVVVSGSLP-------SKCGKYNLYCAVIVKKVDAKTLGKVGINE
DAPD_METFK      DRETGEIHYGRVPTGSVVVSGNLP-------SKDGSYSLYCAVIVKKVDEKTLGKVGINE
DAPD_THIDA      DRETGEIHYGRVPAGSVVVSGNLP-------SKDGSYSLYCAVIVKKVDAKTLSKVGINE
DAPD_ALKEH      NRETGEVTYGRVPKGAVVVPGSLP-------AKDGSHSLYCAVIIKQVDAQTRSKVGINE
DAPD_METCA      NRMTGEISYGRVPAGSVVVSGNLP-------ARDGSHSLYCAVIIKQVDEKTRGKVGINE
DAPD_NITOC      HRETGTISYGRVPAGSVVVPGNLP-------SQDGKYSLYCAIIVKQVDERTRSKVGINE
DAPD_COLP3      DRETGEVHYGRVPAGSVVVPGNLP-------SACGTYSLYAAIIVKKVDAKTLAKVGINE
DAPD_PSEHT      DRETGEIHYGRVPAGAVVVPGALP-------SKDGSHSLYAAIIVKKVDQQTREKVGINA
DAPD_IDILO      DRENDRILYGRVPSGSVVVPGSLP-------SANGTHSLYAAIIVKRVDAKTRAKVGINA
DAPD_NEIM0      DRTTGEIYQGRVPTGSVVVSGSMP-------SKDGSHSLYCAVIVKRVDAQTRAKTSVNE
DAPD_NEIMF      DRTTGEIYQGRVPTGSVVVSGSMP-------SKDGSHSLYCAVIVKRVDAQTRAKTSVNE
DAPD_NEIMB      DRTTGEIYQGRVPAGSVVVSGSMP-------SKDGSHSLYCAVIVKRVDAQTRAKTSVNE
DAPD_NEIMA      DRTTGEIYQGRVPAGSVVVSGSMP-------SKDGSHSLYCAVIVKRVDAQTRAKTSVNE
DAPD_NEIG1      DRTTGEIYQGRVPAGSVVVSGSLP-------SKDGSHSLYCAVIVKRVDAQTRAKTSVNE
DAPD_CHRVO      DRETGEVMYGRVPPGSVVVSGNLP-------SKDGSHSLYCAVIVKKVDAQTRSKTSINE
DAPD_LEGPA      NRITGEVSYGRIPAGSVVVAGNLP-------SHDGSHSLYCAVIVKQVDEKTRAKVSIND
DAPD_LEGPH      NRITGEVSYGRIPAGSVVVAGNLP-------SHDGSHSLYCAVIVKQVDEKTRAKVSIND
DAPD_LEGPC      NRITGEVSYGRIPAGSVVVAGNLP-------SHDGSHSLYCAVIVKQVDEKTRAKVSIND
DAPD_LEGPL      NRITGEVSYGRIPAGSVVVAGNLP-------SHDGSHSLYCAVIVKQVDEKTRAKVSIND
DAPD_XYLFA      NRATGEISYGYVPPYSVVVSGQLP-------AKDGTHSLYCAVIVKQVDEKTRAKTSINE
DAPD_XYLFT      NRATGEISYGYVPPYSVVVSGQLP-------AKDGTHSLYCAVIVKQVDEKTRAKTSINE
DAPD_WOLPM      DRETSKVFYGEVPPYSVVVPGSIP------SKNN--ISTYCAVIVKKVDEKTRSKISINE
DAPD_WOLTR      DRETNKVFYGEVPPYSVVVPGSTL------SANN--ISIYCAIIVKKVDEKTRQKTSINE
DAPD_WIGBR      DSINNKIYYGRIPKKSVVIPGSLP------SKNNR-FNINCAIIIKKPDHETKRKIKMNS
DAPD_EHRRG      DRTSGEVFFGRVPAYSVVVPGSYS------SGNV---SIYCAIIVKKVDQNTRNKVSINE
DAPD_RICCN      YRDTGEIIYGRIPAYSVVVPGVLP------AKEAGKPGLYCVVIVKQVDKTTRAKVSIND
DAPD_RICFE      YRDTGEIIYGRIPAYSVVVPGVLP------AKEAGKPGLYCVVIIKQVDKATRAKVSIND
DAPD_RICRS      YRDTGEIIYGRIPAYSVVVPGVLP------AKETGKPGLYCVVIVKQVDKTTRAKVRIND
DAPD_RICAH      YRDTGEIIYGRIPAYSVVVPGVLP------AKEAGKPGLYCAVIIKQVDKTTRSKVSIND
DAPD_RICPR      YRDTGEIIYGRIPAYSVVVPGILP------PPEVGKPGLYCVVIVKQVDKTTRGKVSIND
DAPD_RICTY      YRDTGKIIYGRIPAYSVVVPGVLP------SPEAGKPGLYCVVIVKQVDKTTRAKVSIND
DAPD_RICBR      YRDSGEIIYGIVPACSVVVPGVLP------NKEADKPGLYCAVIVKQVDKNTRAKVSINE
DAPD_PELUB      YRETGEVIYGKIPPYSVIVPGSIP------SKDGKGPALYCAVIIKQVDEKTRSKTSIND
                   .     * :*  :*::.*                   . :*:*  :  *  .  :* 

DAPD_COXBU      LLREG------
DAPD_COXBR      LLREG------
