CLUSTAL format seed alignment for MF_00812

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TPMT_CANLF            MDKTRTFLDVKEYPDTEVQKNRVLTLEEWQEKWVSR--RIGFHQEQGHKLLKKHLDTFLK
TPMT_RABIT            MDDARTLLDIKEYPDTEVQKNRVLTLEEWQDKWVSH--KIGFHQEQGHKLLKKHLDAFLK
TPMT_GORGO            MDGTRTSLDIEEYSDTEVQKNQVLTLEEWQDKWVNG--KTAFHQEQGHQLLKKHLDTFLK
TPMT_HUMAN            MDGTRTSLDIEEYSDTEVQKNQVLTLEEWQDKWVNG--KTAFHQEQGHQLLKKHLDTFLK
TPMT_PANTR            MDGTRTSLDIEEYSDTEVQKNQVLTLEEWQDKWVNG--KTAFHQEQGHQLLKKHLDTFLK
TPMT_HORSE            MDGTRTVLDIKEYSDSEVQKNRVLTLEEWQGKWVTG--KTIFHQEQGHQLLKKHLDAFLK
TPMT_BOVIN            MGDSRALLDSEEYPNTEAQKDRVLTLEEWQEKWVNH--KTGFHQEQGHQLLKKYLDTFLK
TPMT_MOUSE            -----MSLDMKEHPDAEVQKNQVLTLEDWKEKWVTR--HISFHQEQGHQLLKKHLDTFLK
TPMT_RAT              -----MSLGIKEHPDAEVQKNRVLTLDDWQDKWVTR--HIAFHQEQGHQLLKKHFDTFLK
TPMT_DANRE            ---------------MSAQADRVMDLSEWENRWQEG--RTGFHRSDVHNLLKANVDKLIC
A9B4X2_HERA2          -----------------------MEATFWINSWQQGGSATSFHRRDIHPYVEHFATPEFL
D0LKG1_HALO1          -----------------------MEAQFWIDSWREGGSKTSFHRRDIHPYVLRHLPPSHL
D2QUH2_SPILD          -----------------------MEKAFWMNSWELEGPYTSFHRKDIHPYLIKHLPPFSL
C6WH21_ACTMD          -----------------------MEEEFWVDSWAEGGSRTSFHLRRVHPHAELLAERVPL
F8JC21_HYPSM          -----------------------MEHSFWEERWQRG-EI-GFHQPHIHAQLQQFWPGLSL
D8JWM2_HYPDA          -----------------------MEKAFWTERWKRR-DI-GFHQPHVHEQLTRFWPTLNL
TPMT_METCA            -----------------------MDPDFWHERWRQK-QT-GFHQTQVNPLLETFWPRCVG
D3RTH2_ALLVD          -----------------------MDTQFWLDRWDRR-ET-GWHLGEINSHLQEHWPKLGL
F8GJR4_NITSI          -----------------------MQKEYWLDRWERK-DT-GFHQNEINPYLSQFWQSLQL
D5CQZ6_SIDLE          -----------------------MKKDFWLERWERA-ET-GFHQNEINPYLQRHWQELHH
G4SVA1_META2          -----------------------MHQEFWLERWQQN-QI-GFHSESINPHLEQYWPALHI
Q31ES3_HYDCU          -----------------------MEADFWHEMWRSE-QV-GFHQSNVNAFLKKHWKQLNL
E4PN63_MARAH          -----------------------MEHEFWHERWAKK-EI-GFHEGTVNQYLHDHWPELAG
TPMT_VIBVU            ----------------------MRDAEFWHNKWASN-QI-GFHLEDVNPLLTRFWSALAP
TPMT_VIBVY            ----------------------MRDAEFWHNKWASN-QI-GFHLEDVNPLLTRFWSALAP
TPMT_VIBPA            ----------------------MRDQEFWHSKWASN-QI-GFHLEDVNPLLPAYWHHANP
F0LV54_VIBFN          ----------------------MNDPEFWHAKWASN-QI-GFHLTDVNTLLSDHWHETQP
TPMT_VIBCH            ----------------------MRDPEFWHNKWAAN-QI-GFHLEDVNPLLIRFWSDLAP
TPMT_ALIF1            -----------------------MEHEFWQKKWASN-VI-GFHLPDTNPILTQYWSALEP
TPMT_PHOPR            -----------------------MDAEFWHSRWAEN-RI-GFHLDDTNPVLTQYWPMVKA
A4SM27_AERS4          -----------------------MEAAFWHQRWEEN-RI-GFHQADFNRWLQSWWSAQQ-
TPMT_SHEON            -----------------------MEPGFWHEKWQQQ-QI-GFHQQDVNPFLVTYWHQLAL
TPMT_SHEB9            -----------------------MEPGFWHEKWHQQ-QI-GFHQQDINPFLVKYWQKLGL
D4ZCC8_SHEVD          -----------------------MEPSFWHDKWDAK-HL-GFHLGEINALLIKYWPELAL
E1SLI2_FERBD          -----------------------MEAAFWHDKWERG-IT-GFHLDHINPHLAEHWPQLNL
TPMT_PSEPK            -----------------------MEPAFWQQRWADN-QI-GFHQAQVNPYLQTYWPQLQL
TPMT_PSEP1            -----------------------MEPAFWQQRWADN-QI-GFHQAQVNPYLQTYWPQLQL
TPMT_PSEF5            -----------------------MQADFWQKRWERD-QI-GFHLAEVNPYLQQYWPALGL
TPMT_PSEAE            -----------------------MQADFWHARWANN-QI-GFHLDEINPYLMRHLSRLRL
F6AH35_PSEF1          -----------------------MQESFWLQRWHSN-QI-GFHARQVNGQLQRHWTTVAG
A0A1G3DEK4_9GAMM      -----------------------MHQNFWQERWARN-EI-GFHLEDVHPGLRRHWPRLAL
TPMT_PSESJ            -----------------------MKADFWLQRWSAG-QI-GFHQSEVNKDLQQYWSSLNV
TPMT_PSESM            -----------------------MHADFWQQRWRAG-QI-GFHQAQVNQDLQQYWPRLGL
TPMT_BORBR            -----------------------MDADFWLDRWREG-RT-HFHQTRVTPLLQKYWPALDV
TPMT_BORPA            -----------------------MDADFWLDRWREG-RT-HFHQTRVTPLLQKYWPALDV
TPMT_BORPE            -----------------------MDADFWLDRWREG-RT-HFHQTRVTPLLQKYWPTLDV
F4GSM8_PUSST          -----------------------MEPDFWLARWRDE-QT-GFHQQRVTPLLQKYWPSLER
TPMT_XANAC            -----------------------MDTNFWLERWQLG-HT-GFHQQEVLPLLQKHWHALDL
TPMT_XANCP            -----------------------MDTDFWLQRWQDG-QT-GFHQDEVMPLLQKHWPALQL
E6WR26_PSEUU          -----------------------MEPDFWLQRWREG-RT-GFHREAVMPLLEKHWPALGV