DAPD_COXBN      LLREG------
DAPD_BLOFL      LLREYCN----
DAPD_BLOPB      LLRDI------
DAPD_BUCAI      LLRNIK-----
DAPD_BUCAP      LLRDK------
DAPD_BUCBP      LLREITE----
DAPD_ACIAC      LLRD-------
DAPD_ACISJ      LLRD-------
DAPD_RHOFT      LLRD-------
DAPD_BORBR      LLRA-------
DAPD_BORPE      LLRA-------
DAPD_BORPA      LLRA-------
DAPD_BORA1      LLRA-------
DAPD_AZOSB      LLRGA------
DAPD_AROAE      LLRGA------
DAPD_BURCA      LLRGD------
DAPD_BURCH      LLRGD------
DAPD_BURL3      LLRGD------
DAPD_BURVG      LLRGD------
DAPD_BURCM      LLRGD------
DAPD_PARXL      LLRGD------
DAPD_BURMA      LLRGD------
DAPD_BURP6      LLRGD------
DAPD_BURM9      LLRGD------
DAPD_BURM7      LLRGD------
DAPD_BURMS      LLRGD------
DAPD_BURPS      LLRGD------
DAPD_BURP0      LLRGD------
DAPD_CUPNH      LLRGD------
DAPD_CUPPJ      LLRGD------
DAPD_CUPMC      LLRD-------
DAPD_RALSO      LLRGD------
DAPD_HERAR      LLRD-------
DAPD_JANMA      LLRD-------
DAPD_POLAQ      LLRD-------
DAPD_ACIBA      LLRAD------
DAPD_ACIBT      LLRAD------
DAPD_ACIAD      LLRAD------
DAPD_PSYA2      LLRLA------
DAPD_PSYCK      LLRLA------
DAPD_PSYWF      LLRLA------
DAPD_BRUAB      LLRD-------
DAPD_BRUA2      LLRD-------
DAPD_BRUC2      LLRD-------
DAPD_BRUME      LLRD-------
DAPD_BRUO2      LLRD-------
DAPD_BRUSU      LLRD-------
DAPD_BRUSI      LLRD-------
DAPD_OCHA4      LLRD-------
DAPD_RHILO      LLRD-------
DAPD_RHIME      LLRD-------
DAPD_SINMW      LLRD-------
DAPD_CHESB      LLRD-------
DAPD_RHIEC      LLRD-------
DAPD_RHIL3      LLRD-------
DAPD_AGRFC      LLRD-------
DAPD_BRASB      LLRD-------
DAPD_BRASO      LLRD-------
DAPD_BRADU      LLRD-------
DAPD_RHOP5      LLRD-------
DAPD_RHOPS      LLRD-------
DAPD_RHOPA      LLRD-------
DAPD_RHOPB      LLRD-------
DAPD_NITHX      LLRD-------
DAPD_NITWN      LLRD-------
DAPD_BARHE      LLRD-------
DAPD_BARQU      LLRD-------
DAPD_BART1      LLRDETQC---
DAPD_BARBK      LLRD-------
DAPD_PARL1      LLRD-------
DAPD_GLUOX      LLRD-------
DAPD_GRABC      LLRA-------
DAPD_MAGSA      LLRD-------
DAPD_RHORT      LLRDTPR----
DAPD_MARMM      LLR--------
DAPD_DINSH      LLRD-------
DAPD_RUEPO      LLRD-------
DAPD_ROSDO      LLRD-------
DAPD_JANSC      LLRD-------
DAPD_RHOS4      LLRD-------
DAPD_RHOS1      LLRD-------
DAPD_RHOS5      LLRD-------
DAPD_PARDP      LLRD-------
DAPD_NOVAD      LLRD-------
DAPD_ZYMMO      LLREAQN----
DAPD_CAUVC      LLRD-------
DAPD_DECAR      LLRP-------
DAPD_UNKP       LLRTID-----
DAPD_SERP5      LLRTID-----
DAPD_YERPE      LLRTID-----
DAPD_YERPA      LLRTID-----
DAPD_YERP3      LLRTID-----
DAPD_YERPN      LLRTID-----
DAPD_YERPP      LLRTID-----