TPMT_YARLI            -----------------------MKPEFWQDRWNKD-QI-GWHQKSANPHLVKYWPTLNI
E1V6A1_HALED          ------------------------MVEDWRQRWQQG-RI-GFHREAVHPALERHWPGLGV
TPMT_PSEU5            --------------------MTDHDNQRWLQLWRER-RT-DFHQHGVNLLLSRFWPAFAP
F9ZXQ9_METMM          --------------------MQSRDNVLWLQCWRDR-QI-DFHQQTINEFLPRFWPRLDL
Q47IR0_DECAR          --------------------MSNPDNALWQQCWRDR-NI-EFHQKTVNQLLIRYWHSLNL
A0L4Z7_MAGMM          --------------------MSSLDSDLWLQAWQDD-HICDFHQLRVNRLLMKHWPLLHM
TPMT_LEGPA            ---------------------MNKGQYFWNELWCEG-RI-SFHKEEVNPDLIAYVSSLNI
TPMT_LEGPC            ---------------------MNKGQYFWNELWCEG-RI-SFHKEEVNPDLIAYVSSLNT
TPMT_LEGPL            ---------------------MNKGQYFWNELWCEG-RI-SFHKKEVNPDLIAYVSSLNI
TPMT_LEGPH            ---------------------MNKGQYFWNELWCEG-RI-SFHKEEVNPDLIAYISSLNI
F2JUT9_MARM1          ----------------------MITNEFWLDRWNTG-RI-GFHENEVNQSLIQYWPNL--
A6VV15_MARMS          ----------------------MITNEFWLDRWKTG-RI-GFHQEGVNPKLTEFWPAL--
D7DKZ7_METV0          -------------------MRKDMKHEFWHQKWEKN-EI-GFHLADANPLLVKHFSTLNL
Q04UF5_LEPBJ          -----------------------MDTNFWHQKWEKN-EI-AFHESEVNPLLVENIDKLSL
F8GGU4_NITSI          -----------------------MEASFWHQKWERG-DI-GFHESEVNPFLIEHFEELNL
C6X732_METGS          -----------------------MEASFWHQRWERN-EI-GFHEASANALLVKHLPSLSL
F2G5W5_ALTMD          -----------------------MEHSFWHSKWQKN-EI-GFHEPEGNALLVKHAHVLLS
F5ZD75_ALTNA          -----------------------MEHDFWHSKWHKN-EI-GFHEPEGNALLVKYADTLLA
G2I337_KOMMN          -----------------------MNSTFWQAKWQRN-EI-GFHEHRPNVLLVRNFPALCL
C7JHY1_ACEP3          -----------------------MDAQFWNMKWQKN-QI-GFHLAAVNPLLVKYFPVMGL
D7A4L6_STAND          -----------------------MEKQFWHDKWERN-EI-AFHGGEPHPLLVHNLPALGL
Q2SMC8_HAHCH          -----------------------MDANFWHERWAEN-SI-AFHQCEANPLLVAHFNRLDL
B1KQV0_SHEWM          -----------------------MKASFWHERWERG-EI-AFHEQEINCFLAEHLSRLGV
Q15VP2_PSEA6          -----------------------MQASYWHEKWQKG-ET-AFHQFKGSPLLKAHFDELGL
G4QNZ9_GLANF          -----------------------MEPDFWHRRWKKN-EI-GFHENEGNTLLKAYFEQWQL
TPMT_ACIAD            -----------------------MQHEFWHQRWQEN-RI-GFHQFTPSPLLVDYFNELGL
TPMT_GLUOX            -------------------MDAKSNAVFWQEKWERG-ET-GFHEPQANPLLTRHIAALDL
A5WC52_PSYWF          -----------------------MNPEFWQEKWQNP-QP-GFHQAKPNQLLVSYFKSLSL
Q1QB39_PSYCK          -----------------------MTPEFWKNAWQKS-QT-NFTQKKPNPMLVHHFKALNT
C7RA80_KANKD          -----------------------MDFEFWDNCWQRE--SQPFHLAEAHTFLVKYVNKLFN
E1X1S8_HALMS          -----------------------MEREFWENAWDEN--NIGFHMSETNQFLKYTFDEGIV
TPMT_FRATT            -----------------MNKLETNNNQYWLDRWQND--DVGFCQESPNEFLVKHFSKLNI
                                                  *   *        :                  

TPMT_CANLF            GEN-----GLRVFFPLCGKAVEMKWFADRGHSVVGVEISELGIREFFAEQNLSYTEEPIV
TPMT_RABIT            GES-----GLRVFFPLCGKAVEMKWFADRGHSVVGVEISELGIREFFSEQNLSYSEEPIT
TPMT_GORGO            GKS-----GLRVFFPLCGKAVEMKWFADRGHSVVGVEISELGIQEFFTEQNLSYSEEPIT
TPMT_HUMAN            GKS-----GLRVFFPLCGKAVEMKWFADRGHSVVGVEISELGIQEFFTEQNLSYSEEPIT
TPMT_PANTR            GKS-----GLRVFFPLCGKAVEMKWFADRGHSVVGVEISELGIREFFTEQNLSYSEEPIT
TPMT_HORSE            GES-----GLKVFFPLCGKAVEMKWFADRGHSVVGVEISELGIREFFTEQNLSYSEEPII
TPMT_BOVIN            GEK-----ALRVFFPLCGKAVEMKWFADRGHSVVGVEISELGIRDFFTEQNLSYSEEPIM
TPMT_MOUSE            GQS-----GLRVFFPLCGKAIEMKWFADRGHTVVGVEISEIGIREFFAEQNLSYTEEPLA
TPMT_RAT              GQS-----GLRVFFPLCGKAIEMKWFADRGHTVVGVEISEIGIREFFAEQNLSYTEEPLT
TPMT_DANRE            GRR-----EVRFFFPLCGKAVDMKWLADMGHTVVGVEFSEKGIKEFSQEQNLEYNEEAVA
A9B4X2_HERA2          Q-------GKRVLVPLCGKTNDLRWFSQYAEAVIGVELVTTAIEQFFAEQELDYVQPDP-
D0LKG1_HALO1          R-------GKRVLVPLCGKTLDMGYFREHAAHVVGVELIEPAIHQFFSEQQLHYSREDQG
D2QUH2_SPILD          E-------GKSVFVPLCGKSVDMIYFSHFANRVIGVEIVEKAVLQFFSENQLTYRRIGD-
C6WH21_ACTMD          E-------GRVVLVPLCGKSVDLLFFAERAERVVGVELVGRAVEEFFAENGLSPTEVDE-
F8JC21_HYPSM          PK------GSIVFVPLSGKTRDMVWLAEQGHKVIGAELSELAVRDFFKECGLTPAVTAS-
D8JWM2_HYPDA          PV------ASAVFVPLAGKSCDMVWLATQGHRVIGVELSDVAVREFFKDGGQTPEIRSE-
TPMT_METCA            PA------RPRVFVPLCGKSLDMVWLRNRGHSVLGNELSPIAVDEFFRENGLSAVTTPL-
D3RTH2_ALLVD          AH------ETRVFVPLCGKTLDLVWLVSRGHRVVGVELSRLGIEAFLAEHRLEPRITEQ-
F8GJR4_NITSI          AP------GSAVLVPLCGKSRDMLWLHQQGHTVLGVELSIVAAQAFFTENGLTPQCSVH-
D5CQZ6_SIDLE          AQ------GGEVFVPLCGKSLDMIWLREQGCSPLGVEISPIAVQSFYKENGYSPELVAG-
G4SVA1_META2          EA------GSRVFVPLCGKSNDILWLLAQNYRVIGVELSPLAVNAFFTENKVPATAGRK-
Q31ES3_HYDCU          IG------HEQVFVPLCGKSLDMLWLQQQGHAVLGVELSEQALQAFVTEHDLQASLVQY-
E4PN63_MARAH          KG------TDAVFVPLCGKAHDMWWLHDRGHPIIGVELSELACKDFFEEAGEKAKVHPG-
TPMT_VIBVU            KR------EETVLVPLCGKTEDLAWLATKHDHVEGAELSLIAVRSFFAEHFYTPTVTPI-
TPMT_VIBVY            KR------EETVLVPLCGKTEDLAWLATKHDHVEGAELSLIAVRSFFAEHFYTPTVTPI-
TPMT_VIBPA            KR------EDKVLVPLCGKSEDLVWLATKHDSVEGVELSQIAVRSFFAEHFYTPTVTPI-
F0LV54_VIBFN          KR------DERVLVPLCGKSEDLIWLAEKHDDVQGVELSPIAVRAFFAEHFYTPTVTQI-
TPMT_VIBCH            KR------SEKVLVPLCGKSEDLIWLANQHDSVQGVELSQIAVRSFFAEHFYTPTVTRL-
TPMT_ALIF1            KR------NETVFVPLCGKSMDLDWLAERHNSVTGVELSQIAVRAFFAERLYTPTVTQL-
TPMT_PHOPR            TR------DDRVLVPMCGKSVDLVWLAQKHNNVIGIELSDIAVRSFFAEHLYTPMVTSI-
A4SM27_AERS4          -Q------DEPVLVPLCGKSRDMLWLNGLGHPIDGFELSALAIEQFFSENQLTDTLSEL-
TPMT_SHEON            PA------DAKIFVPLCGKSLDMCFLAEQGHQVIGCELNELAVQQFFSDNQLPMQQSAE-
TPMT_SHEB9            PA------DTQVFVPLCGKSLDMCFLAEQGHQVIGCELNELAVQQFFSDIQLEMTQTTV-
D4ZCC8_SHEVD          GSNYS-GSDINVFVPLCGKSLDMCYLAEQGHNVLACELSQKAVEQFFTENNLPHQIEQL-
E1SLI2_FERBD          PG------GTPVLVPLCGKSLDLAYLAGEGHPVLGVELNALAVDALFASLGQTPTVSQE-
TPMT_PSEPK            AP------GSRVLVPLCGKSLDLAWLAGQGHRVLGVELSRRAVEDFFREHGLEAEVRQ--
TPMT_PSEP1            AP------GSRVLVPLCGKSLDLAWLAGQGHRVLGVELSRRAVEDFFREHGLEAEVRQ--
TPMT_PSEF5            AA------QSRVLVPLCGKSLDLIWLADQGFEVLGIELAEKAVEDFFREHQLQPQISQ--
TPMT_PSEAE            QA------GEQILVPLCGKTLDLAWLAAQGLEVLGVELSEKAVSDFFEEHDLHPEIDQ--
F6AH35_PSEF1          SS------DAAVLVPLCGKSLDLAWLAAQGHRVVGVELAEVAVAAFFAEQGVEPVITQ--
A0A1G3DEK4_9GAMM      PE------DAAVLVPLCGKSLDLAWLAGQGHRVLGVELSQKAVEAFFAEQGLEAEISQ--
TPMT_PSESJ            VP------GARVLVPLCGKSQDMSWLSGQGYHVVGAELSEAAVERYFTERGEQPHITS--
TPMT_PSESM            AP------EARVLVPLCGKSQDMSWLIGQGCHVVGAELSETAVESYFSEHGVQPQITR--
TPMT_BORBR            PA------GGQVLVPLAGKSLDMVWLAGQGLRVLGVELSQLAVEQFFDENGLRPEIHQ--
TPMT_BORPA            PA------GGQVLVPLAGKSLDMVWLAGQGLRVLGVELSQLAVEQFFDENGLRPEIHQ--
TPMT_BORPE            PA------GGQVLVPLAGKSLDMVWLAGQGLRVLGVELSQLAVEQFFDENDLRPEIHQ--
F4GSM8_PUSST          PK------GSRVLVPLCGKSLDMIWLAEQGHEVLGVELAQQPIEQFFAENGLQATVHE--
TPMT_XANAC            PK------ESRVLVPLCGKTLDMHWLASQGHRVLGVELSPLAVTQFFDEAGLQPQRHT--
TPMT_XANCP            PA------HARVLVPLCGKTLDLHWLAAQGHRVLGVEISPLAVTQFFDDAGLQPQRHT--
E6WR26_PSEUU          AE------GAPVFVPLAGKTLDMHWLAARGHQVLGCELSPLAVQAFFAEAGLVPEQER--
TPMT_YARLI            SQ------GSTVIVPLCGKSLDMRWLEGLGYNVLGVELSEKACKQYFDQMELEPKVSKNA
E1V6A1_HALED          DE------GAKVLVPLCGKSLDMRWLADRGHPVLGIELAEEAIEQFL--AEGAGEVSRYH
TPMT_PSEU5            AT------PSRVFVPLCGKSLDMLWLAEQGHDVIGVELSPLAIEAFFRENHLPPSKRRQ-
F9ZXQ9_METMM          AS------GSRVFVPLCGKSLDMIWLAEQGHQVIGVELSPIAVADFFRENGLKPNRRRV-
Q47IR0_DECAR          AE------GSRVFVPLCGKSLDLLWLAQQGCEVIGIELSPIAVRAFFRENGLLPARRQV-
A0L4Z7_MAGMM          AR------GERVMVPLCGKSLDMLWLAQQGYEVLGIELSALAVAAFFEENGLQPTHRKL-
TPMT_LEGPA            PAKG------RVLVPLCGKSVDMLWLVRQGYHVVGIELVEKAILQFVQEHQITVRENT--
TPMT_LEGPC            PAKG------RILVPLCGKSVDMLWLVRQGYHVVGIELVEKAILQFVQEHQITVRENT--
TPMT_LEGPL            PAKG------RVLVPLCGKSVDMLWLVRQGYHVVGIELVEKAILQFVQEHQITVRENT--
TPMT_LEGPH            PAKG------RVLVPLCGKSVDMLWLVRQGYHVVGIELVEKAILQFVQEHQITVRENT--
F2JUT9_MARM1          PLGS------RVLVPLCGKSNDLIWLVEQGYDVTGVELSSLAVVEFFGDNDLAYTTEQ--
A6VV15_MARMS          PKGS------RILVPLCGKSNDLLWLAEQGYEVTGVELSSLAVIQFLGDNDLAFNTHQ--
D7DKZ7_METV0          KPESSPKISPRVFLPLCGKTLDIAWLLAQGYRIAGAELSSIAIEDLFKSLNLTPTIK---
Q04UF5_LEPBJ          AENG------RIFLPLCGKTLDIAWLLSRGFRVAGAELSKIAIEQLFQELGVEPKIS---
F8GGU4_NITSI          TRGN------RIFLPLCGKTRDAAWLLACGYRVVGAELSELAINELFKELGLEPEIS---
C6X732_METGS          APQS------RVFIPLCGKTLDIHWLLNQGLRVAGAELSELAVTQLFAELKLTPEIT---
F2G5W5_ALTMD          GGEQS-SHPIRIFVPLCGKTRDIAWLLSQGVEVVGAELSEVAITQLFEELGAAPTVA---
F5ZD75_ALTNA          ------STSPRVFVPLCGKTKDIHWLLANGCEVVGAELSEIAITQLFAELDIEPEIT---
G2I337_KOMMN          QHGA------RVFVPLCGKSLDIHWLLAQGHQVVGCELSPLAVGQLFAELGLAPHVS---
C7JHY1_ACEP3          KEGA------RVFVPLCGKTLDIHWFLQRGMNVVGVELSQIAVEQLFSEIGLTPQISN--
D7A4L6_STAND          APGA------RLFLPLCGKSLDIGWLRGRGYEVAAIELSRLAIEQLFDELKVEPRVT---
Q2SMC8_HAHCH          AKGS------RVFVPLCGKTLDISWLLSQGHRVVGCELSEMAIEQFFKELGVTPAIS---
B1KQV0_SHEWM          RRGG------RILVPLCGKTRDIEHLLSCGYQVVGVELNQQAVEALFIALGLTPNVT---
Q15VP2_PSEA6          PQSS------RLLVPLCGKTRDIAWLVANGHHVVAAELHEPAVIQLFKDMEIEPKVM---
G4QNZ9_GLANF          PENG------RVFVPLCGKTKDIGWFLAKGLSVVAIELNESAVKALFEDLGVEPHIE---
TPMT_ACIAD            KTSA------RIFVPLSGKTLDISWLLQQGYHVVAIELSQIAVTSLIEQLVEDFDIQFES
TPMT_GLUOX            PAGA------RIFVPLCGMSQDMVWLAGQGFHVTGCELSDIAVHRFFNDLDLTPDIR---
A5WC52_PSYWF          APAS------RVFVPLCGKSIDMLWLAEQGYDVIGSELIDSAVQQFFSENNIEMSITKHP
Q1QB39_PSYCK          PKNG------RVFVPLCGKSVDMLWFISQGFDVIGVELSEIAVIQFFAENDLQATVSLHP
C7RA80_KANKD          KS-------EKVLVPLSGKSLDLLFLAEQGYYPVGVEFNPKAVNRFIQENQLEFSSQTFP
E1X1S8_HALMS          CDIK------TALIPLCGKSLDLLYLREMGIEVFGVEIATKAVEQFFEENSLDFEIEEK-
TPMT_FRATT            ND------SSVCLIPMCGCSIDMLFFLSKGVKVIGIELSEKAVLSFFSQNTINYEVIHG-
                                  :.*:.* : :   :        . *:                      

TPMT_CANLF            EIPGGKIFKSS-----SGNISLYCCSLFDLPRA--NIGKFDRIWDRGALVAINPG----D
TPMT_RABIT            EVPGAKVFKSS-----AGNISLYCCSIFDLPRV--NIGKFDRIWDRGALVAVNPS----D
TPMT_GORGO            EIPGTKVFKSS-----SGNISLYCCSIFDLPRT--NIGKFDMIWDRGALVAINPG----D
TPMT_HUMAN            EIPGTKVFKSS-----SGNISLYCCSIFDLPRT--NIGKFDMIWDRGALVAINPG----D
TPMT_PANTR            EIPGTKVFKSS-----SGNISLYCCSIFDLPRT--NIGKFDMIWDRGALVAINPG----D
TPMT_HORSE            EIPGAKVFKSS-----SGNISLYCCNIFDLPRT--NIGKFDRIWDRGALVAVNPG----D
TPMT_BOVIN            EIPGAKIFKSS-----SGNISLYCCNLFDLPRA--NIGKFDRIWDRGALVAVNPS----D
TPMT_MOUSE            EIAGAKVFKSS-----SGSISLYCCSIFDLPRA--NIGKFDRIWDRGALVAINPG----D
TPMT_RAT              EIAGAKVFKSS-----SGNISLYCCSIFDLPRA--NIGKFDRIWDRGALVAVNPG----D
TPMT_DANRE            DIPGAKLFKST-----DGKISIYQCDLYKFSSA--VAGHFGGIWDRGALVAINPC----D
A9B4X2_HERA2          -------TTYV-----SGNITILNRDVLSLTTA--DVGNIDLVYDRAALVALPHE----M
D0LKG1_HALO1          PF-----VYFR-----AERLTLICGDFLRLTTD--ELGSIDLLYDRAALVALPLH----M
D2QUH2_SPILD          --------RFI-----SGNITIFCCDLFSLTPD--DLGPIDVVYDRASLVALPDA----M
C6WH21_ACTMD          -------GVFT-----AGNVTIRNQSLFDLGRG--DLGRVDVVYDRAALIAFPEA----M
F8JC21_HYPSM          --GP-FHVFE------AGPYTIYQGDFFALPAD--ALRGVAVCYDRAAMIALPPE----M
D8JWM2_HYPDA          --GP-FDLYS------AGPFNLYRGDFFETSPD--MVRDTVAVYDRAALIALPTD----L
TPMT_METCA            --GNGFVRAE------SGDISLLCGNYFDLTPD--LIGKVGAIYDRAALVAMPPE----M
D3RTH2_ALLVD          --GA-VRRYQ------VDELVLFQGDFFDLRPE--HLDDVGAVFDRASLIALPPP----M
F8GJR4_NITSI          --DR-FTHLE------ANDMHILCGDFFDLREN--DIAKVTAVYDRAALIALPPE----M
D5CQZ6_SIDLE          --NK-FERYE------AGGIKILCGDFFDLGKK--ELANVRAVYDRASLVALPPE----M
G4SVA1_META2          --DK-FEVWE------NDDLCIYCGDFFHLREE--DLTGVDAVYDRASLVALPPE----M
Q31ES3_HYDCU          --PR-FRSYE------MNGMSLLCGDFFDVSAK--ECAEVKAVYDRAALVALPPE----M
E4PN63_MARAH          --EP-FITFK------HDNLQLWCGDFFQLVPE--DLKHVRLVYDRAALIALPPH----M
TPMT_VIBVU            --SGQHELYQ------FDELSIYAGDFFTAPL-----SKADLIYDRAALIALPEE----M
TPMT_VIBVY            --SGQHELYQ------FDELSIYAGDFFTAPL-----SKADLIYDRAALIALPEE----M
TPMT_VIBPA            --SGMHELYQ------FDELSIYTGDFFTAPV-----SQADIVYDRAALVALPQD----M
F0LV54_VIBFN          --NGLHELYQ------FDELSIYTGDYFTAPL-----QSVDIVYDRAALIALPEG----M
TPMT_VIBCH            --NAQHELYQ------FDELTLFTGDFFTAPV-----ESVDLVYDRAALVALPEE----M
TPMT_ALIF1            --SSTLELYE------FDEFTIYSGDYFVAPI-----EAADLIYDRAALVALPKE----M
TPMT_PHOPR            ---GHESVYA------FDEITIHCGDYFSVRI-----DPVDVVYDRAALIAMPKN----M
A4SM27_AERS4          ---GPYQCHQ------HGSLRIHQGDFFAAPEL---GRRYRLAYDRAALIALPTE----M
TPMT_SHEON            ---GEHQHYQ------TEQISLYQGDIFTLPQS--ITAEVSGFYDRAALIAWPES----M
TPMT_SHEB9            ---GEHQHYH------TEQISLYQGDIFTLPKA--ITQEVTAFYDRAALIAWPEC----M
D4ZCC8_SHEVD          ---DTINKFT------TEQVTILQGDLFTLDPE--SFTEINAFYDRAALIAWPES----M
E1SLI2_FERBD          ---GALLRHQ------FDELTVLQGDLFQVTPE--QTRHCTAFYDRAALIALPAP----M
TPMT_PSEPK            --QGAFEVWR------SGDVQLWCGDFFALRAE--DVADCVGLYDRAAVIALPVQ----M
TPMT_PSEP1            --QGAFEVWR------SGDVQLWCGDFFALRAE--DVADCVGLYDRAAVIALPVQ----M
TPMT_PSEF5            --HGVFKVYA------HGPIELWCGDFFALTAE--DTADCTALYDRAAMIALPSP----M
TPMT_PSEAE            --LDGFRRYR------VAGITLLQGDFFALQAE--HLAQCRAFYDRAALIALPPE----M
F6AH35_PSEF1          --EDAFKVYR------HGRVELFCGDFFAFEAR--HMPGCALFYDRAALIALPAE----M
A0A1G3DEK4_9GAMM      --VGAFKVYR------SGRLEIRCGDFFALAAP--DVADCRGVYDRAALIALPPA----M
TPMT_PSESJ            --QGDFKVYA------APGIEIWCGDFFALTAR--DIGHCAAFYDRAAMIALPAD----M
TPMT_PSESM            --QGDFSVYA------APGIEIWCGDFFALTSQ--DIGHCTAFYDRAALIALPAD----L
TPMT_BORBR            --SAQGRHYV------AGNLELICGDVFALEDA--TLAACAGVYDRAALVALPEP----M
TPMT_BORPA            --SAQGRHYV------AGNLELICGDVFALEDA--TLAACAGVYDRAALVALPEP----M
TPMT_BORPE            --SAQGRHYV------AGNLELICGDVFALEDA--TLAACAGVYDRAALVALPEP----M
F4GSM8_PUSST          --TLQGTHYR------CGNIELICGDIFGISAE--TLAACQGVYDRAALVALPPA----M
TPMT_XANAC            --SAAGEHFI------AGPIEIICGDAFALDAS--VLADCTAVYDRAALVALPAE----L
TPMT_XANCP            --SRAGEHCI------AGPIEIICGDAFTLDAS--VLGDCTAVYDRAALVALPAA----L
E6WR26_PSEUU          --DADGLHHR------AGRIDLVEGDVFALTDA--TLARMRAVYDRAALIALPPD----L
TPMT_YARLI            --SGKFTIYE------AGNTQIWCGDLFDLDAD--DVKYVSALYDRASVIALPPD----M
E1V6A1_HALED          --HAHFAVSR------QGNVELWCGDFFHLHID--EAAEIGAFYDRAALIALPEA----A
TPMT_PSEU5            ---GRFTLWR------HGRIGILCGDYFALSEA--DLGPVDSVYDRAALTALPPI----L
F9ZXQ9_METMM          ---NQFTLWQ------HGRISILCGDYFALKPA--DLGEIETVYDRAALTALPED----I
Q47IR0_DECAR          ---GRLTEWS------SGPIRIFCGDIFALTAA--DLGPISAVYDRAALTALPES----V
A0L4Z7_MAGMM          ---GDFTLWQ------SGRVSILCGDFFDLTPL--LCENVDWVYDRAALTALPEP----L
TPMT_LEGPA            --IGQAKQYF------TDNLNLWVTDIFALNSA--LIEPVDAIYDRAALVALPKK----L
TPMT_LEGPC            --IGQAKQYF------TDNLNLWVTDIFALNSA--LIEPVDAIYDRAALVALPKK----L
TPMT_LEGPL            --IGQAKQYF------TDNLNLWVTDIFALNSA--LIEPVDAIYDRAALVALPKK----L
TPMT_LEGPH            --TGQAKQYF------TDNLNLWITDIFALNAA--LIEPVDAIYDRAALVALPKK----L
F2JUT9_MARM1          --TAYGKLHS------ANEMTLRVFEGDIFDFD--G-KVFDACYDRAAMVAMPST----L
A6VV15_MARMS          --EGDLKVHT------VDGLPLRIVEGDYFQFK--E-NEFDACYDRAAMVAMPES----K
D7DKZ7_METV0          -TLGEVTHYS------APNIDIFVGDIFKVSST--ILGAVDAVYDRAALVALPVD----I
Q04UF5_LEPBJ          -KAAELERYS------AHHIDIFVGDIFHLTAA--SLGFVDAIYDRASLVALPED----T
F8GGU4_NITSI          -KVGKLARYR------AEDIDILAGDIFAVSAG--YLGPISAIYDRAALVALPAC----I
C6X732_METGS          -QRGQLRHYH------AKHIDIFVGDIFDLTAD--ILGPVDAIYDRAALVALPAP----L
F2G5W5_ALTMD          -ETEHGKVYA------KDGLTVFVGDIFKLSAK--DVGNISGVYDRAALVALPSQ----L
F5ZD75_ALTNA          -TLGSLKLFK------NGPLSIFVGDIFELTNE--TLGGITGIYDRAALVALPTE----L
G2I337_KOMMN          -ICGTMQRYD------AEGLCIYVGDIFDLTAD--ALGQIDAVYDRAALIALPPA----Q
C7JHY1_ACEP3          -MAPNMQCFK------AKNLNIFVGDIFTLSRA--LLGDVQAIYDRAALVALPPA----M
D7A4L6_STAND          -EVGPLELFE------ADGLTIFVGDFFDLGRE--ALGTVDAVYDRAALVALPEP----M
Q2SMC8_HAHCH          -EIVAGKRYS------AENLDIIVGDFFDLTVE--TLGHVDATYDRAALVALPKP----M
B1KQV0_SHEWM          -KVGDFTLYR------AANIDLFVGDIFALSSE--LVGAVDGIYDRAALVALPFE----M
Q15VP2_PSEA6          -HFEEIDLIHYQAMVGGLMIDAYVGDIFQLNPA--LVGRVDAIYDRAALVALPFD----M
G4QNZ9_GLANF          -SHGSLSKYS------VANLIVYVGDFFTLSAE--DVGSIDGVFDRGALVALPEP----L
TPMT_ACIAD            SEKNNLIHYH------HPQIDIFVGDFFDLSKE--QLGQVDAIFDRAALIALPDD----I
TPMT_GLUOX            -DVGPLRCFS------AGTIRIFAGNIFDLTPD--LLGLMDGIYDRAALIALPED----L
A5WC52_PSYWF          -KNESMNIYQ--GQYAGRLIQIFAGDIFELSPA--DVGTIDAVYDRAALVAMPDKAPTHL
Q1QB39_PSYCK          -TTPSLTCYQ--AEHEGQTLKIWVGDIFDLSPI--DIGIIDAVYDRGALVALPDMKPDNL
C7RA80_KANKD          VANGNELIRYH-----NDTMEVWLADFFEVTEN--HIGTFEQVYDRAAFIALPDQ----M
E1X1S8_HALMS          ---GNYKIYK------TSGITIFCGDFFSLKRD--DLPKIDFIYDRASNVALPPQ----M
TPMT_FRATT            ---NDYKLYK------GDDIEIYVADIFNLPKIANNLPVFDIWYDRGAYIALPND----L
                                               .                 :**.:  *         

TPMT_CANLF            RERYADIMLSLTRKGFHYLLAVLCYDP----------TKHAGPPFYVPEAEIKKLFGSIC
TPMT_RABIT            RKRYAAVMLSLLRKGFQYLLAVLSYDP----------TKHAGPPFYVPDAEIKMLFDTKC
TPMT_GORGO            RKCYADTMLSLLGKKFQYLLCVLSYDP----------TKHPGPPFYVPHAEIERLFGKIC
TPMT_HUMAN            RKCYADTMFSLLGKKFQYLLCVLSYDP----------TKHPGPPFYVPHAEIERLFGKIC
TPMT_PANTR            RKCYADTMLSLLGKKFQYLLCVLSYDP----------TKHPGPPFYVPHAEIERLFGKIC
TPMT_HORSE            RKRYVDIMLSLTRKGFHYLLAVLSYDP----------TKHAGPPFFVSDAEVKRLFDSVC
TPMT_BOVIN            RKRYSDVMLSLTRPGFRYLLSVFSYDP----------TKHAGPPFYVTDGEVKKLFGSVC
TPMT_MOUSE            HDRYADIILSLLRKEFQYLVAVLSYDP----------TKHAGPPFYVPSAELKRLFGTKC
TPMT_RAT              RDRYADIILSLLRKGYHYLLVVLSYDP----------TKHTGPPFYVPDAELKKLFGTKC
TPMT_DANRE            RQKYASLLVSLMSSDCRYLLDTLEYNP----------ELYKGPPFFVSEDDIKTVFGGSC
A9B4X2_HERA2          RNQYRATIDQLLPVGGQQMIITLEYAP----------LMAT-PPFSITPTEIEFYYGERY
D0LKG1_HALO1          RLAYVEQVNALLPAGAQQFINTIEYEP----------SLNQ-APFSVSAEDVSRYYGRDF
D2QUH2_SPILD          RMRYLQTLEELTPVGALTFLNTVEYAP----------TMPT-PPFSISPRDVLWYF-PNY
C6WH21_ACTMD          RGRYVAKILELAAPGTRYFLNTLEYRP----------ALDS-PPFSVGPEEVVGYYGEWF
F8JC21_HYPSM          RPQYAEKLTSVLPPEAAIFVISIEYPE----------GEIKGPPFAVAQDEVRALYGKLY
D8JWM2_HYPDA          RERYAKKLASIIPSSAIIFLVALEYPE----------HEMSGPPFSVPRAEVERLYGDTF
TPMT_METCA            QGRYAEQVFRLLPETPPMLLITLEYDA----------EEMSGPPFPVPEEAVVRLFGPAY
D3RTH2_ALLVD          RVRYAEHLRAILPRPVDRLLITLDYDQ----------AQMSGPPFSVQPPEIERLFGVDH
F8GJR4_NITSI          HKRYTHHLLSILPPATQILLVTLDYPQ----------YEMSGPPFAVSMDEVTLLYQPHA
D5CQZ6_SIDLE          RERYAQHLASILSAGTQILLITFDYPQ----------AEMSGPPFAVSIEEVESLYRDRA
G4SVA1_META2          RANYAAHMKRLLKTGTKILLVAFDYSQ----------QEMDGPPFSVQCQEVEMLYRDWC
Q31ES3_HYDCU          RQQYASHLKTILAPGVPILLIAMDYDQ----------SLQSGPPFAVSALEVKALFEDRF
E4PN63_MARAH          RRDYVNHLTAIIPDGTRILLITLDYD-----------TEIKGPPFNVSDEEVRELYQDDY
TPMT_VIBVU            RVEYVQRIRGLLNPGGRILLVSLDYPQ----------QEMAGPPFSVTQEEIEHLFAGMH
TPMT_VIBVY            RVEYVQRIRGLLNPGGRILLVSLDYPQ----------QEMAGPPFSVTQEEIEHLFAGMH
TPMT_VIBPA            REEYVARLKQLLNPGGRILLVTLNYPQ----------EEMAGPPFSVPLEEIQQLFAGYK
F0LV54_VIBFN          RADYVARLKSLLNPGARILLVTLDYDQ----------QELSGPPFSVNEEEVKRLFSGFS
TPMT_VIBCH            RAEYAQRVLQLLKPGGRILLVSMDYVQ----------TELSGPPFSVPEAEIRTLFMGCE
TPMT_ALIF1            REEYVQVLRSRLKEGGRILLVTLDYDQ----------NEMAGPPFSVPENEVQALFSGMK
TPMT_PHOPR            REMYVERLLSLVKKGGRILLVTLDYPQ----------EQLNGPPFSVMSDEVRRLFDGCN
A4SM27_AERS4          RRQYAELMSRLMETGGQILLVTLEYQP----------EQQKQPPFSVGEMEVRTLFERDF
TPMT_SHEON            RAQYAKQLAYLLPQGSVGLLVTLDYPQ----------EVLSGPPFAVSPTWVETHLSEDF
TPMT_SHEB9            RAQYAKQLASLLPSGSVGLLVTLDYPQ----------EALSGPPFAVSPTWVEQHLSDDF
D4ZCC8_SHEVD          RLAYVEKIAALIPPKSIGLLITLDYPQ----------ETLKGPPFAVSDDWVMSNMSDTF
E1SLI2_FERBD          RDRYVTALAELLPSGAVGLLVTLDYPQ----------DALAGPPFAVAEQEVVERLSPWF
TPMT_PSEPK            RARYMQLLSGLLPANCRGLVVTLEYDQ----------SLLAGPPFSVRDEELRQGFAG-W
TPMT_PSEP1            RARYMQLLSGLLPTSCRGLVVTLDYDQ----------SLLAGPPFSVRDEELRQGFAG-W
TPMT_PSEF5            RQRYAAHLNGLLPNGSKGLLITMDYAQ----------EQLDGPPFAVLDDEVRQRLGGVW
TPMT_PSEAE            RERYAGHLQAVLPTRSLGLLVTIDYPQ----------AEMAGPPFAVPDEEVRGYYAGGW
F6AH35_PSEF1          RERYVRHLQQILLPESHGLLVTLDYDQ----------ALMDGPPFSVSDAEVRSWNGTIW
A0A1G3DEK4_9GAMM      RQRYAALLTNILPAGCQQLLVTLDYDQ----------AEMDGPPFAVSRAEVSTLYDGAW
TPMT_PSESJ            RERYVQHLEALMPQACSGLLITLEYDQ----------ALLEGPPFSVPQTWLHRVMSGNW
TPMT_PSESM            RERYVQQLEALMPRECNGLLITLDYDQ----------SRLEGPPFSVPPTWLQAFVSGNW
TPMT_BORBR            RKRYAREVYGRLGRGCRGILITLDYPQ----------DQMEGPPFSVDDAEVQALYAGHT
TPMT_BORPA            RKRYAREVYGRLGRGCRGILITLDYPQ----------DQMEGPPFSVDDAEVQALYAGHT
TPMT_BORPE            RKRYAREVYGRLGRGCRGILITLDYPQ----------DQMEGPPFSVDDAEVQALYAGHT
F4GSM8_PUSST          RQRYVAHVYGQLAQQYRGLLLTLDYDQ----------HEMEGPPFAVNDAEVQSLYTGHS
TPMT_XANAC            RQRYLQTVYVQLPTHCRGLLITLEYPQ----------AEKAGPPFSVDATHVHALFDAAW
TPMT_XANCP            RQRYLETVYARLPAGCRGLLITLDYPQ----------AEKAGPPFSVDAAEVHALFGTQW
E6WR26_PSEUU          RRRYAGEVYGRLPGGCEGLLVTLEYPQ----------AQMQGPPFSVPEAEVRGLFEADW
TPMT_YARLI            RERYAAHLGALIP-DPQGLIITLDYDQ----------SKMNGPPHAVSDAEVQRLFGTNW
E1V6A1_HALED          RQRYAFHLAQLLPPGARGLLITLTRAP----------GDSGGPPYEVTADEVHERFSPNF
TPMT_PSEU5            RSRYVAQLRRIVPDTARVFLLTLEDAE----------ADATLQQALGVDEELAALYTAGF
F9ZXQ9_METMM          RKQYVSHLCKIVPDTSEIFLLTTEDAA----------ENETLGESLEIGEEITALYSQNF
Q47IR0_DECAR          RAIYVAHLHALIPETCPIFLLTAEDPE----------EGDADGAEPNVAEELLTLYAERF
A0L4Z7_MAGMM          RRRYAAYIQQLTP--ANIVLMTIEEQE----------DGVSEACFLGIDPEIMALYGPLC
TPMT_LEGPA            RPAYVDICLKWLKPGGSILLKTLQYNQEK----------VQGPPYSVSPEEIALSYQQCA
TPMT_LEGPC            RPAYVDICLKWLKPGGSILLKTLQYNQEK----------VQGPPYSVSSEEIALSYQQCA
TPMT_LEGPL            RPAYVDICLKWLKPGGSILLKTLQYNQEK----------VQGPPYSVSPEEIALSYQQCA
TPMT_LEGPH            RPAYVDICLKWLKPGGSILLKTLQYNQEK----------VQGPPYSVSPEEIALSYQQCA
F2JUT9_MARM1          RQSYVEKVSACLREDAHILMISLHHDGN-----------IDTPPFSVSDDDVASLWQRNI
A6VV15_MARMS          RTEYVSHTLGRLSSSACVLLVSLQYDGD-----------KQGPPFSVNEDSVVSLWGNQI
D7DKZ7_METV0          RKLYTAHLIT-LTHHAPQLLICFEYDQ----------SLHAGPPFSISADEVKQHYQANY
Q04UF5_LEPBJ          SKHYVKHLME-ITNTAPQLLICYEYDQ----------SKMAGPPFSIRSGEVQKHYRNHY
F8GGU4_NITSI          REHYTSHLMN-ITDTAPQLLITYEYDQ----------LLMDGPPFSVNEDEVKRHYGASY
C6X732_METGS          REKYAAHLTA-ISHAAPQLLICYVYEQ----------SQLSGPPFSVEDAEVKQHYQSQY
F2G5W5_ALTMD          RAQYASHLME-ITHKAPQLIISFEYNQ----------DELAGPPFSVNEHTVASLYADSY
F5ZD75_ALTNA          REKYAAHICD-ITECAPILLISFDYDQ----------SVIPGPPFCVDETEVARLYNASY
G2I337_KOMMN          QADYAAHLCA-ITHQAPQLLICLEYDQ----------SRLAGPPFSVDAAQVSQYYGATF
C7JHY1_ACEP3          RAAYAEHLMD-ISGKAEQLLVTLEYDQ----------SCIAGPPFSVTRQDIHRYYGAEY
D7A4L6_STAND          RERYAGHLVH-MTHAAPQLLITFDYDP----------SLLVGPPFCVPEHEVRRHYGAAY
Q2SMC8_HAHCH          RDSYAKHLMA-LTNNAPQLMLCYQYDQ----------TQMEGPPFSISAEEVQHHYADSY
B1KQV0_SHEWM          RKRYSSHLID-ITCGAPQLLVIYTYDQ----------TLMDGPPFSISCDEVELHYSENY
Q15VP2_PSEA6          REKYTLHMRE-LTGAAPQLLISFDYEQ----------HLLPGPPYCVNGNEITGHYGQHY
G4QNZ9_GLANF          RNRYSQHLRM-ISKACKQFVVTYDYDQ----------SLFAGPPFSVPSETVHEVYQQYF
TPMT_ACIAD            RQDYVQHLIE-ISGAASQFLISYQYDA----------GSHEGPPFSVNAEEIKQLYAEAY
TPMT_GLUOX            RRAYAAHLLS-LTGPVPELLVTLDYDQ----------SCLKGPPFSVDEAFLRECYGQAY
A5WC52_PSYWF          RRQYVQQVIK-LTQTAPQLLLNFALNAPAMDEATRLSRQQGGPPFVVSDDAIYGYYQEAY
Q1QB39_PSYCK          RTRYTQKLMA-LSNKASQLLLSFAYDG----EKQCSDNHKNLPPFLVTRSQLEQYYAEYY
C7RA80_KANKD          RTSYAKHLKSLLADNATILLVTMDYLP----------DEMSGPPFHITLDEIKQQFPDGE
E1X1S8_HALMS          RESYYDQIRNLSSDNTQMLLLTAHSEE----------EDQFGPPFSISKEEIEMAYKEKA
TPMT_FRATT            RTNYAKMMLEVCSNNTQILLLVMEHDK-----------KSQTPPYSVTQAELIKNFSAKI
                         *              .:                               :        

TPMT_CANLF            NIHCLEK---VDVFEEQHKSWGIDYIIEKLYLFTEK----------------
TPMT_RABIT            KIHCLEK---VDAFEERHKSWGIDYIFEKLYLLTEK----------------
TPMT_GORGO            NIRCLEK---VDAFEERHKSWGIDCLFEKLYLLTEK----------------
TPMT_HUMAN            NIRCLEK---VDAFEERHKSWGIDCLFEKLYLLTEK----------------
TPMT_PANTR            NIRCLEK---VDAFEERHKSWGIDCLFEKLYLLTEK----------------
TPMT_HORSE            NIRCLEK---VDALEERHKSWGIDYLVETLYLFTEK----------------
TPMT_BOVIN            NIQCLEK---VDVFEERHKSWGIDQIIERLYLFTEK----------------
TPMT_MOUSE            SMQCLEE---VDALEERHKAWGLDYLFEKLYLLTEK----------------
TPMT_RAT              NMQCLEE---VDALEERHKTWGVDYFFEKLYLLTEK----------------
TPMT_DANRE            NIDLLQS---VDGFEEKHRSWGLDSLTEKLYLLTTKTQ--------------
A9B4X2_HERA2          FISHFAAP--SQPEHRMVAKFNLQFLKEHGFLITRYQK--------------
D0LKG1_HALO1          TIEHVESP--EVPEHGMVRKFQLGFLREHGFLLSKR----------------
D2QUH2_SPILD          VIDHVESP--VLPNHGMVRKFNLSFLIEHGFLMRKLYNSAVWTDAEQMTEAV
C6WH21_ACTMD          EIEHWVDE--VQPGHRMVEKFGLEELREHGFLLRRR----------------
F8JC21_HYPSM          DIDVLEVR-DGLAASDNLKKRGVTRLEEVAYLLRQQA---------------
D8JWM2_HYPDA          DIQVLEAR-DGLDASGNLRRRGVSALQETAYVLRRR----------------
TPMT_METCA            RIELLSAR-DALEGNPQLRAKGLSRLTEKAYWLRAQASA-------------
D3RTH2_ALLVD          HIEPLAEI-DALAESPNFRQRGLTALVERVHWLRPRV---------------
F8GJR4_NITSI          GITLLSQQ-DVLEQNPRFQDRGLSRLQENTILLKTLRKL-------------
D5CQZ6_SIDLE          EIRLLAHH-DVLAQTPRFKERGLSRLHEN-IFLLTLR---------------
G4SVA1_META2          RIDLLLTE-DILSKEPRFRERGLSRLQEQVYVLTVL----------------
Q31ES3_HYDCU          NIEKV--------ESDTFERKG-VKTTENVFVLTPKA---------------
E4PN63_MARAH          KIEHILTN-TLAKDHPFTKRKGLENASESVFRLTKL----------------
TPMT_VIBVU            VTRLYQDI-A-DEHHPKIAKQGLSRFSEEVYVIENDK---------------
TPMT_VIBVY            VTRLYQDI-A-DEHHPKIAKQGLSRFSEEVYVIENDK---------------
TPMT_VIBPA            VTCLNVDQ-A-DEHHPKIAKKGLSRFSEEVYLIEAQ----------------
F0LV54_VIBFN          VRRLLRDE-A-NAQHPKRAKKGLSRFAEEVWLIES-----------------
TPMT_VIBCH            VRRVYQDT-SIDPHLNKRTQAGLSRFAEEVWVIEKSE---------------
TPMT_ALIF1            ITRLQRDE-A-DAEHPKI-KKGLSRFAEEVWLIES-----------------
TPMT_PHOPR            ITLLARDE-K-DETHPRR-KNGLSHFAEETWLIEVA----------------
A4SM27_AERS4          RVEVLGRA-A-EVDHPRVLSGQLSYFDEVAYRLIRRG---------------
TPMT_SHEON            EIQPLACQ-DVLADNPRFVKKAVPWLNEAVYLLKRR----------------
TPMT_SHEB9            DIGVLASQ-DVLADNPRFIKKAVPWLNEAAYLLKRK----------------
D4ZCC8_SHEVD          EIEKLSCD-DVLMDNQRFVNKGVPWLSESVYKLVRKG---------------
E1SLI2_FERBD          VVEKLASH-DVLADNPRFVAKGAPWLQEEVYRLVRR----------------
TPMT_PSEPK            QVEQLEAV-DVIEDSPKFVQAGASSLLERVYQVSR-----------------
TPMT_PSEP1            QVEQLEAV-EVIEESPKFVQAGASSLLERVYRLSR-----------------
TPMT_PSEF5            QLQVETER-DILGESWKFLQGGVTRLVERVYRLSKQGAAR------------
TPMT_PSEAE            RIEELERG-DVLGVNWKFLERGVSWLDEAVYLLERG----------------
F6AH35_PSEF1          ESELLESQ-DALED--RFRARGLTRMDERAYHLRLL----------------
A0A1G3DEK4_9GAMM      DVQQLEAK-EVLERNPKMRERGLQRLQEQFYRLQRRD---------------
TPMT_PSESJ            EVTKVGGQ-DTLHSSARGLKAGLERMDEHVYVLERV----------------
TPMT_PSESM            NITKVGEH-DALHSSPKALKAGVERLDEQVYVLARKLR--------------
TPMT_BORBR            EARLIDRR-DILDKEPKFNQRGVARLDTLVYRLERLG---------------
TPMT_BORPA            EARLIDRR-DILDKEPKFNQRGVARLDTLVYRLERLG---------------
TPMT_BORPE            EARLIDRR-DILDKEPKFNQRGVARLDTLVYRLERLG---------------
F4GSM8_PUSST          HAQLIDQR-AILDKEPKFKERGLTRLDTLVYRLEEARQA-------------
TPMT_XANAC            QVDQLERR-DILDQEPRFRDEGVTGLSTAVYRLQRR----------------
TPMT_XANCP            KVQELEHR-DILDQEPRFRADGVTALSTGVYRLQRD----------------
E6WR26_PSEUU          DVELLERR-DILAQEPRFIADGVTALSTAVYRLRRR----------------
TPMT_YARLI            KLTLLE---EVDKK--DMFKEEGIEPVERVYKLN------------------
E1V6A1_HALED          EVTHLE---DGEREPGSGFRESIWKLVRRGPGR-------------------
TPMT_PSEU5            EIALAHVE-SLFEPDPQ--NGAPRRVEHKVYQLTGKRPASPEADGRAAETED
F9ZXQ9_METMM          RIDLTHIE-SIFELDPDSPDRPATRAECKLYRLSNRAAA-------------
Q47IR0_DECAR          TVDLVHVA-PSFQMNPETPDAPPLPIEHKFYRLLPS----------------
A0L4Z7_MAGMM          HIGLSYVG-REEEIDPNNPLGKPISVAYKIYQITR-----------------
TPMT_LEGPA            KIELLKSQKRIQEPNDHLFNLGISEVNDYVWCIRKG----------------
TPMT_LEGPC            KIELLKSQKRIQEPNDHLFNLGISEVNDYVWCIRKG----------------
TPMT_LEGPL            KIKLLKSQKRIQEPNDHLFNFGISEVNDSVWCIRKG----------------
TPMT_LEGPH            KIELLKSQKRIREPNDHLFNLGISEVNDYVWRIRKG----------------
F2JUT9_MARM1          HKIASED---LVQTNSRYKESEYAYFEESVWRVLPDEL--------------
A6VV15_MARMS          QKIASEN---LALTNPQYKEEGHNIFEESVWRIQPERI--------------
D7DKZ7_METV0          DLTLLGS------TAVAGGLKGLCPATEHVWWLKPLK---------------
Q04UF5_LEPBJ          HFNLIVS------KNVVGGLKGKCEATENVWLLLKQSTD-------------
F8GGU4_NITSI          QLKSVGS------KDVAGGLKGKVASTEAAWLLQKNKIIG------------
C6X732_METGS          TLELLEC------PEVSGGFKGRVPAQEHVWRLSRQTPI-------------
F2G5W5_ALTMD          VINRLER------SVLEGGLKGKVDAENLVFELVAK----------------
F5ZD75_ALTNA          SITLLER------EPLEGGLKGKVAADSLVFNLKHK----------------
G2I337_KOMMN          TLTCVER------VMVPGGLKGACPATEALWHLVPA----------------
C7JHY1_ACEP3          TINCLES------TAVTGGLKGGVPATENVWVLKPE----------------
D7A4L6_STAND          HIRGLGR------HEVKGGIRGVGPIFEEVWLMERR----------------
Q2SMC8_HAHCH          ALTALAT------VGVEGGLRELNEVSETVWLLESR----------------
B1KQV0_SHEWM          CVNQLDS------RDAPGGIRGKISAIESAWLLIKDD---------------
Q15VP2_PSEA6          DISQLAS------EDVVGGLKGKLKANEEVWLLKYKT---------------
G4QNZ9_GLANF          NITQLYR------GKVAGGFRGQDEVYESVFLLLDKC---------------
TPMT_ACIAD            DIRLLKE------QLVDASQNKGNHPKSTLWILTAKF---------------
TPMT_GLUOX            AFTLLES------RAVEGGLKGRCPASENVWRFSPLPPSS------------
A5WC52_PSYWF          QVEFLGQ------DAFEPTDRLINQAWRLINQS-------------------
Q1QB39_PSYCK          EINLIAQ------EKVDYVSTAGDSGYRLVYTLLSKN---------------
C7RA80_KANKD          VEELCRCS--LLDSHPRWKELNLSRLDEVLYQITF-----------------
E1X1S8_HALMS          KEFKLLHEQKKKVTSKRLIKAGLKSRIMVAHYLKF-----------------
TPMT_FRATT            KFELIDSK-QRDNIPDYRKAEGMTEQYYTTYLRKKQY---------------