DAPD_YERPS      LLRTID-----
DAPD_YERE8      LLRTID-----
DAPD_SHIFL      LLRTID-----
DAPD_SHIF8      LLRTID-----
DAPD_ECO24      LLRTID-----
DAPD_ECOHS      LLRTID-----
DAPD_ECOLI      LLRTID-----
DAPD_ECOLC      LLRTID-----
DAPD_SHISS      LLRTID-----
DAPD_ECO57      LLRTID-----
DAPD_SHIBS      LLRTID-----
DAPD_ECOK1      LLRTID-----
DAPD_ECOL5      LLRTID-----
DAPD_ECOUT      LLRTID-----
DAPD_ECOL6      LLRTID-----
DAPD_SHIDS      LLRTID-----
DAPD_CITK8      LLRTID-----
DAPD_ENT38      LLRTID-----
DAPD_SALAR      LLRTID-----
DAPD_SALTY      LLRTID-----
DAPD_SALPA      LLRTID-----
DAPD_SALPB      LLRTID-----
DAPD_SALCH      LLRTID-----
DAPD_SALTI      LLRTID-----
DAPD_KLEP7      LLRTID-----
DAPD_CROS8      LLRTID-----
DAPD_PECAS      LLRSID-----
DAPD_PHOLL      LLRSID-----
DAPD_SODGM      LLRTID-----
DAPD_SHEAM      LLRIVD-----
DAPD_SHESH      LLRIVD-----
DAPD_SHELP      LLRIVD-----
DAPD_SHEHH      LLRIVD-----
DAPD_SHEPA      LLRIVD-----
DAPD_SHEB5      LLRIVD-----
DAPD_SHEB8      LLRIVD-----
DAPD_SHEB9      LLRIVD-----
DAPD_SHEPC      LLRIVD-----
DAPD_SHESW      LLRIVD-----
DAPD_SHESA      LLRIVD-----
DAPD_SHESM      LLRIVD-----
DAPD_SHESR      LLRIVD-----
DAPD_SHEON      LLRIVD-----
DAPD_SHEDO      LLRIVD-----
DAPD_SHEFN      LLRIVD-----
DAPD_ACTPL      LLRTIEE----
DAPD_ACTP2      LLRTIEE----
DAPD_HAEIN      LLRSIEE----
DAPD_HAEIE      LLRSIEE----
DAPD_HAEI8      LLRSIEE----
DAPD_HAEDU      LLRTIEE----
DAPD_ACTSZ      LLRSIEE----
DAPD_MANSM      LLRTIEE----
DAPD_PASMU      LLRTIDE----
DAPD_AERHH      LLRSIDE----
DAPD_AERS4      LLRSIDE----
DAPD_NITEU      LLRGI------
DAPD_NITEC      LLRGI------
DAPD_NITMU      LLRGI------
DAPD_HAES1      LLRTIE-----
DAPD_HISS2      LLRTIE-----
DAPD_METFK      LLRGI------
DAPD_THIDA      LLRGI------
DAPD_ALKEH      LLRP-------
DAPD_METCA      LLRD-------
DAPD_NITOC      LLRNI------
DAPD_COLP3      LLRAVSEE---
DAPD_PSEHT      LLRSIDDE---
DAPD_IDILO      LLRSAE-----
DAPD_NEIM0      LLRGI------
DAPD_NEIMF      LLRGI------
DAPD_NEIMB      LLRGI------
DAPD_NEIMA      LLRGI------
DAPD_NEIG1      LLRGI------
DAPD_CHRVO      LLRGV------
DAPD_LEGPA      LLRANQDD---
DAPD_LEGPH      LLRANQDD---
DAPD_LEGPC      LLRANQDD---
DAPD_LEGPL      LLRANQDD---
DAPD_XYLFA      LLRGFAD----
DAPD_XYLFT      LLRGLAD----
DAPD_WOLPM      ILRD-------
DAPD_WOLTR      ILRD-------
DAPD_WIGBR      ILHLNN-----
DAPD_EHRRG      LLRDNYAATSI
DAPD_RICCN      LLR--------
DAPD_RICFE      LLR--------
DAPD_RICRS      LLR--------
DAPD_RICAH      LLR--------
DAPD_RICPR      LLR--------
DAPD_RICTY      LLR--------
DAPD_RICBR      LLRS-------
DAPD_PELUB      LLRD-------
                :*: