CLUSTAL format seed alignment for MF_00815

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ATPG_CLOAB       -MAGAGLIIIKRRIKSITNTKKITNAMGLIATSNLRKSRQNLEANKAYYEAFNDVINKIV
ATPG_CLOPA       --MAAGLITIKRRIQSITNTRKITKAMGLIATSTLRKARRNLDANLSYYSSFEDVMKKVS
ATPG_CLOPE       -MAGAGLLEIKRRIKSIKNTRKITKAMGLVATSKLRKARQKLTENNQYFSSLDEIARELI
ATPG_ACEWD       --MAENVQDIKRRIKSVNSTMQITHAMELVASAKLRKSRELAEGRRPYFEAMIESIGRIV
ATPG_RUMA7       ---MANMKDVKRRIKSVESTMQITKAMQLVASSKMRKAKERAEAVHPFFEGVFQVMADIS
ATPG_CALS4       ----MGKRDIALRIKSVKEVRKITRAMYLISASKFQKAKGMLDRVRPYYYRVQTVMKDIL
ATPG_BACFR       ---MASLKEVKTRINSVQSTRKITSAMKMVASAKLHKAQGAIENMLPYQRKLNKILTNFL
ATPG_BACFN       ---MASLKEVKTRINSVQSTRKITSAMKMVASAKLHKAQGAIENMLPYQRKLNKILTNFL
ATPG_BACTN       ---MASLKEVKTRINSVKSTRKITSAMKMVASAKLHKAQGAIENMLPYERKLNKILTNFL
ATPG_BACCA       MKPLASLRDIKTRINATKKTSQITKAMEMVSTSKLNRAEKR-EIVRPYMEKIQEVVAMSA
ATPG_GEOSE       MKPLASLRDIKTRINATKKTSQITKAMEMVSTSKLNRAAKR-EIVRSYMEKIQEVVANVA
ATPG_BACP3       MKPLASLRDIKTRINATKKTSQITKAMEMVLTSKLNRAEKR-EIVRPYMEKIQEVVANVA
ATPG_GEOKA       ---MASLRDIKTRINATKKTSQITKAMEMVSTSKLNRAEQNAKSFVPYMEKIQEVVANVA
ATPG_BACMQ       ---MASLRDIQTRITSTKKTSQITKAMEMVSAAKLNRAEQNAKSFVPYMEKIQEVVSSVA
ATPG_BACLD       ---MASLRDIKSRIASNKKMSQITKAQEMVSASKLNRAENKAKSFVPYMEKMQEVVADIA
ATPG_BACSU       ---MASLRDIKSRITSTKKTSQITKAMQMVSAAKLNRAENNAKSFVPYMDKIQEVVSNVG
ATPG_BACC1       ---MASLRDIKAKINSTKKTSQITKAMEMVSASKLNRAEQNAKSFVPYMEKIQEVVASIA
ATPG_BACCR       ---MASLRDIKAKINSTKKTSQITKAMEMVSASKLNRAEQNAKSFVPYMEKIQEVVASIA
ATPG_BACCZ       ---MASLRDIKAKINSTKKTSQITKAMEMVSASKLNRAEQNAKSFVPYMEKIQEVVASIA
ATPG_BACHK       ---MASLRDIKAKINSTKKTSQITKAMEMVSASKLNRAEQNAKSFVPYMEKIQEVVASIA
ATPG_BACHD       ---MASLRDIKQRINSTKKTKQITKAMEMVSAAKLNRSQEKAQSFLPYTDKIREVVASIA
ATPG_BACPE       ---MASLRDIQGRITSTKKTKQITKAMQMVSAAKLNRAQHNAQSFTPYTDKIREVVAAIA
ATPG_BACSK       ---MASLRDIKNRINSTKKTRQITKAMQMVSAAKLNRAQEKAQSYEVYAKKMREVVGNIA
ATPG_OCEIH       ---MASLRELKGRIESTKKTKQITGAMQLVSASKMSKAEQNARGFVPYADKLQEVVSSIA
ATPG_LISIN       ---MASLIDIKQRITSTRKTSQITKAMQMVSAAKLGRAESNARSYEPYVSKIKDVVTHVA
ATPG_LISMO       ---MASLIDIKQRITSTRKTSQITKAMQMVSAAKLGRAESNARSYEPYVSKIKDVVTHVA
ATPG_LISMF       ---MASLIDIKQRITSTRKTSQITKAMQMVSAAKLGRAESNARSYEPYVSKIKDVVTHVA
ATPG_STAAM       ---MASLKEIDTRIKSTKKMKQITKAMNMVSSSKLRRAEKNTKQFTPYMDKMQDAITAVA
ATPG_STAAW       ---MASLKEIDTRIKSTKKMKQITKAMNMVSSSKLRRAEKNTKQFTPYMDKMQDAITAVA
ATPG_STAAN       ---MASLKEIDTRIKSTKKMKQITKAMNMVSSSKLRRAEKNTKQFTPYMDKMQDAITAVA
ATPG_STAHJ       ---MASLKEIDGRIKSTKKMKQITKAMNMVSSSKLRRAEKNTKQFEPYMEKMQDAITAIA
ATPG_STAES       ---MASLKEIDSRIKSTSKMKQITKAMNMVSSSKLRRAEKNTKSFRPYMEKMQDAITAVA
ATPG_STAEQ       ---MASLKEIDSRIKSTSKMKQITKAMNMVSSSKLRRAEKNTKSFRPYMEKMQDAITAVA
ATPG_STAS1       ---MGSLKEIDTRIKSTKKMKQITKAMNMVSSSKLRRAESNAKQFRPYMEKMQDAITAVA
ATPG_ENTFA       --MGASLNEIKQRIASTKKTSQITKAMQMVSAAKLTKSEGASKSFQEYSSKIRSVVTHLV
ATPG_ENTHA       --MGASLNEIKTRIASTKKTSQITRAMQMVSASKLTKSEASSQKFQIYANKVREIVTHLT
ATPG_STRA3       --MAGSLSEIKDKILSTEKTSKITSAMQMVSSAKLVKSEQAARDFQVYASKIRQITTNLL
ATPG_STRA5       --MAGSLSEIKDKILSTEKTSKITSAMQMVSSAKLVKSEQAARDFQVYASKIRQITTNLL
ATPG_STRP1       --MAGSLSEIKAKIISTEKTSKITSAMRMVSSAKLVKSEQAARDFQIYASKIRQITTDLL
ATPG_STRP8       --MAGSLSEIKAKIISTEKTSKITSAMRMVSSAKLVKSEQAARDFQIYASKIRQITTDLL
ATPG_STRP6       --MAGSLSEIKAKIISTEKTSKITSAMRMVSSAKLVKSEQAARDFQIYASKIRQITTDLL
ATPG_STRP3       --MAGSLSEIKAKIISTEKTSKITSAMRMVSSAKLVRSEQAARDFQIYASKIRQITTDLL
ATPG_STREI       --MAGSLSEIKGKIISTQKTSHITGAMQMVSAAKLTKSEQAAKDFQVYASKIRQITTDLL
ATPG_STRMU       --MTGSLSEIKVRITSTQKTGKITSAMKMVSSAKLVKSEQAAKDFQIYASKIRQITTDLL
ATPG_STRTR       --MAGSLREIKAKIASIKQTSHITGAMQMVSASKLTRSEQAAKDFQIYASKIRQITTDLL
ATPG_STRT2       --MAGSLREIKAKIASIKQTSHITGAMQMVSASKLTRSEQAAKDFQIYASKIRQITTDLL
ATPG_STRT1       --MAGSLREIKAKIASIKQTSHITGAMQMVSASKLTRSEQAAKDFQIYASKIRQITTDLL
ATPG_STRPN       --MAVSLNDIKTKIASTKNTSQITNAMQMVSAAKLGRSEEAARNFQVYAQKVRKLLTDIL
ATPG_STRR6       --MAVSLNDIKTKIASTKNTSQITNAMQMVSAAKLGRSEEAARNFQVYAQKVRKLLTDIL
ATPG_STRSA       --MAVSLNDIKNKIASTKNTSQITNAMQMVSAAKLGKSEEAAKNFQVYAQKVRKLVTDML
ATPG_LACLM       --MGASLNEIKTKIASTKKTSQITGAMQMVSAAKLQKAESHAKAFQTYAEKVRKITTDLV
ATPG_LACLA       --MGASLNEIKTKIASTKKTSQITGAMQMVSAAKLQKAESHAKAFQIYAEKVRKITTDLV
ATPG_LACAC       --MPASLLELKRKIASVKQTGKITEAMRMVSASKLNQTENRDKDYTVYNDHVRKTISHLI
ATPG_LACJO       --MAESLLELKKKIASIQKTGQITEAMRMVSGVKLNRTEKLDQEYTIYNDKVRATVSHLM
ATPG_LACPL       --MAESLMDVKRRIDSTKKTHQITSAMQMVSTSKLNQIQKHTSTYQVYASKVESIVSHLA
ATPG_OENOE       ---MASLQDIRRRIDSTKKTSQITSAMQMVSSSKLIQIQKHTSGYLDYANHVEAIVAHLA
ATPG_COREF       ---MANLRELRDRIRSVNSTKKITKAQELIATSRITKAQGRVAAAAPYAEEIQKVLERLA
ATPG_CORGL       ---MATIRELRDRIRSVNSTKKITKAQELIATSRITKAQGRVAAAAPYAEEIQRVLERLA
ATPG_CORDI       ---MANLRELRDRIRSVNSTKKITKAQELIATSRITKAQARVEASQPYATEIHKVMERLA
ATPG_CORJK       ---MASLRELRTRIKSVNSTKKITKAQELIATSRITKAQARVDDAEPYADEITRVVQRLA
ATPG_MYCBO       --MAATLRELRGRIRSAGSIKKITKAQELIATSRIARAQARLESARPYAFEITRMLTTLA
ATPG_MYCTU       --MAATLRELRGRIRSAGSIKKITKAQELIATSRIARAQARLESARPYAFEITRMLTTLA
ATPG_MYCPA       --MAATLRELRGRIRSAGSIKKITKAQELIATSRIGRAQARLDSARPYAFQITAMLTTLA
ATPG_MYCLE       --MAATLRELRGRIRSVGSIKKITKAQELIATSRIARAQVRLESARPYAVDITRMLTTLA
ATPG_NOCFA       ---MASLRELRSRIRGVNSIKKITKAQELIATSRISKAQARVAAAKPYAEEITKVLGELA
ATPG_STRCO       --MGAQLRVYKRRIRSVTATKKITKAMEMIAASRVVKAQRKVAASTPYARELTRAVTAVG
ATPG_STRLI       --MGAQLRVYKRRIRSVTATKKITKAMEMIAASRVVKAQRKVAASTPYARELT--LPRLG
ATPG_STRAW       --MGAQLRVYKRRIRSVTATKKITKAMEMIAASRVVKAQRKVAASTPYATELTRAVTAVG
ATPG_LEIXX       --MGAQLRVYRQKIKSAHRTKKITRAMELISASRIQKEQARVAASSPYARAITRAVSAVA
ATPG_CUTAK       --MASNLRELRERRNSVATTKKITRAMELIASSRIIKAQNTVKAAGPYSLELTRALSAVA
ATPG_LEPIC       ---MATPREIKKRINSVKNTRKITRTMEMVSTAKSKKISDRVNASHPFSNKIKELVSSLA
ATPG_RHOBA       ---MANARALDKRRKSIRNIRKITRTMELIATARYKKAMDRAAAATAYTEQITKIVSRLA
ATPG_ACIAD       ---MANLKEIRAKVASIKSTQKITRAMQMVAASKMRRAQERMAQGRPYADNMRRVIAHLV
ATPG_PSYA2       ---MASLKEIRAKVTSIKSTQKITRAMQMVAASKMRRAQERMEVGRPYADSMRRVISHLV
ATPG_LEGPL       ---MAGAKEIRSKISSINKTRKITRAMEMVAASKMRKTQERMRASKPYANKIYEVIKHIA
ATPG_LEGPH       ---MAGAKEIRSKISSINKTRKITRAMEMVAASKMRKTQERMRASKPYANKIYEVIKHIA
ATPG_LEGPA       ---MAGAKEIRSKISSINKTRKITRAMEMVAASKMRKTQERMRASKPYANKIYEVIKHIA
ATPG_PSE14       ---MAGAKEIRSKIASIKSTQKITSAMEKVAVSKMRKAQMRMAASRPYAERIRQVIGHLA
ATPG_PSEU2       ---MAGAKEIRSKIASIKSTQKITSAMEKVAVSKMRKAQMRMAASRPYAERIRQVIGHLA
ATPG_PSEF5       ---MAGAKEIRSKIASIKSTQKITSAMEKVAVSKMRKAQMRMAASRPYAERIRQVIGHLA
ATPG_PSEPK       ---MAGAKEIRSKIASIKSTQKITSAMEKVAVSKMRKAQMRMAASRPYAERIRQVIGHLA
ATPG_PSEAE       ---MAGAKEIRSKIASIKSTQKITNAMEKVAVSKMRKAQMRMAAGRPYAERIRQVIGHLA
ATPG_METCA       ---MAVGKEIRIKIASVRNTQKITRAMEMVAASKMRRTQDRLQATRPYARKIARIIKHLA
ATPG_COXBU       ---MSKAREIRTKIASIKNTQKITRAMELVAASKMRKAQDRMAMSRPYASKIRKVISHVA
ATPG_COLMA       ---MAVGKEIKTKIASVKGTQKITSAMEMVAASKMRKAQEGMAASRPYATNIRNVIGHIA
ATPG_COLP3       ---MAVGKEIKTKIASVKNTQKITSAMEMVAASKMRKAQEGMAASRPYATNIRNVIGHIA
ATPG_SHEON       ---MAGAKEIKTKIASVKNTQKITSAMEMVAASKMRRAQERMAASRPYAESMRKVIGHVA
ATPG1_PHOPR      ---MASAKEIRNKIGSVQNTQKITKAMEMVAASKMRKTQDAMESSRPYAETMRKVIGHIA
ATPG_ALIF1       ---MAGAKEIRNKIGSVKSTQKITKAMEMVAASKMRRSQESMEASRPYADTMRKVIGHLA
ATPG_VIBVU       ---MAGAKEIRSKIGSVKSTQKITKAMEMVAASKMRRSQDAMEASRPYAETMRKVIGHVA
ATPG_VIBVY       ---MAGAKEIRSKIGSVKSTQKITKAMEMVAASKMRRSQDAMEASRPYAETMRKVIGHVA
ATPG_VIBAL       ---MAGAKEIRNKIGSVKSTQKITKAMEMVAASKMRRSQDAMEASRPYAETMRKVIGHVA
ATPG_VIBCH       ---MAGAKEIRTKIGSVKSTQKITKAMEMVAASKMRRSQDAMESSRPYAQTIRKVIGHVA
ATPG_PECAS       ---MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQERMAASRPYAETIRNVIGHLA
ATPG_YERPS       ---MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQERMAASRPYAETMRSVIGHLA
ATPG_ECOLI       ---MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLA
ATPG_ECO57       ---MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLA
ATPG_ECOL6       ---MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLA
ATPG_SHIFL       ---MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLA
ATPG_SALCH       ---MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLA
ATPG_SALTY       ---MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLA
ATPG_SALPA       ---MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLA
ATPG_PHOLL       ---MAGAKEIRTKIASVQNTQKITKAMEMVAASKMRKTQDRMAASRPYAETIRSVIGHLA
ATPG2_PHOPR      ---MANAKEIRTKIASVQNTQKITSAMEMVAASKMRKVQDNMAATRPYAENMRKVISHVA
ATPG_IDILO       ---MASGKEIKTQISSIGNTQKITSAMEMVAASKMKKAQERMEASRPYADTIRKVIGHVA
ATPG_HAEIN       ---MAGAKEIKTKIASVQSTQKITKAMEMVATSKMRKTQDRMAASRPYSETIRNVISHVS
ATPG_HAEI8       ---MAGAKEIKTKIASVQSTQKITKAMEMVATSKMRKTQDRMAASRPYSETIRNVISHVS
ATPG_MANSM       ---MASGKEIKTKIASVQSTQKITKAMEMVATSKMRKTQDRMAASRPYSETIRNVISHVS
ATPG_PASMU       ---MAGAKEIRTKIASVKSTQKITKAMEMVAASKMRKTQERMSSSRPYSETIRNVISHVS
ATPG_HAEDU       ---MAGAKEIRTKIASVRNTQKITKAMEMVATSKMRKTQERMAAGRPYSETIRKVISHIA
ATPG_ACIFR       ---MANAKEIRGQIKSVKNTRKITRAMEMVAASKMRRAQERMRAARPCAEKIREVLGHLA
ATPG_AROAE       ---MASGKEIRTKIKSVQNTRKITKAMEMVAASKMRKAQDRMRAARPYAEKIRRLAANLS
ATPG_DECAR       ---MPSGKEIRNKIKSVENTRKITKAMEMVAASKMRKAQDRMRAARPYGEKIRRVAGNLS
ATPG_BORBR       ---MPGIKEIRTKIKSVQNTRKITKAMEMVAASKMRKAQERMRAGRPYATKVREIAAHLM
ATPG_BORPE       ---MPGIKEIRTKIKSVQNTRKITKAMEMVAASKMRKAQERMRAGRPYATKVREIAAHLM
ATPG_BURMA       ---MAGMKEIRGKIKSVQNTRKITKAMEMVAASKMRRAQERMRAARPYAEKVRAIAAHMS
ATPG_BURPS       ---MAGMKEIRGKIKSVQNTRKITKAMEMVAASKMRRAQERMRAARPYAEKVRAIAAHMS
ATPG_CUPPJ       ---MAGTKEIRTKIKSVQNTRKITKAMEMVAASKMRKAQERMRNARPYAEKVRNIAAHLA
ATPG_RALSO       ---MAGTKEIRTKIKSVQNTRKITKAMEMVAASKMRRAQERMRSARPYAEKIRNVAAHMA
ATPG_NITEU       ---MPSSREIRNKIKSVKNTQKITRAMEMVAASKMRKAQDRMKKARPYGEKIRNVAAHMS
ATPG_XANAC       ---MAGGREIKTKIKSVQNTRKVTRALEMVSASKIRKAQERMKTSRPYAQAMKQVIGHLA
ATPG_XANOR       ---MAGGREIKTKIKSVQNTRKVTRALEMVSASKIRKAQERMKTSRPYAQAMKQVIGHLA
ATPG_XANCP       ---MAGGREIKTKIKSVQNTRKVTRALEMVSASKIRKAQERMKTSRPYAQAMKQVIGHLA
ATPG_XANC8       ---MAGGREIKTKIKSVQNTRKVTRALEMVSASKIRKAQERMKTSRPYAQAMKQVIGHLA
ATPG_XYLFA       ---MASGREIKSKIKSVQNTRKVTRALEMVSASKIRKAQEQMKISRPYAQAMKQMTGHLA
ATPG_XYLFT       ---MASGREIKSKIKSVQNTRKVTRALEMVSASKIRKAQEQMKISRPYAQAMKQMIGHLA
ATPG_NEIG1       ---MAVGKEILTKIRSVQNTQKITKAMQMVSTSKMRKTQERMSLARPYAEKVRMVMSHLA
ATPG_NEIMA       ---MAVGKEILTKIRSVQNTQKITKAMQMVSTSKMRKTQERMRLARPYAEKVRMVMSHLA
ATPG_CHRVO       ---MAVGKEILTKIRSVQNTQKITRAMQMVSTSKMRKTQERMRAARPYAEKVRTVMAHLA
ATPG_BUCAI       ---MTSTKEIKNKIVSVTNTKKITKAMEMVAVSKMRKTEERMRSGRPYSDIIRKVIDHVT
ATPG_BUCAP       ---MASKKEIKDQIISVTNTKKITKAMEMVAVSKMRKTEERMRLGRPYSEIIKKVIHHVL
ATPG_BUCDN       ---MASIKEIKTQITSVVNTKKITKAMEMVAISKMRKTEERMSSGRPYSEIIRKVINHVA
ATPG_BUCMH       ---MSEIKEVRNKIKCITNTQKITKAMEMVSISKMKKAEVKMNSGRPYLKTIKEIINNFI
ATPG_BUCSC       ---MSEKKEIKNKINCISNTKKITKAMEMVSIAKMKKSEIKMKSRKPYLDIIKTIISHIL
ATPG_BUCBP       ---MIGIREIRSKMKSINNTKKITKAMEMVSISKLRKIKKRMCSSRPYFNIINQVISHVI
ATPG_WIGBR       ---MYNIKDIRQKIIGIKKTQSITSAMEKISAIKMKKSQNLLNSTKPYYEKISLLLNKLL
ATPG_FRATT       ---MSNAREIRSKVQSVKNTQKITGAMELVAASKMRGAIVKMNNVRPYVESANTIIKNVT
ATPG_NOSS1       ---MPNLKSIRDRIQSVKNTKKITEAMRLVAAARVRRAQEQVIATRPFADRLAQVLYGLQ
ATPG_SYNP6       ---MANLKAIRDRIKSVRNTRKITEAMRLVAAAKVRRAQEQVLSTRPFADRLAQVLAGLQ
ATPG_SYNP1       ---MPNLKAIRDRIKTIKDTRKITEAMRLVAAAKVRRAQEQVMASRPFADRLAQVLYGLQ
ATPG_SYNY3       ---MPNLKAIRDRIQSVKNTKKITEAMRLVAAAKVRRAQEQVLSTRPFADALAQVLYNLQ
ATPG_ARTPT       ---MSNLKAIRDRIQSVKNTKKITEAMRLVASAKVRRAQEQVLATRPFADRLAGVLYGLQ
ATPG_PROMA       ---MANLKEIRDRIVSVKNTRKITEAMRLVAAAKVRRAQEQVLRSRPFADRLARVLENIQ
ATPG_PROMM       ---MANLKDIRDRIVSVKNTRKITEAMRLVAAAKVRRAQEQVLRSRPFADRLARVLENIQ
ATPG_PROMP       ---MANLKEIRDRIVSVKNTRKITEAMRLVAAAKVRRAQDQVLKSRPFADKLARVLENIQ
ATPG_SYNPX       ---MANLKEIRDRIKSVKNTRKITEAMRLVAAAKVRRAQEQVLRSRPFADRLARILENLQ
ATPG_GLOVI       ---MPNLRGIRDRIKSVKNTQKITKAMRLVAAARVRRAQEQVLAGRPFADRLVGLLFRLR
ATPG_PARUW       ---MASLREIRKRLQSIQNIQQLTKAMEMVAASRLHQVQIKVKQAKPYVVKLSEILDRLS
ATPG_DESPS       ---MPSLKEVKTKITGVKKTSQITKAMNMVAASRLRGAQDKMESFRPYASKFSEAMSNLS
ATPG_DESVH       ---MPSLKDVKVKIAGVKKTKQITKAMNMVASAKLRGAQQRIERFRPYAEKFYGMLGDLA
ATPG_AQUAE       -MAKLSPRDIKRKIQGIKNTKRITNAMKVVSAAKLRKAQELVYASRPYSEKLYELVGHLA
ATPG_MOOTA       ---MAHMRDLKRRIRSVQSTQHITRAMKMVAAAKLRKAQAQVTAARPYAAKLEEVVGRLM
ATPG_SYMTH       --MAENKKAVQRRIRAVKSTQQITKAMKMVDAAKLRRAQEKVQNARPYSRELAKTLGRLI
ATPG_AGRFC       ---MPSLKDLKNRIASVKATQKITKAMKMVAAAKLRRAQEAAEAARPYSQRMSAVLANIA
ATPG_RHIME       ---MPSLKDLKNRIASVKATQKITKAMKMVAAAKLRRAQEAAEAARPYSQRMAAVLANIA
ATPG_BRUAB       ---MPSLKDLRNRIASVKATQKITKAMQMVAAAKLRRAQEAAEAARPYSQRMGAVLANIA
ATPG_BRUME       ---MPSLKDLRNRIASVKATQKITKAMQMVAAAKLRRAQEAAEAARPYSQRMGAVLANIA
ATPG_BARHE       ---MASLKDLRDRIASVKATQKITKAMQMVAAARLHRAQEAAHSARPYAKRMAAILANLA
ATPG_BARQU       ---MASLKDLRDRIASVKATQKITKAMQMVAAARLHRVQEAAQSARPYAQRMAAILANVA
ATPG_RHOPA       ---MASLKDMRVRIASTKATQKITKAMQMVAASKLRRAQMAAEAARPYAEKMEAVISNIA
ATPG_RHOBL       ---MPSLKDLKNRIGSVKNTRKITKAMQMVAAAKLRRAQDSAEAARPYAERMGAVIASLA
ATPG_RUEPO       ---MPNLKDLKNRIASVKSTRKITKAMQMVAAAKLRRAQESAEAARPYAERFNAVMAGLA
ATPG_RHOCA       ---MPSLKDLKNRIVSVKNTRKITKAMQMVAAANIRRAQESAEAARPYAERMNAVMSSLA
ATPG_CAUVC       ---MASLKEMRNRISSVKATQKITKAMQMVAAAKLRRSQDAAESARPYARRLASVIANLA
ATPG_GLUOX       ---MASLKELRGRITGVKSTRKITNAMKMVAASKLRRAQMQAEAARPYADAMRRMMAELA
ATPG_RHORU       ---MASLKDLRSRITSVKSTQKITSAMKMVAASRLRRAQDTAEAARPYTQRMERMLGNLA
ATPG_PELUB       ---MATLDDLKKRIASVKSTQKITKAMKMVAAAKLRRAQENAEKGRPYSEKMNNIILNLS
ATPG_ZYMMO       ---MPSLKSLKTRVSSIKSISKITRAMQMVASAKLRRAESRLAAARPYAKRMAQVMSLLA
ATPG_HELHP       --MGGNLKNIKRQISSTKNTQKTTKAMKLVSSSKLKKAEELARRSKVYAKQLSAVFHDVV
ATPG_WOLSU       --MGSNLKEIRKKITSVKNTQKTTKAMKLVSTSKLKKAEEMAKRSRVYAERITAVFQEIK
ATPG_HELPY       ---MANLRDIRKKIGSVKNTQKITHAMKLVSTSKLRKAEEVARNSRAYALKLDAVFDDVL
ATPG_HELPJ       ---MANLRDIRKKIGSVKNTQRITHAMKLVSTSKLRKAEEVARNSRAYALKLDAVFDDVL
ATPG_CAMJR       ---MSNLKEIKRKIKSVHNTQKTTNAMKLVSTAKLKKAEEAAKRSKIYAQKIDEILSEIS
ATPG_RICPR       ---MSNLKQLRTRIKSVKSTQKITKAMQLVSASKMTKIKTQIANSNFYIEAINKMMSDIC
ATPG_BDEBA       ---MASLKDIRAQIESTKNTQQITKAMKLVSAAKLRKAQNNIVNMRPYALALRQVIADIA
ATPG_MESFL       ---MANLSNLKTQISNTQDIGKITNAMQLVASAKLRRIGKKVTETQEYVSEVYAIFNEII
ATPG_MYCMS       ---MPNLKGLKTEILSVKNISRITNAMQLVALAKLRKISKKVIDTHNYVSEVYSLFNDII
ATPG_MYCPU       ---MPSLQKTKNRIALIDNIKKITKAMELVATSKMKKTQKHFLEVNEFSQSVLDIFSKIV
ATPG_MYCS5       ---MSNLINIKNRINVVTNTRKITNAMQLVSTSKLHRIINLTKNIKAYQNLVETTFDNIV
ATPG_MYCGE       ---MAFIQEIKRRMNTVKSTIKITNAMKMVSRAKFIKFKKQFQEISLFFNEFYKAVGQVV
ATPG_MYCPN       ---MAFIQEIKRKMTTVQSTIKITNAMKMVSRAKFVRFKKQFKEVNYFFNEFYKAVGQVV
ATPG_MYCGA       ---MASMQDLKRRMESITVTHKITKAMKMLSTVKLNRFKATLGKTKEFYQEFYEVIGAVI
                             .          * :   :                              

ATPG_CLOAB       SSS-----------------------------SKSNLYVAGNK-----SDKKLYIALTSD
ATPG_CLOPA       SGI-----------------------------LGENIYTNGNG-----SKEKLYITMTSD
ATPG_CLOPE       GSLN----------------------------SNNNPLLKPND-----NPKKLIILLASD
ATPG_ACEWD       EKSGNA----------------------------RNIFMDQR-----EVKKTAYIIITGD
ATPG_RUMA7       -RDHEF----------------------------TSVFTKKK-----FKNSVLLIVIAGD
ATPG_CALS4       LHTGEV----------------------------TSRYLEKKDVPEKQDKRKVFLIVTGD
ATPG_BACFR       SADLPV----------------------------ESPFCVER-----PVMRVAIVAFSSN
ATPG_BACFN       SADLPV----------------------------ESPFCVER-----PVKRVAIVAFSSN
ATPG_BACTN       SADLPV----------------------------ESPYIKAR-----EVKRVAIVAFSSN
ATPG_BACCA       S-AAR-----------------------------SHPMLVSR-----PVKKTGYLVITSD
ATPG_GEOSE       S-RGR-----------------------------SHPMLVSR-----PVKKTGYLVITSD
ATPG_BACP3       L-AARA----------------------------SHPMLVSR-----PVKKTGYLVITSD
ATPG_GEOKA       LGAGGA----------------------------SHPMLVSR-----PVKKTGYLVITSD
ATPG_BACMQ       LGSRGA----------------------------SHPMLTAR-----SVKKTGYIVITSD
ATPG_BACLD       -VGYTG----------------------------KHPMMSSR-----PVKRTGYLVITAD
ATPG_BACSU       RVSGNV----------------------------KHPMLLSR-----EVKKTAYLVITSD
ATPG_BACC1       QGSKGI----------------------------NHPMLNAR-----PVKRTGYIVITSD
ATPG_BACCR       QGSKGI----------------------------NHPMLNAR-----PVKRTGYIVITSD
ATPG_BACCZ       QGSKGI----------------------------NHPMLNAR-----PVKRTGYIVITSD
ATPG_BACHK       QGSKGI----------------------------NHPMLNAR-----PVKRTGYIVITSD
ATPG_BACHD       ASDTDV----------------------------SHPMLEER-----PVKKTGYIVITSD
ATPG_BACPE       SSGTEI----------------------------SHPMLEER-----PVKKTGYIVVTSD
ATPG_BACSK       QAGSDT----------------------------SHPMLEER-----PVKKTGYILMTSD
ATPG_OCEIH       NANTDA----------------------------QHPMLMKR-----EVKKTGYLIITSD
ATPG_LISIN       STGNSS----------------------------DHPMLVSR-----PVHRTGYIVLTSD
ATPG_LISMO       STGNSS----------------------------DHPMLVSR-----PVHRTGYIVLTSD
ATPG_LISMF       STGNSS----------------------------DHPMLVSR-----PVHRTGYIVLTSD
ATPG_STAAM       GASSNT----------------------------NHPMLRPR-----KITRSGYLVITSD
ATPG_STAAW       GASSNT----------------------------NHPMLRPR-----KITRSGYLVITSD
ATPG_STAAN       GASSNT----------------------------NHPMLRPR-----KITRSGYLVITSD
ATPG_STAHJ       GASKNS----------------------------SHPMLRPR-----QVQRSGYLVITSD
ATPG_STAES       GSNSTS----------------------------NHPMLKSR-----DIKRSGYLVITSD
ATPG_STAEQ       GSNSTS----------------------------NHPMLKSR-----DIKRSGYLVITSD
ATPG_STAS1       GSDKNS----------------------------RHPMLQQR-----EVKKSAYLVITSD
ATPG_ENTFA       AAQLSELRE---------------TEQSSLSEGNYHVMLAQR-----PVKKTGYIVITSD
ATPG_ENTHA       ATQLNDIAS---------------DNPR--GDINYNSMLISR-----PVKKTGYIVITAD
ATPG_STRA3       KSDLV--------------------------SGSDNPMLASR-----PVKKTGYIVITSD
ATPG_STRA5       KSDLV--------------------------SGSDNPMLSSR-----PVKKTGYIVITSD
ATPG_STRP1       KSELT--------------------------IGSDNPMLVSR-----PVKKTGYIVITSD
ATPG_STRP8       KSELT--------------------------IGSDNPMLVSR-----PVKKTGYIVITSD
ATPG_STRP6       KSELT--------------------------IGSDNPMLVSR-----PVKKTGYIVITSD
ATPG_STRP3       KSELT--------------------------IGSDNPMLVSR-----PVKKTGYIVITSD
ATPG_STREI       KSELV--------------------------NGSKNPMLAAR-----PVKKTGYIVITSD
ATPG_STRMU       HSDLR--------------------------KGSSNPMLISR-----PIKKTAYIVITSD
ATPG_STRTR       HSELV--------------------------NGSSNPMLDAR-----PVRKSGYIVITSD
ATPG_STRT2       HSELV--------------------------NGSSNPMLDAR-----PVRKSGYIVITSD
ATPG_STRT1       HSELV--------------------------NGSSNPMLDAR-----PVRKSGYIVITSD
ATPG_STRPN       HGNGA--------------------------GASTNPMLISR-----SVKKTGYIVITSD
ATPG_STRR6       HGNGA--------------------------GASTNPMLISR-----SVKKTGYIVITSD
ATPG_STRSA       HGHEAE-------------------------NARHHSMLISR-----PVKKSAYIVITSD
ATPG_LACLM       SSDNE---------------------------PAKNPMMIKR-----EVKKTGYLVITSD
ATPG_LACLA       SSDKE---------------------------PAKNPMMIKR-----EVKKTGYLVITSD
ATPG_LACAC       SSQVVDSLR-ERDISIDKNNISKIDYTDVFGLGITADMIQPRK----NIKTTGFLVVTGD
ATPG_LACJO       SSQIVNQLGKETNEYSEFSGQSNIDYSSFFDLGTLASLVQPRK----EIKSTGYLVISGD
ATPG_LACPL       KAHLMSASA--------------GVANSNSNTISVSELLAQR-----PVKKTGLLVITSD
ATPG_OENOE       AAHLLEHQN--------------GSS---------IPFITQR-----PVKTTAILVITSD
ATPG_COREF       SASS-----------------------------LDHPMLRERE----GGKRAAVLVVSSD
ATPG_CORGL       SASS-----------------------------LDHPMLRERE----GGKRAAVLVVTSD
ATPG_CORDI       AASS-----------------------------LEHPMLRERE----GGKRAAVLVVSSD
ATPG_CORJK       AAST-----------------------------LDHKILQEPT----DASRAAILVVSSD
ATPG_MYCBO       AEAA-----------------------------LDHPLLVERP----EPKRAGVLVVSSD
ATPG_MYCTU       AEAA-----------------------------LDHPLLVERP----EPKRAGVLVVSSD
ATPG_MYCPA       AEAA-----------------------------LDHPLLVERP----EPKRAGVLVVSSD
ATPG_MYCLE       YEAV-----------------------------LDHPLLVASA----TPKRAGVLVVSSD
ATPG_NOCFA       SASKN----------------------------LSHPLLTERP----NPRRAAVLVITSD
ATPG_STRCO       TGSN-----------------------------TKHPLTTEAD----SPSRAAVLLLTSD
ATPG_STRLI       TGSN-----------------------------TKHPLTTEAD----SPSRAAVLLLTSD
ATPG_STRAW       TGSN-----------------------------TKHPLTTQAE----TVTRSAVLLLTSD
ATPG_LEIXX       TYSN-----------------------------VGHVLTTEPE----KIERAVIVIFSSD
ATPG_CUTAK       AHTH-----------------------------EEHPLTSMNP----DPKRSAVLVITSD
ATPG_LEPIC       SLGGV----------------------------VHSPYLRRPE----KIKTVALLIITAN
ATPG_RHOBA       DAGLD----------------------------VQHPLLEQRE----KINTTRVLVLASN
ATPG_ACIAD       QA-NPE---------------------------YKHRYMVDRP-----VKRVGYIVVSSD
ATPG_PSYA2       HA-SSD---------------------------YKHPYMVNRP-----VNKVGYIVITSD
ATPG_LEGPL       RA-ASE---------------------------YRHPFMSERE-----IKRIGIIVVTTD
ATPG_LEGPH       RA-ASE---------------------------YRHPFMSERE-----IKRIGIIVVTTD
ATPG_LEGPA       RA-ASE---------------------------YRHPFMSERE-----IKRIGIIVVTTD
ATPG_PSE14       NA-NPE---------------------------YRHPFMIERP-----VKRVGYVVVSSD
ATPG_PSEU2       NA-NPE---------------------------YRHPFMIERP-----VKRVGYVVVSSD
ATPG_PSEF5       NA-NPE---------------------------YRHPFMIDRA-----IKRVGYVVVSSD
ATPG_PSEPK       NA-NPE---------------------------YRHPFMIERP-----VKRAGYIVVSSD
ATPG_PSEAE       NA-NPE---------------------------YRHPFMVERE-----VKRVGYIVVSSD
ATPG_METCA       QA-NPE---------------------------YKNPFMVERP-----VKRVGVVLVSSD
ATPG_COXBU       AS-HAE---------------------------YPHPYLQQRE----NIKRVGYIIVTTD
ATPG_COLMA       LG-NLE---------------------------YRHPYMDERE-----AKRVGYIVVSSD
ATPG_COLP3       LG-NLE---------------------------YRHPYMEERE-----TKRVGYIVVSTD
ATPG_SHEON       QG-SLE---------------------------YKHPYLEVRE-----AKRVGYIVVATD
ATPG1_PHOPR      LG-NLE---------------------------YKHPYLEVRE-----AKRVGYIIVSSD
ATPG_ALIF1       LG-NLE---------------------------YRHPYLEERE-----AKRVGYIVISSD
ATPG_VIBVU       NA-SLE---------------------------YRHPYLDERE-----AKRVGYIIISTD
ATPG_VIBVY       NA-SLE---------------------------YRHPYLDERE-----AKRVGYIIISTD
ATPG_VIBAL       NA-NLE---------------------------YRHPYLEERE-----AKRVGYIIVSTD
ATPG_VIBCH       NA-SLE---------------------------YRHPYLEERE-----AKRVGYIIISTD
ATPG_PECAS       LG-NLE---------------------------YKHPYLEERG-----VKRVGYLVVSTD
ATPG_YERPS       LG-NLE---------------------------YKHPYLEERD-----VKRVGYLVVSTD
ATPG_ECOLI       HG-NLE---------------------------YKHPYLEDRD-----VKRVGYLVVSTD
ATPG_ECO57       HG-NLE---------------------------YKHPYLEDRD-----VKRVGYLVVSTD
ATPG_ECOL6       HG-NLE---------------------------YKHPYLEDRD-----VKRVGYLVVSTD
ATPG_SHIFL       HG-NLE---------------------------YKHPYLEDRD-----VKRVGYLVVSTD
ATPG_SALCH       NG-NLE---------------------------YKHPYLEERD-----VKRVGYLVVSTD
ATPG_SALTY       NG-NLE---------------------------YKHPYLEERD-----VKRVGYLVVSTD
ATPG_SALPA       NG-NLE---------------------------YKHPYLEERD-----VKRVGYLVVSTD
ATPG_PHOLL       LG-NLE---------------------------YKHPYLEERE-----TKRVGYLVVSTD
ATPG2_PHOPR      SG-SLE---------------------------YKHPYLEERE-----AKRVAYIIISSD
ATPG_IDILO       RG-NLE---------------------------YRHPFMEERQ-----VKRVGYIIVSTD
ATPG_HAEIN       KA-SIG---------------------------YKHPFLVERE-----VKKIGILVISTD
ATPG_HAEI8       KA-SIG---------------------------YKHPFLVECE-----VKKIGILVISTD
ATPG_MANSM       KA-SIG---------------------------YKHPFLVERE-----VKKVGMLVISTD
ATPG_PASMU       KA-TIG---------------------------YKHPFLVDRE-----VKKVGMIVVSTD
ATPG_HAEDU       KG-SIG---------------------------YKHPFLIERD-----VKKVGYLVISTD
ATPG_ACIFR       QA-HPE---------------------------YEHPLMQVRP-----VKKAGFLVVTTD
ATPG_AROAE       QANVTD---------------------------YKHAFLVQKD----EVKRVGLILVTTD
ATPG_DECAR       HA-LTE---------------------------YRHPFLVNR-----EQAAVGLILVTSD
ATPG_BORBR       QA-NPE---------------------------YSHPYLVERE-----VKAVGVVLVTTD
ATPG_BORPE       QA-NPE---------------------------YSHPYLVERE-----VKAVGVVLVTTD
ATPG_BURMA       RA-NPE---------------------------YRHPFMVAND----GVKTAGMILVTTD
ATPG_BURPS       RA-NPE---------------------------YRHPFMVAND----GVKTAGMILVTTD
ATPG_CUPPJ       SA-NPE---------------------------FKHPFMQERE-----VKRVGMIVVTTD
ATPG_RALSO       QA-NPE---------------------------YQHPFMVKRD-----VKRAGLIVVTTD
ATPG_NITEU       NA-SVE---------------------------YRHPFLISRD----SVKRVGIIVVTSD
ATPG_XANAC       QA-STD---------------------------FQHPFLIERE----QVKRVGYIVISSD
ATPG_XANOR       QA-STD---------------------------FQHPFLIERE----QVKRVGYIVISSD
ATPG_XANCP       QA-STD---------------------------YQHPFLVERE----QVKRVGYIVISSD
ATPG_XANC8       QA-STD---------------------------YQHPFLVERE----QVKRVGYIVISSD
ATPG_XYLFA       QA-NTD---------------------------YLHPFLIAHK----QVKRIGYIVISSD
ATPG_XYLFT       QA-NTE---------------------------YLHPFLIAHK----QVKRIGYIVISSD
ATPG_NEIG1       QT-NTD---------------------------HGIPLLESHR----EIRRVGFILITSD
ATPG_NEIMA       QT-NTD---------------------------HGIPLLESHR----EIRRVGFILITSD
ATPG_CHRVO       QA-NAE---------------------------LGHPLLARRE----TIKRAGIILVSSD
ATPG_BUCAI       QG-NLE---------------------------YKHSYLEERK-----TNRIGMIIISTD
ATPG_BUCAP       QG-SLE---------------------------YKHSYLEKRN-----DKRIGIIIVSTD
ATPG_BUCDN       QG-HLE---------------------------YKHSYLETRK-----IKRIGLIIVSSD
ATPG_BUCMH       SN-NTR---------------------------YQHVYLEQRA-----VKKIGIIIISTD
ATPG_BUCSC       YN-HIK---------------------------YRHLYLNNRK-----TKKIGIIVISTD
ATPG_BUCBP       TG-NLE---------------------------HYHTYFNQRN-----VKRIGVIIVSTD
ATPG_WIGBR       FQ-NIK---------------------------YKHPYLKKRQ-----IKCIGYIVVSTD
ATPG_FRATT       AA-SID---------------------------YPNPYLFDRD-----VKRVGYIVISTD
ATPG_NOSS1       TRLRFE---------------------------DVDLPLLKKR----EVKSVGLLVISGD
ATPG_SYNP6       QRLQFE---------------------------NVDLPLLQRR----EVKTVALLVVSGD
ATPG_SYNP1       TRLRFE---------------------------DANLPLLAKR----PVKTVALLVVTGD
ATPG_SYNY3       NRLSFA---------------------------ETELPLFEQR----EPKAVALLVVTGD
ATPG_ARTPT       GRLQFE---------------------------DVECPLLQQR----EVKKVGLVVLAGN
ATPG_PROMA       SRMKFE---------------------------AADSPLLKAR----AVQKVTLLAVTGD
ATPG_PROMM       SRMSFE---------------------------MADAPLLKTS----DLKTITLLAVTGD
ATPG_PROMP       SRVQFE---------------------------AVDSPLLSKR----NVKKISLVCITAD
ATPG_SYNPX       SRMRFE---------------------------DASSPLMEQR----DVETITLVSVTGD
ATPG_GLOVI       SRLRFE---------------------------DVQSPLMERR----DVQKVLVLVIAGD
ATPG_PARUW       QITQ-----------------------------DIKHPLLEQR----EVKKVGVVIVAAD
ATPG_DESPS       GGGNTN---------------------------AFPLMDVRD------VKTVELIVVTSD
ATPG_DESVH       SKADGS---------------------------AHPLLEVRDE-----IKTCGIVLATSD
ATPG_AQUAE       AHVDTE---------------------------DNPLFDVRE------ERNVDVILVTAD
ATPG_MOOTA       AAVDPE---------------------------TQPLAATRE------VKKAGYVLITAD
ATPG_SYMTH       QAGAGI---------------------------DHPLLHRRTE----GTPTVAYVLLTAD
ATPG_AGRFC       TAVEAD---------------------------VAPALMTGTG----KDDVHLLVVCTAE
ATPG_RHIME       QAVGAD--------------------------DSAPRLMTGTG----RDDTHLVIVCTAE
ATPG_BRUAB       QNVSGE---------------------------DAPALMVGTG----KDDVHLLVVCTAK
ATPG_BRUME       QNVSGE---------------------------DAPALMVGTG----KDDVHLLVVCTAK
ATPG_BARHE       NDVDPI---------------------------DAPSLMRGTG----RDDVHLLVVCTAE
ATPG_BARQU       TDVDTI---------------------------DVPPLMRGTG----RNDVHLLVVCTAE
ATPG_RHOPA       GAAAGS--------------------------PGAPVLLAGNG----KDQVHLLLVCTGE
ATPG_RHOBL       SGQG----------------------------AGAPRLLAGNG----RDQIHLLVVMTSE
ATPG_RUEPO       ASVGGS--------------------------DSAPLLLRGTG----SDQVHLLVVMTAE
ATPG_RHOCA       GAVGST--------------------------DGAPRLLAGTG----SDKVHLLVIMTGE
ATPG_CAUVC       AGVSGD---------------------------GAPKLLAGTG----RDDRHLVVVAAAD
ATPG_GLUOX       MATRGE------D------------------AASLPRLLAGTG----KDQTHLVVVLTSD
ATPG_RHORU       ASTAGM------A------------------GAS--PLLGGTG----KDNVHLIVALTAN
ATPG_PELUB       SGISDK--------------------------ENAPKLLSGTG----EDKVHLCIVLTSD
ATPG_ZYMMO       ARAAGT--------------------------PNALPLLNGRG----KDQTHLLIVTSSD
ATPG_HELHP       AKIRV--RGLDN-------------------INSRYFAKSEGR----EIKKLDIIFITAD
ATPG_WOLSU       AKIEQ--NGFSG-------------------LESPYFTAGEDR----EVKMVDIVFVTAD
ATPG_HELPY       SKMKN--QGIED-------------------IQSKYFRELERL----EIKKVDIIFITAD
ATPG_HELPJ       SKMKN--QGIED-------------------IQSKYFRELERL----EIKKVDIIFITAD
ATPG_CAMJR       FQINKIVHNEDD-------------------VRLSLFHKKE------QIKTVDLIFITAD
ATPG_RICPR       SMTSC------E-------------------LSIEEQKFFNTM----PSKINLLIVMTSE
ATPG_BDEBA       VTNKV---------------------------SHPLMEKKE------QVKNVLLVVITSD
ATPG_MESFL       KHSSES----------------------------IYLKNSAND-----IKKTLWVVVNSN
ATPG_MYCMS       SQVDKS----------------------------VFLKDSNFE-----TKKTLWIVINSN
ATPG_MYCPU       SQIDPQ----------------------------IKLYPDGQ------KNSTLYIVISSD
ATPG_MYCS5       SKITQEEL--------------------------NEIFPPKQE-----TDATLYIIVTSD
ATPG_MYCGE       VSLKEPK---------------------------KKPDNQ----------KTLWIMMSSS
ATPG_MYCPN       LSLKKMP---------------------------KPLENP----------KTLWVMMSSS
ATPG_MYCGA       TNYNKTK---------------------------PRTTTPTNQ-----STKRLWIVINTQ
                                                                       :    .

ATPG_CLOAB       SGLCGGFNGAVVTAADNVMRGDKDKS----LLITVGQKGISYFKRLKYETLSEYVDIPNE
ATPG_CLOPA       AGLCGGFNGNVVNAAVSEISKDRENS----LIMSVGQKGRGYFKRLQYDTIAEYVDIQNE
ATPG_CLOPE       SGLCGGFNGNTAAFVRDNYENNLENI----EAVVVGKKGIHYVKKNKISTLAEYVDLGDT
ATPG_ACEWD       KGLAGGYNVNVAKLVE---EHITDKE--NAVLFTVGSRGRDHFRNREYHIQGEYLGISER
ATPG_RUMA7       RGLAGGFNTNVLKLAKAKADAITESGG-EAVIMAIGKKAVEYFEKREYKLIDGFPQIAEG
ATPG_CALS4       KGLCGAYNHNVIKASI---ELIKNEK---ANLKVVGEVGRRYFIKKGYDVDRDFLYTAQN
ATPG_BACFR       SSLCGAFNANVLKMFLQTVGEYRELGQDNILIYPVGKKIEEAVKKLGFFPQGSYQKLADK
ATPG_BACFN       SSLCGAFNANVLKMFLQTVGEYRELGQDNILIYPVGKKIEEAVKKLGFFPQGSYQKLADK
ATPG_BACTN       TSLCGAFNANVIKMLLQTVGEFRTLGQDNILIFPVGKKVDEAVKRLGFEPQETSPTLSDK
ATPG_BACCA       RGLAGAYNSNVVRLVYPKRSKNAMLPPDEIAIIVIGRVGLSFFRKRNMPVILDITRLPDQ
ATPG_GEOSE       RGLAGAYNSNVVRLVYPKRSKNAMLPPDEYAIIVIGRVGLSFFRKRNMPVILDITRLPDQ
ATPG_BACP3       RGLAGAYNSNVLRLVYQTIQKRHASP-DEYAIIVIGRVGLSFFRKRNMPVILDITRLPDQ
ATPG_GEOKA       RGLAGAYNSNVLRLVYQTIQKRHASP-DEYAIIVIGRVGLSFFRKRNMPVILDITRLPDQ
ATPG_BACMQ       RGLAGAYNSNILRKVSQAIEERHQSP-DEYGVIAIGRVGRDFFVKRGIPVLLEITGLADQ
ATPG_BACLD       RGLAGAFNANVLRKAYQRIQERHQSK-DEYAVIAVGRMGRDFFKKRGIPVISEMTGIRDE
ATPG_BACSU       RGLAGAFNSSVLRSAYQAMQERHQSK-DEYAVIAIGRVGRDFFKKREIPIISELTGLGDE
ATPG_BACC1       RGLAGGYNSNVLRTVSNVIRERHNMDSNQYSIIVLGRLGRDYLKRRGFNIIDEVVGLSDH
ATPG_BACCR       RGLAGGYNSNVLRTVSNVIRERHNMDSNQYSIIVLGRLGRDYLKRRGFNIIDEVVGLSDH
ATPG_BACCZ       RGLAGGYNSNVLRTVSNVIRERHNMDSNQYSIIVLGRLGRDYLKRRGFNIIDEVVGLSDH
ATPG_BACHK       RGLAGGYNSNVLRTVSNVIRERHNMDSNQYSIIVLGRLGRDYLKRRGFNIIDEVVGLSDH
ATPG_BACHD       RGLAGAYNSNLIRGLLYTINKRHKSK-DEYGIFAIGRTGRDLLKKRQLPIISEMTGLSDQ
ATPG_BACPE       KGLAGGYNSSLIRSLLNTIKERHNSP-DEYGIIIMGRIGRDLFKKRGLPIIQEVIGLPDQ
ATPG_BACSK       TGLAGGYNSSLLRDMMKTINERHASE-DEYAIIVLGRIGRDLLRTRKQPIIQEMVEVPDQ
ATPG_OCEIH       RGLVGAYNSHILKNLVNTIEKNHTSK-DEYTIIVLGRKGYDYCRKRGLPVSKSVLGVPDH
ATPG_LISIN       TGLAGSYNSSVIKEVFQEINKKHTSS-DEYAIITVGRSARDFFKARQMNVVLEVQGITDH
ATPG_LISMO       TGLAGSYNSSVIKEVFQEINKKHTSS-DEYAIITVGRSARDFFKARQMNVVLEVQGITDH
ATPG_LISMF       TGLAGSYNSSVIKEVFQEINKKHTSS-DEYAIITVGRSARDFFKARQMNVVLEVQGITDH
ATPG_STAAM       KGLAGAYSANVLKKLITDIEAKHQDS-SEYSIVVLGQQGVDFLKNRGYDIEYSQVDVPDQ
ATPG_STAAW       KGLAGAYSANVLKKLITDIEAKHQDS-SEYSIVVLGQQGVDFLKNRGYDIEYSQVDVPDQ
ATPG_STAAN       KGLAGAYSANVLKKLITDIEAKHQDS-SEYSIVVLGQQGVDFLKNRGYDIEYSQVDVPDQ
ATPG_STAHJ       KGLAGAYSSNVLKRLINDIKEKHTSS-DEYSIIVLGQSGVDFLKNRGYEIENSLVDVPDQ
ATPG_STAES       KGLAGAYSTNVLKSLVNDINSKHNDS-SEYSLIVLGQQGVDFFKHRGYEIESSLVEVPDQ
ATPG_STAEQ       KGLAGAYSTNVLKSLVNDINSKHNDS-SEYSLIVLGQQGVDFFKHRGYEIESSLVEVPDQ
ATPG_STAS1       KGLAGAYNANVLKHLIKDIEEKHASK-DDYSIVVLGQTGVDFLKNKGYDIHDSLIDVPDQ
ATPG_ENTFA       KGLVGGYNSSILKQTMSMIQEDHDSN-KEYALIAIGGTGADFFKARGIDVSYELRGLTDQ
ATPG_ENTHA       GGLVGGYNSSILKQTMSILEEDHKSP-DDYVMIAIGGTGADFFKARGINLAYELRNLSDQ
ATPG_STRA3       KGLVGGYNSKILKAMMDTITDYHTEN-DDYAIISIGSVGSDFFKARGMNVSFELRGLEDQ
ATPG_STRA5       KGLVGGYNSKILKAMMDTITDYHTEN-DDYAIISIGSVGSDFFKARGMNVSFELRGLEDQ
ATPG_STRP1       KGLVGGYNSKILKSVMDMITEYHADG-D-YEIISIGSVGSDFFKARGMNVAFELRGLADQ
ATPG_STRP8       KGLVGGYNSKILKSVMDMITEYHADG-D-YEIISIGSVGSDFFKARGMNVAFELRGLADQ
ATPG_STRP6       KGLVGGYNSKILKSVMDMITEYHADG-D-YEIISIGSVGSDFFKARGMNVAFELRGLADQ
ATPG_STRP3       KGLVGGYNSKILKSVMDMITEYHADG-D-YEIISIGSVGSDFFKARGMNVAFELRGLADQ
ATPG_STREI       KGLVGGYNSKILKAMMDLIEEYHQDG-N-YAIIAIGGIGADFFKARGMNVVFELRGLEDQ
ATPG_STRMU       KGLVGAYNSTILKAVMDTIKDYHPKG-DDYTIISIGGMGSDFFRARHIPVAFELRGLEDN
ATPG_STRTR       KGLVGGYNSTILKAVLDMIKRDHDSE-DEYAIISIGGTGSDFFKARNMNVAFELRGLEDQ
ATPG_STRT2       KGLVGGYNSTILKAVLDMIKRDHDSE-DEYAIISIGGTGSDFFKARNMNVAFELRGLEDQ
ATPG_STRT1       KGLVGGYNSTILKAVLDMIKRDHDSE-DEYAIISIGGTGSDFFKARNMNVAFELRGLEDQ
ATPG_STRPN       RGLVGGYNSSILKAVMELKEEYHPDG-KGFEMICIGGMGADFFKARGIQPLYELRGLSDQ
ATPG_STRR6       RGLVGGYNSSILKAVMELKEEYHPDG-KGFEMICIGGMGADFFKARGIQPLYELRGLSDQ
ATPG_STRSA       RGLVGGYNATILKALMELKAEYHPTG-EDFEVICIGSVGADFFRARGIQPVYELRGLADQ
ATPG_LACLM       RGLVGSYNSNILKSVISNIRKRHTNE-SEYTILALGGTGADFFKARNVKVSYVLRGLSDQ
ATPG_LACLA       RGLVGGYNSNILKSVMNTIRKRHANE-SEYTILALGGTGADFFKARNVKVSYVLRGLSDQ
ATPG_LACAC       RGLVGSYNSSVIKNMMSIFDDERAQG-REVKVLAVGSVGAQFFKKNNVNVVYEKDGVSDV
ATPG_LACJO       RGLVGSYNSQVIKNMMSIFKDADAQN-KDVKILAVGSVAAQFFKKQNLNVVYEYSGVSDV
ATPG_LACPL       RGLVGSYNSNVLKQTNDFMRTHKVDA-DNAVVLAVGGTGADFYKKNGLNVAYEYRGVSDV
ATPG_OENOE       RGLVGGYNNQVLKRTDQIMREQKLTK-ENAVIFALGGKGSDYYAKRGFTIAFENRDITDV
ATPG_COREF       RGMAGGYNHNVFKKAAELEKLLAEQG-YEVVRYVTGSKGVGYYKFREDYVAGAWTGFSQD
ATPG_CORGL       RGMAGGYNHNVLKKAAELEKLLAESG-YEVVRYVTGKKGVDYYKFRAEDVAGTWTGFSQD
ATPG_CORDI       RGMAGGYNYNVFKKAAELEKLLEENG-YEVVRYVTGNKGVGYYKFRGQEVAGAWTGFSQD
ATPG_CORJK       RGMCGGYNNNVFKKTAELRKRLENEG-KDVVLYVSGNKGISYYNFRGEDIAGAWSGYSQD
ATPG_MYCBO       RGLCGAYNANIFRRSEELFSLLREAG-KQPVLYVVGRKAQNYYSFRNWNITESWMGFSEQ
ATPG_MYCTU       RGLCGAYNANIFRRSEELFSLLREAG-KQPVLYVVGRKAQNYYSFRNWNITESWMGFSEQ
ATPG_MYCPA       RGLCGAYNASIFRRAEELFSLLREQG-KTPVLYSVGRKALNYYTFRNWDISGSWTGFSEQ
ATPG_MYCLE       RGLCGAYNANVFRRSEELFSLLRAEG-KTPILYVVGRKALNYYTFRNWGIAESWTGFSEQ
ATPG_NOCFA       SGMCGGYNSNVLKRAEELMTTLRNEG-KEPVLYVMGAKGLTYYTFRNRPFVSAWTGFSQQ
ATPG_STRCO       RGLAGAFNSNSIKAAEQLTERLEREG-RQVDTYIVGRRGLAHYNFRERKVVESFAGFTDE
ATPG_STRLI       RGLAGAFNSNSIKAAEQLTERLEREG-RQVDTYIVGRRGLAHYNFRERKVVESFAGFTDE
ATPG_STRAW       RGLAGAFNSNAIKAAEQLTARLEAEG-REVDTYIVGRRGAAHYNFRERKVTELWTGFTDE
ATPG_LEIXX       RGLAGAFNSNVLKESEKLAELLRSQG-KEVVYFLIGRKAQGYFSFRRRAFERVWTGNTDA
ATPG_CUTAK       RGLAGAYSSNVIRTAEELTTALQPK--QEIATYLCGRKAVQYFEFRGRKVDHLWSGFSDS
ATPG_LEPIC       RGLCGGYNSNVNRMAKAKIQEWKKSG-VNVRLFIVGKKGISFFKFAGEKAEKTYTHLDDK
ATPG_RHOBA       RGLCGGYNASILRTALPRIKSLRESI-PNVIVDASGKRGVNGLKFRGIETEQRFLQFEDQ
ATPG_ACIAD       RGLAGGLNINLFKKVVQHVKAQREQSI-EVEFALIGQKAVSFFKNYGGKVLGATTQLGDA
ATPG_PSYA2       RGLAGGLNINLFKALTKSIQQYQDQSV-QAEFAVIGAKGVSFFKNFGGKVTSAVTDYGDK
ATPG_LEGPL       RGLCGGLNSNLFRETIRTIRNWQEHGK-EVDIAVIGRKGQAFFRRVGGNILGSIDHLGDT
ATPG_LEGPH       RGLCGGLNSNLFRETIRTIRNWQEHGK-EVDIAVIGRKGQAFFRRVGGNILGSIDHLGDT
ATPG_LEGPA       RGLCGGLNSNLFRETIRTIRNWQEHGK-EVDIAVIGRKGQAFFRRVGGNILGSIDHLGDT
ATPG_PSE14       RGLCGGLNTNLFKTLVKDMAVNRENGV-EIDLCVVGSKGAAFFRNFGGNVVAAISHLGEE
ATPG_PSEU2       RGLCGGLNTNLFKTLVKDMAVNRENGV-EIDLCVVGSKGAAFFRNFGGNVVAAISHLGEE
ATPG_PSEF5       RGLCGGLNTNLFKALVKDMAVNREQGV-EIDLCVVGSKGAAFFRNFGGNVVAAISHLGEE
ATPG_PSEPK       RGLCGGLNTNLFKALVKDMSANREQGV-EIDLCVIGSKGATFFRIFGGNVVAAISHLGEE
ATPG_PSEAE       RGLCGGLNINLFKSLVKDMSGYREQGA-EIDLCVIGSKGASFFRSFGGNVVAAISHLGEE
ATPG_METCA       RGLCGGLNSNLFRLLLRRMRAWGEAGV-EVRLGVIGQKGASFFGGVGADVAAQVVRLGDT
ATPG_COXBU       RGLCGGLNVNLFRTAIADMKKWQADNI-GMDLCVIGRKGEAFFRRYGGNVLAVADHLGDA
ATPG_COLMA       RGLCGGLNINLFKKVLADAAEKQASGA-EVEFCVIGSKATAFFNNMGAKVSAQISGLGDS
ATPG_COLP3       RGLCGGLNINLFKKVLADAAEKQASGA-EVEFGVVGSKATSFFNNMGAKVSAQISGLGDS
ATPG_SHEON       RGLCGGLNVNLFKKVVADVKSWKEQGA-EFEFCPIGARSVQFFKSFGGQVSAQASGLGDA
ATPG1_PHOPR      RGLCGGLNINLFKSAMTDIKGWADQGA-DVEMALVGAKATAFFNSYGGNVVAQVSGLGDS
ATPG_ALIF1       RGLCGGLNINLFKKVMTEMKTWSEDGV-EIDLAVIGSKATAFFNSYGGNVVAQNSGLGDH
ATPG_VIBVU       RGLCGGLNINVFKKAVTDMQAWKEKGA-EVELAVIGSKATAFFKHGGAKVAAQVSGLGDS
ATPG_VIBVY       RGLCGGLNINVFKKAVTDMQAWKEKGA-EVELAVIGSKATAFFKHGGAKVAAQVSGLGDS
ATPG_VIBAL       RGLCGGLNINVFKKAVTDMQTWREKGA-EIELAVVGSKATAFFKHGGAKVAAQVSGLGDN
ATPG_VIBCH       RGLCGGLNINLFKKAITDMQTWKEKGA-QIELAIIGSKATAFFNNSGAKVAAQVSGLGDS
ATPG_PECAS       RGLCGGLNINLFKKLLADMKSWSDKGV-ETDLALIGSKAASFFGSVGGNIVAQVTGMGDN
ATPG_YERPS       RGLCGGLNINLFKRLLAEMKGWSEKGV-ECDLALIGSKAASFFGSVGGKIVAQVTGMGDN
ATPG_ECOLI       RGLCGGLNINLFKKLLAEMKTWTDKGV-QCDLAMIGSKGVSFFNSVGGNVVAQVTGMGDN
ATPG_ECO57       RGLCGGLNINLFKKLLAEMKTWTDKGV-QCDLAMIGSKGVSFFNSVGGNVVAQVTGMGDN
ATPG_ECOL6       RGLCGGLNINLFKKLLAEMKTWTDKGV-QCDLAMIGSKGVSFFNSVGGNVVAQVTGMGDN
ATPG_SHIFL       RGLCGGLNINLFKKLLAEMKTWTDKGV-QCDLAMIGSKGVSFFNSVGGNVVAQVTGMGDN
ATPG_SALCH       RGLCGGLNINLFKKLLADMKAWSDKGV-QCELAMIGSKGVSFFNSVGGNVVAQVTGMGDN
ATPG_SALTY       RGLCGGLNINLFKKLLADMKAWSDKGV-QCELAMIGSKGVSFFNSVGGNVVAQVTGMGDN
ATPG_SALPA       RGLCGGLNINLFKKLLADMKAWSDKGV-QCELAMIGSKGVSFFNSVGGNVVAQVTGMGDN
ATPG_PHOLL       RGLCGGLNTNLFKKLLSEMKDWSDKDV-QCELALIGSKATSFFASVGGNVVAQVTGMGDN
ATPG2_PHOPR      RGLCGGLNSNLFKRALTDMRQWQEKNV-EVDLTLIGSKAISFFHRF-GNVIAQTSGLGDK
ATPG_IDILO       RGLCGGLNGNEFKKVVKHANEWKEQDV-EADFAAIGSKGTSFFKRF-GKLKAQVSGMGDK
ATPG_HAEIN       RGMCGGLNVNLFKTTLNQIKNWKEQNI-STDLGLIGSKGISFFRSFGFNIKGQLSGLGDT
ATPG_HAEI8       RGMCGGLNVNLFKTTLNQIKNWKEQNI-STDLGLIGSKGISFFRSFGFNIKGQLSGLGDT
ATPG_MANSM       RGMCGGLNINLFKTVLNEIKKWKEQGI-TVEVGVIGSKGIAFFRSLGLKIRAQHSGMGDN
ATPG_PASMU       RGLCGGLNVNLFKTVLNEMKEWKEKDV-SVQLSLIGSKSINFFQSLGIKILTQDSGIGDT
ATPG_HAEDU       RGLCGGLNINLFKTTLNEFKAWKDKDV-SVELGLVGSKGVSFYQSIGLKVRAHITGLGDS
ATPG_ACIFR       RGLCGGLNVNVLRNVVQKMRELHEEGV-ESNLAVVGNKGLGFLRRHGAHLVADVNGLGDS
ATPG_AROAE       KGLCGGLNTNIQRVALNAMKGWDASGTTEIQACCIGNKGFGFMQRMGAKVVSHVVQLGDT
ATPG_DECAR       KGLCGGLNSNLLRVAVSKMKEFESQGK-KLQATCIGNKGFGFMQRSGAKIVSHVTGLGDT
ATPG_BORBR       KGLCGGLNTNISRVTLSKLKEFEQRSI-KVQATAFGNKGLGLLTRIGAKLVSQEVQLGDK
ATPG_BORPE       KGLCGGLNTNISRVTLSKLKEFEQRSI-KVQATAFGNKGLGLLTRIGAKLVSQEVQLGDK
ATPG_BURMA       KGLCGGLNTNVLRASLQKFKELEEQGQ-KVEATAIGGKGLGFLNRFGAKVISQVVHLGDT
ATPG_BURPS       KGLCGGLNTNVLRASLQKFKELEEQGQ-KVEATAIGGKGLGFLNRFGAKVISQVVHLGDT
ATPG_CUPPJ       KGLCGGLNTNVLRAVTNELKTLQGRGV-DVQATAIGGKGMQFLSRIGAKVVSNVVQLGDT
ATPG_RALSO       KGLCGGLNTNVLRAVTNQLRDLQNKGV-ESQATAIGSKGMQFLGRIGAKVVSNVVHLGDT
ATPG_NITEU       KGLCGGLNTNVLRRALNEIRTWETEGN-HVDACCIGNKGLGFMSRLGTQVISQVTGLGDA
ATPG_XANAC       RGLAGGLNNNLFRKMLGEVRPWQDKGA-EIDVVTIGQKASAFFRRVKVNMVGSVTHLGDS
ATPG_XANOR       RGLAGGLNNNLFRKMLGEVRPWQGTGA-EIDVVTIGQKASAFFRRIKVNMVGSVTHLGDS
ATPG_XANCP       RGLAGGLNNNLFRKMLGEVRPWQDKGA-EIDVVTIGQKASAFFRRIKVNMVGSVTHLGDS
ATPG_XANC8       RGLAGGLNNNLFRKMLGEVRPWQDKGA-EIDVVTIGQKASAFFRRIKVNMVGSVTHLGDS
ATPG_XYLFA       RGLAGGLNNNLFRKMLGEMRQWQDKGA-EVDIVTIGQKASVFFRRIKVNILGSVTHLGDT
ATPG_XYLFT       RGLAGGLNNNLFRKMLGEMHQWQDNGA-EVDIVTIGQKASVFFRRIKVNILGSVTHLGDT
ATPG_NEIG1       KGLCGGLNANVLKKFLAQVQEYRNQGI-EEEIVCLGSKGLMACQSIGLNVVASAVNLGDT
ATPG_NEIMA       KGLCGGLNANVLKKFLAQVQEYQNQGI-EEEIVCLGSKGLMACQSIGLNVVASAVNLGDT
ATPG_CHRVO       KGLCGGLNVNSFKRFFGKVKELQDQGI-EVDVCCLGQKGLAAAQRARLNVVASAVHLGDM
ATPG_BUCAI       RGLCGGLNTNLFKQVLFKIQNFAKVNI-PCDLILFGLKSLSVFKLCGSNILAKATNLGEN
ATPG_BUCAP       RGLCGSLNTNLFKQVLFKIQNFAKINI-PCDLILFGLKSLSVFKLYGSSIISSVTNLGET
ATPG_BUCDN       RGLCGSLNSNLFRKVLFKIQNFTQKNI-PCDLILFGLKSLPVFKLCENNILSKITHLGEH
ATPG_BUCMH       RGLCGNLNVTLFKKILDFIQNYNNRNI-TSDLSILGLKGLSFFKSLSNKIVYFNDYAKNN
ATPG_BUCSC       RGLCGSLNISLFKKIIQLINIYKNKNV-MSSLFILGSKGVSYFKSSTYDITYYEKIITKN
ATPG_BUCBP       RGLCGNLNTLLFKKVLEVLTEHINEHI-LNNLFVIGTKALTFFKSFTNNIVFSLSNLKND
ATPG_WIGBR       RGLAGSLNINLFKKLLYEINKSKEKKI-NTKLVLIGSKAISFFRFFEDEIISTISGIGDT
ATPG_FRATT       RGLCGGLNINLFKHVLKEIKNNIEDRV-GVDVCVIGSKAENFFAKLKDVNIVATAHYNDK
ATPG_NOSS1       RGLCGGYNTNVIRRAENRAKELKAEGL-DYTFVIVGRKAEQYFRRRE--QPIDASYTGLE
ATPG_SYNP6       RGLCGGYNSNVIRRAEQRARELSAQGL-DYKFVIVGRKAGQYFQRRE--QPIEATYSGLE
ATPG_SYNP1       RGLCGGYNTNVIRRAKERTEELEAEGI-KYTLVIVGRKAAQYFQRRD--YPIDAVYSGLE
ATPG_SYNY3       RGLCGGYNVNAIKRAEQRAKELKNQGI-AVKLVLVGSKAKQYFGRRD--YDVAASYANLE
ATPG_ARTPT       RGLCGAYNSNIIKRAEARAAELKAEGL-EYSYLLVGRKAIQHFTRRD--APISQCRDNPE
ATPG_PROMA       RGLCGGYNTNVIKRTEQRYGELSSQGF-EIDLVLIGRKAITYFQNRSSQYKIRASFQDLE
ATPG_PROMM       RGLCGGYNSNIIKRTEQRYAELNGQGY-KVDLVLIGRKAITYFSNRSSQYTIRATFTGLE
ATPG_PROMP       RGLCGGYNTNIIKKVEIRYAELIKQGY-EPNLILVGKKAIGYFQNRKDRYVIKSTFKELE
ATPG_SYNPX       RGLCGGYNANIIKRTEQRFAELTGKGF-KVKLVLIGNKAIGYFTKRD--YPVQATFSGLE
ATPG_GLOVI       RGLCGAYNSNIIRRTVQYLRELQQQGK-QFALYLVGNKAISFFRRSN--FPIAKTLTNVD
ATPG_PARUW       MGLSGPYNKDIFSAANKFLKTYAQE---QVELILVGKKATDYYKKRP--WNIRFEFGEWG
ATPG_DESPS       RGLCGSFNANVVKLTEKKMAQYRAEGK-KVSLICIGKKGYQLLRKSG---AVRENYSDIM
ATPG_DESVH       RGLCGSFNANLISTALKLAKQKAAEGK-TVKFYCVGKKGRDTIRKADF--EVVTAIADQM
ATPG_AQUAE       RGLAGAFNSNVIRTAENLIREKEEKGV-KVSLILVGRKGFQYFTKRGY--NVIKGYDEVF
ATPG_MOOTA       RGLAGGYNANLIRLTEERLRE---EGR-PAALVAVGRKGRDFFRRRPV--EIVKSFTDIG
ATPG_SYMTH       RGLAGAFNINVIRKAHQALQK---ESR-PTKLITIGRKGRDYFVKRKI--QPVLEFVNLG
ATPG_AGRFC       RGLCGGFNSQIARFARDQARKLISEGK-TVKIITVGKKGYDSLRREFASLIIERIELRDV
ATPG_RHIME       RGLCGGFNSQIARFARDHVRKLLAQGK-TVKIICVGKKGFDMLRRDFASLIIDRVDLREV
ATPG_BRUAB       RGLCGGFNSQIARLARDHARKLLAEGK-TVKIITVGKKGADILRREFSALLHDHVDLREV
ATPG_BRUME       RGLCGGFNSQIARLARDHARKLLAEGK-TVKIITVGKKGADILRREFSALLHDHVDLREV
ATPG_BARHE       RGLCGAFNVQIARRAREHIKTLLAAGK-IVKVLTVGKKGADILSRDYKALMIDHIDLQSI
ATPG_BARQU       RGLCGAFNMQIARRARQQIKALLSAGK-IVKILTVGKKGADILSRDYKALMIDHIDLRSV
ATPG_RHOPA       RGLSGAFNSSIVRLARERAYELMSQGK-TVKFFCVGRKGYEQLRRNFEKQIIDNVELRSV
ATPG_RHOBL       RGLCGGFNSTIVRLARQRANELVAQGK-TVKILTVGKKGREQLKRDWASAFVGHVDLSDV
ATPG_RUEPO       RGLCGGFNSNIAKLARVRANELLAKGK-TVKILTVGKKGRDAMKRDFAANMVGHVDLSGI
ATPG_RHOCA       RGLCGGFNANIAKLAKAKAMELLAQGK-TVKILTVGKKGRDALRRDLGQYYIDHIDLSDV
ATPG_CAUVC       RGLAGGFTSSIVRAARAHIDGLIAQGK-DVRVVCVGKKVTAQLAKPYAGRIVETFDLSSY
ATPG_GLUOX       RGLAGGFNANIVRSARQLVDTLVSEGK-TVRILPVGRKGADILVRHYPEMITDRLAGSDG
ATPG_RHORU       RGLCGGFNGSIIRATRTLVRELEAQGK-TVKLLCIGKKGRDGLKREFPKQIIGGIADQSS
ATPG_PELUB       RGLCGGFNTNIIKKAKTYFQKISDEGK-TLKIITVGSKGYDQLKRVYKDAIVERISFKDS
ATPG_ZYMMO       AGLCGGFNSNIYRQARDRALALEAAGK-TVQFYVIGIKNAPVIRNNFPGKTIHETKREET
ATPG_HELHP       KGLCGGFNITTIKEVLRLMETYKQQGI-KVRLRGIGKTGISFFAFNDIEVLDKAIGLSAA
ATPG_WOLSU       KGLCGGFNSTTIKEVTRLMAEYKSQNV-KVRLRAIGKKGISFFGFNEVELLDKVSDLSAT
ATPG_HELPY       KGLCGGFNTNTIKKVLACTNEYKEKDI-KVRLRGIGKKGNEYFSFNGIEVLDKINNLSSM
ATPG_HELPJ       KGLCGGFNTNTIKKVLACTNEYKEKDI-KVRLRGIGKKGNEYFSFNGIEVLDKINNLSSM
ATPG_CAMJR       KGLCGGFNIKTLKTVSEMLKEYEAKNI-NIRLRAIGKTGIEYFNFQKIELLEKYFHLSSS
ATPG_RICPR       RGLCGMFNYSIIKQVKNDIKELTNKGE-QIKLIIIGKKGYEALKRQYANYINSYFEFTKI
ATPG_BDEBA       RGLCGAFNSNINKFAEAYYNSNKASLE-KIDFLFVGRRGHDYFARRGIKAVDYITKLDKD
ATPG_MESFL       LGLCGGYNANVNKLVISNFKKED-------QIYAIGSKAVSAYN--SKKIKIKNECTDVD
ATPG_MYCMS       LGLCGGYNSNVNKLVLQNLKTND-------EIFAIGSKAVSFFR--SKKIKIKDQVTNID
ATPG_MYCPU       IGLAGSYNSNIFKILNSNIKNED-------KLILIGQKAINFF--SNRQDQIIETFKALP
ATPG_MYCS5       IGLCGSYNSNVINELKKVIKPSD-------LVITLGTKGLNWIRVSKFKDQLYKAYVNLE
ATPG_MYCGE       LGLCGQHNSNMNKLLKANFKADD-------KIFFLGRKNQSFWNKNSQYNPAVGFIDIQD
ATPG_MYCPN       LGLCGQHNTNMNKLLQTKFQPGD-------KIFFLGRKNQSFWNKGDTDNPTVGYVDIQD
ATPG_MYCGA       LGLCGSYNTNVGKLLVSELAKDD-------EIILVGTKLNSFLRTRNHEDQIIHTYSIND
                  .: *  .                           *                        

ATPG_CLOAB       PG---LKEAKEIADRALSLYEKGEI--------------------GEVHVIYTQFLSTVN
ATPG_CLOPA       PT---LTEAKTISEHALSLYNKGEI--------------------GEINIVYSKFISTIK
ATPG_CLOPE       PN---VGDASTIVNKAVKEFTDGNF--------------------GEVSLVYTKFFSPVK
ATPG_ACEWD       PN---FFNAKEVTAIVMEGFKNGEY--------------------DEVYIAYTKFVSTIT
ATPG_RUMA7       IE---LIDAMMIANKVIERFKIGDF--------------------DAVELVYTTFVSVMT
ATPG_CALS4       PT---VDLAAEIAEILLKEYNNGDA--------------------DEIWAVYTEMKG-LS
ATPG_BACFR       PS---YDEAAALAKLLMELFLEKNI--------------------DRVELIYHHFKSMGV
ATPG_BACFN       PS---YDEAAALAKLLMELFLEKNI--------------------DRVELIYHHFKSMGV
ATPG_BACTN       PS---YQEASELAHRLMEMYVSGEI--------------------DRVELIYHHFKSMGV
ATPG_BACCA       PS---FADIKEIARKTVGLFADGTF--------------------DELYMYYNHYVSAIQ
ATPG_GEOSE       PS---FADIKEIARKTVGLFADGTF--------------------DELYMYYNHYVSAIQ
ATPG_BACP3       PS---FADIKEIARKTVGLFADGTF--------------------DELYMYYNHYVSAIQ
ATPG_GEOKA       PS---FADIKEIARKTVGLFADGTF--------------------DELYMYYNHYVSAIQ
ATPG_BACMQ       PA---FADIQGIASQTVQMFADGTF--------------------DELYLYYNHFINTIS
ATPG_BACLD       VT---FSEIKDLANSTVQMYIDETF--------------------DELYLFYNHFVSAIS
ATPG_BACSU       VT---FTEIKDLARQTIQMFIDGAF--------------------DELHLVYNHFVSAIT
ATPG_BACC1       PS---FTDIKDLASRAIAMFADGAY--------------------DELYIYYNHYVSKIS
ATPG_BACCR       PS---FTDIKDLASRAIAMFADGAY--------------------DELYIYYNHYVSKIS
ATPG_BACCZ       PS---FTDIKDLASRAIAMFADGAY--------------------DELYIYYNHYVSKIS
ATPG_BACHK       PS---FTDIKDLASRAIAMFADGAY--------------------DELYIYYNHYVSKIS
ATPG_BACHD       PT---FNDIKDIAKQTVDMFADEVF--------------------DELYIWYNHFVSPIK
ATPG_BACPE       PE---FNDIKNIARTSVEMFADGIF--------------------DELYVWYNHFVSPIT
ATPG_BACSK       PT---FNDVSGLAKSSVEMFADGVF--------------------DELYIWYNHFVSPMT
ATPG_OCEIH       PT---FADVKELASETVQMYADGDI--------------------DELNIIYNHYVSAIS
ATPG_LISIN       PI---FAEIKDIASNTVQMFEDGVY--------------------DEVFIYYNHHINSIS
ATPG_LISMO       PI---FAEIKDIASNTVQMFEDGVY--------------------DEVFIYYNHHINSIS
ATPG_LISMF       PI---FAEIKDIASNTVQMFEDGVY--------------------DEVFIYYNHHINSIS
ATPG_STAAM       PS---FKSVQALANHAIDLYSEEEI--------------------DELNIYYSHYVSVLE
ATPG_STAAW       PS---FKSVQALANHAIDLYSEEEI--------------------DELNIYYSHYVSVLE
ATPG_STAAN       PS---FKSVQALANHAIDLYSEEEI--------------------DELNIYYSHYVSVLE
ATPG_STAHJ       PS---FKSIQAIAKHAIDLFSEEHI--------------------DELKIYYSHYVSVLE
ATPG_STAES       PS---FKSIQSIAKHAIDLFSEENI--------------------DELTIYYSHYVSVLE
ATPG_STAEQ       PS---FKSIQSIAKHAIDLFSEENI--------------------DELTIYYSHYVSVLE
ATPG_STAS1       PS---FKEVQAIAKKAIGLYSEGEV--------------------DEVKIYFSHFVSVLE
ATPG_ENTFA       PT---FEEVRKIVTTATTMYQNEVF--------------------DELYVCYNHHVNSLT
ATPG_ENTHA       PS---FDEVRKIVGMATTMYQNEVF--------------------DELYVCYNHHINSLT
ATPG_STRA3       PS---FDQVGKIIAQAVEMYKNELF--------------------DELYVCYNHHVNSLT
ATPG_STRA5       PS---FDQVGKIIAQAVEMYKNELF--------------------DELYVCYNHHVNSLT
ATPG_STRP1       PS---FEQVRQIISQSVDMFVNEIF--------------------DELYVCYNHHVNSLT
ATPG_STRP8       PS---FEQVRQIISQSVDMFVNEIF--------------------DELYVCYNHHVNSLT
ATPG_STRP6       PS---FEQVRQIISQSVDMFVNEIF--------------------DELYVCYNHHVNSLT
ATPG_STRP3       PS---FEQVRQIISQSVDMFVNEIF--------------------DELYVCYNHHVNSLT
ATPG_STREI       PS---FEQVGNIIAKSVEMYKNELF--------------------DELYVCYNHHVNSLT
ATPG_STRMU       PS---FEEVNRIISKSVEMYKNELF--------------------DELYVCYSHHINSLT
ATPG_STRTR       PS---FDQVGKIISKAVGMYQNELF--------------------DELYVCYNHHINSLS
ATPG_STRT2       PS---FDQVGKIISKAVGMYQNELF--------------------DELYVCYNHHINSLS
ATPG_STRT1       PS---FDQVGKIISKAVGMYQNELF--------------------DELYVCYNHHINSLS
ATPG_STRPN       PS---FDQVRKIISKTVEMYQNELF--------------------DELYVCYNHHVNTLT
ATPG_STRR6       PS---FDQVRKIISKTVEMYQNELF--------------------DELYVCYNHHVNTLT
ATPG_STRSA       PS---FDEVRKIISKTIEMYQNELF--------------------DELYVCYNHHVNSLT
ATPG_LACLM       PT---FEEVRAIVTEAVEEYQAEEF--------------------DELYVCYNHHVNSLV
ATPG_LACLA       PT---FEEVRAIVTEAVTEYQAEEF--------------------DELYVCYNHHVNSLV
ATPG_LACAC       PT---FDEVLPIVSTAIKMFLNGVY--------------------DQLYVCYTHHVNSLS
ATPG_LACJO       PT---YNEVRDIVQTAVKMYLNGVY--------------------DELFVCYTHHVNTLT
ATPG_LACPL       PT---FKEVREIVKTVTSMYHNEVF--------------------DELYVFYNHFINRLS
ATPG_OENOE       PK---FWEVSDLVKEVTKQYAARKF--------------------DALELVFNHFINRLK
ATPG_COREF       PD---WNATHDVRRHLIDGFTATSDGTAKWRDGLNVAEGQEIQGFDQVHVVYTEFVSMLT
ATPG_CORGL       PD---WAATHNVRRHLIDGFTASSEGEAAWREGLNLPEGQDIQGFDQVHVVYTEFISMLT
ATPG_CORDI       PS---WEETHDVRRHLIDGFNASSNGTARYRDGLNTDEGQEIQGFDQVHVVYTEFESMLT
ATPG_CORJK       PD---YAATHDVRRHLIDGFVAGSEGTAKWREGLKAEEGQAVQGFDEVHIVYTRFESMLS
ATPG_MYCBO       PT---YENAAEIASTLVDAFLLGTDN--GEDQRSDSGEG-----VDELHIVYTEFKSMLS
ATPG_MYCTU       PT---YENAAEIASTLVDAFLLGTDN--GEDQRSDSGEG-----VDELHIVYTEFKSMLS
ATPG_MYCPA       PQ---YENAAEIAETLVESFMRGTG---GEDEGESDAES-----VDELHIVYTEFKSMLS
ATPG_MYCLE       PK---YENAAKIASTLVDVFMLGSS---------ESDAG-----VDELHIVFTEFKSMLS
ATPG_NOCFA       PK---YTDASAACRHLVDAFMVGSDGEVPHPNGTGDIAG-----VDELHIVYTRFVSMLT
ATPG_STRCO       PT---YADAKKVAAPLIEAIEKDTA-----------EGG-----VDELHIVYTEFVSMMT
ATPG_STRLI       PT---YADAKKVAAPLIEAIEKDTA-----------EGG-----VDELHIVYTEFVSMMT
ATPG_STRAW       PT---YADAKKVAGPLIEAIEKETA-----------DGG-----VDELHIVYTEFVSMMT
ATPG_LEIXX       PE---FEQAKEVADAILESFLRDSA-----------DGG-----VDEIHVIYNRFVSMLT
ATPG_CUTAK       PS---YRDAKDIADHLIEDFLRPTE-----------EGG-----VDEIHMVYTEFESMLT
ATPG_LEPIC       SG---YREAEEFANLFLELFAKEEV--------------------DVVEIASTVYYSSAS
ATPG_RHOBA       PA---YDDVEKIAEGYLAEYITGKI--------------------DRLDVVYTKFISTSK
ATPG_ACIAD       PS---LEQLTGSVQVMLDAFDKGEL--------------------DRIYLVSNGFVNAMT
ATPG_PSYA2       PT---FEQLNSPVQAMLEDYSNGKI--------------------DRIYVVYNKFVNAMT
ATPG_LEGPL       PS---INDFIGVVKIMLDAYYNGTI--------------------DSLHIVYNEFINTMT
ATPG_LEGPH       PS---INDFIGVVKIMLDAYYNGTI--------------------DSLHIVYNEFINTMT
ATPG_LEGPA       PS---INDFIGVVKIMLDAYYNGAI--------------------DSLHIVYNEFINTMT
ATPG_PSE14       PS---INDLIGSVKVMLDAYLDGRI--------------------DRLSVVSNKFINTMT
ATPG_PSEU2       PS---INDLIGSVKVMLDAYLDGRI--------------------DRLSVVSNKFINTMT
ATPG_PSEF5       PS---INDLIGSVKVMLDAYLEGRI--------------------DRLSVVSNKFINTMT
ATPG_PSEPK       PS---INDLIGSVKVMLDAYLDGRI--------------------DRLSVVSNKFINTMT
ATPG_PSEAE       PS---INDLIGSVKVMLDAYLEGRI--------------------DRLFVVSNKFVNTMT
ATPG_METCA       PH---LEGIIGVLKVMLDAYGEGEI--------------------DELYVAHNEFVNTMT
ATPG_COXBU       PE---VQDIIGIVKVMLDQYDKQQI--------------------DAIYIATNEFVNTMV
ATPG_COLMA       PS---LTDLVGSVAVMLKAYDNGEI--------------------DRLHVVYNKFVNTMT
ATPG_COLP3       PS---LTDLVGSVAVMLKAYDNGEI--------------------DKLYVVYNKFVNTMT
ATPG_SHEON       PK---LNDLIGTVQVMLEAYNEGKL--------------------DRLYVVFNKFVNTMT
ATPG1_PHOPR      PT---VNELIGTVGVMLKKYNEGLL--------------------DRLYLVYNQFVNTMI
ATPG_ALIF1       PS---LEELIGTVGVMLKKYDEGQL--------------------DRLYVVNNKFINTMV
ATPG_VIBVU       PS---LEDLIGSVSVMLEKYDEGEL--------------------DRLYLVFNKFVNTMV
ATPG_VIBVY       PS---LEDLIGSVSVMLEKYDEGEL--------------------DRLYLVFNKFVNTMV
ATPG_VIBAL       PS---LEDLIGSVGVMLKKYDEGEL--------------------DRLYVVFNKFVNTMV
ATPG_VIBCH       PS---LEDLIGSVGVMLKKYDKGEL--------------------DRLYLVFNQFVNTMV
ATPG_PECAS       PS---VSELIGPVKVMLQAYDEGRL--------------------DKLYIVSNKFINTMS
ATPG_YERPS       PS---LSELIGPVKVMLQAYDEGRL--------------------DKLYIVNNKFINTMS
ATPG_ECOLI       PS---LSELIGPVKVMLQAYDEGRL--------------------DKLYIVSNKFINTMS
ATPG_ECO57       PS---LSELIGPVKVMLQAYDEGRL--------------------DKLYIVSNKFINTMS
ATPG_ECOL6       PS---LSELIGPVKVMLQAYDEGRL--------------------DKLYIVSNKFINTMS
ATPG_SHIFL       PS---LSELIGPVKVMLQAYDEGRL--------------------DKLYIVSNKFINTMS
ATPG_SALCH       PS---LSELIGPVKVMLQAYDEGRL--------------------DKLYIVSNKFINTMS
ATPG_SALTY       PS---LSELIGPVKVMLQAYDEGRL--------------------DKLYIVSNKFINTMS
ATPG_SALPA       PS---LSELIGPVKVMLQAYDEGRL--------------------DKLYIVSNKFINTMS
ATPG_PHOLL       PS---LSELIGPVNIMLRAYDEGRL--------------------DKLYVVTNKFINTMS
ATPG2_PHOPR      PK---LEDLLGAVTAMLEHFDDGKI--------------------DRLYLVYNEFVNTMV
ATPG_IDILO       PE---LKEITGSIQVMLDAFEEGKI--------------------DRLYVVFNKFVNTMT
ATPG_HAEIN       PA---LEELIGVANTMFDAYRNGEI--------------------DAVYIAYNKFVNTMS
ATPG_HAEI8       PA---LEELIGVANTMFDAYRNGEI--------------------DAVYIAYNKFVNTMS
ATPG_MANSM       PS---VEELLGIANDMFDAYKDGKI--------------------DALYLAHNQFINTMS
ATPG_PASMU       PS---VEQLIGSVNSMIDAYKKGEV--------------------DVVYLVYNKFINTMS
ATPG_HAEDU       PE---MERIVGAVNEMINAYRNGEV--------------------DMVCIAYNRFENTMS
ATPG_ACIFR       PH---LGDMIGPIRAMADAYAKGEV--------------------DVVYLVSSRFVNTML
ATPG_AROAE       PH---LEKMIGPVKIMLDAFQNGEL--------------------DAVYVAYTRFINTMK
ATPG_DECAR       PH---LEKLIGAVKVQLDAYMNGEI--------------------DALYIGYTRFINTMK
ATPG_BORBR       PD---LDRLLGAIKVQLDDYLEGRI--------------------DALYVATTRFVNTMR
ATPG_BORPE       PD---LDRLLGAIKVQLDDYLEGRI--------------------DALYVATTRFVNTMK
ATPG_BURMA       PH---LDKLIGAVKTQLDLYSEGKL--------------------SAVYLAYTRFVNTMK
ATPG_BURPS       PH---LDKLIGAVKTQLDLYSEGKL--------------------SAVYLAYTRFVNTMK
ATPG_CUPPJ       PH---LEKLIGAIKVQLDAFTNGEV--------------------DAVYLSYTRFINTMK
ATPG_RALSO       PH---LEKLIGAIKVQLDAFTAGEI--------------------DAVYLAYTRFINTMR
ATPG_NITEU       PN---MERLIGAVKVVLDAYTEGQL--------------------DRVYIFYNRFINTMK
ATPG_XANAC       PQ---VEQLIGVIKVMIDAFIEGKV--------------------DRVYLVYNRFVNTMT
ATPG_XANOR       PQ---VEQLIGVIKVMIDAFIEGKV--------------------DRVYLVYNRFVNTMT
ATPG_XANCP       PH---IEQLVGVIKVMLDAFTEGKV--------------------DRVYLVYNRFVNTMT
ATPG_XANC8       PH---IEQLVGVIKVMLDAFTEGKV--------------------DRVYLVYNRFVNTMT
ATPG_XYLFA       PR---LEQLIGVIKVMLDAYTEEKL--------------------DRVYLVYNRFINTMV
ATPG_XYLFT       PR---LEQLIGVIKVMLDAYTEEKL--------------------DRVYLVYNHFINTMV
ATPG_NEIG1       PK---MEMLLGPLTELFQRYEKHEI--------------------DRIHLVYSGFVNTMR
ATPG_NEIMA       PK---MEMLLGPLTELFQRYEKHEI--------------------DRIHLVYSGFVNTMR
ATPG_CHRVO       PK---MEKLIGPLTVLFRQYAEGEL--------------------DAVYIVYSSFVNTMK
ATPG_BUCAI       PK---LEELINSVGIILQEYQCKRI--------------------DKIFIAYNKFHNKMS
ATPG_BUCAP       PD---LSKLIGSIKIILEKYQNNQI--------------------DRLFIAYNKFHNKLS
ATPG_BUCDN       PN---ILKVINGIDVLLKKYQIKRI--------------------DKIFIAYNEFHNKMS
ATPG_BUCMH       YT---FSDCLNCNSIFMKLYSIGEI--------------------DRLFLAYNKFKSTLI
ATPG_BUCSC       YT---FFDCLNFIHSSLEYYNTQKI--------------------DKLFLSYNQFKNTLV
ATPG_BUCBP       FK---IIDLMEMIRISLEMYISGKI--------------------DKLFLAYNKFNSTII
ATPG_WIGBR       PK---ISELIKPVQIMLKEYDSNII--------------------DKIYIISNKFINTMT
ATPG_FRATT       DKEGSIRAIGGAVKVMLDKFTAGEI--------------------DRLYMSSNQFVSTIK
ATPG_NOSS1       QIPTADEANK-IADELLSLFLSEKV--------------------DRIELVYTRFVSLVS
ATPG_SYNP6       QIPTAQEAND-IADQLLSLFLSGTV--------------------DRVELVYTKFLSLVA
ATPG_SYNP1       QIPSASEAGQ-IANELLSLFLSETV--------------------DRVELIYTKFVSLIS
ATPG_SYNY3       QIPNASEAAQ-IADSLVALFVSETV--------------------DRVELIYTRFVSLIS
ATPG_ARTPT       KTPDPQEVSS-ATDEILAWFESGAV--------------------DRVELIYTKFVSLIS
ATPG_PROMA       QVPTSKDAEE-ATSEVLSEFLSEST--------------------DRVEIIYTKFISLVS
ATPG_PROMM       QVPTSDDAES-ITTEVLAEFLSQST--------------------DRIEVIYTKFINLVS
ATPG_PROMP       QVPTAIDSEG-ITNDVLAEFLSENS--------------------DRVEIIYTKFITLVS
ATPG_SYNPX       QVPTADEANT-ISTDVLAEFIGAGT--------------------DRVELIFTKFINLVS
ATPG_GLOVI       PNTPLEGANQLITDDILAPFLSGEY--------------------DQVELVYTRFVSLIS
ATPG_PARUW       EKLTSHQIKT-FANQLMSWFLIGEL--------------------DEIWLVYTHYVTMMT
ATPG_DESPS       A-HFSINNAREIASDVADNFLKGTA--------------------DKVEIIYGAFKSVAV
ATPG_DESVH       G-SFDFQLANKLGLEVINHYLTGEL--------------------DEVVLVYGEFVSTAK
ATPG_AQUAE       RKTVNFNVAKEVAEIVKERFLNGET--------------------DRVYLINNEMVTRAS
ATPG_MOOTA       D-NPELIQARELARQLVTMYLEGTL--------------------DEVNLIYTRFYSAIR
ATPG_SYMTH       D-NITFALARSVLSKIVDLYLSGEV--------------------DEVRVIYTEFVNAVT
ATPG_AGRFC       KK-VGFENADQIAKKVISLFNAGEF--------------------DVCTLIYSEFKSVIS
ATPG_RHIME       KK-IGFENADRIGHKVIELFDKGEF--------------------DVCTLFYSEFKSVIS
ATPG_BRUAB       KQ-LAFVHADQIGHKIIKLFEEGAF--------------------DVCTLFYSEFKSVIS
ATPG_BRUME       KQ-LAFVHADQIGHKIIKLFEEGAF--------------------DVCTLFYSEFKSVIS
ATPG_BARHE       KR-VGFAEAAMISQKIVDLFDDDAF--------------------DVCTLFYSEFVSVIN
ATPG_BARQU       KR-VGFAEAAIISQKIIDLFDKDTF--------------------DVCTLFYSEFVSVIN
ATPG_RHOPA       RQ-IGFVNAEDIAKKVIARFNAGEF--------------------DVCTLFYSRFKSVIS
ATPG_RHOBL       RR-LGYSNAQGIAREVLAAFEAGEA--------------------DVVTIFYNRFQSVIS
ATPG_RUEPO       KA-LGYANAQDIARDVLGRFDAGEF--------------------DVATIFYAKFQNVVT
ATPG_RHOCA       KK-LSYPVAQKISQNIIDRFEAGEY--------------------DVATIFFSVFQSVIS
ATPG_CAUVC       RQ-LTLSVAQPIADVITREYEAGET--------------------DVVTLFYSRFKSVVQ
ATPG_GLUOX       KD-VGFDKATDIGSRIATMLDAGEI--------------------DRCTLVYNRFLNAMT
ATPG_RHORU       KA-IGFSDADRFSRLILDMFQAGEF--------------------DVCTLVYNRFQSAIS
ATPG_PELUB       KT-INYLDAEKVGKMIIENFEKEEF--------------------DVCTIFYNKFKNVIT
ATPG_ZYMMO       SP-VTFENAQKIAQDLIQRFNAGEF--------------------DVAHLFFSHYHSVLS
ATPG_HELHP       P---TFEKAEAFIENVVEDFLNGAT--------------------DEVIIVHNGFKNMIS
ATPG_WOLSU       P---DYERAAEFVNKATTDFINGVT--------------------DKVILVHNGFKNMIS
ATPG_HELPY       P---NYERVQEFMKKVVEDYLSGKT--------------------DKVIIIHNGFKNMIT
ATPG_HELPJ       P---NYERAQEFMKKVVEDYLSGKT--------------------DKVIIIHNGFKNMIT
ATPG_CAMJR       P---DYEKACEVIHAAVDDFLNGNT--------------------DEVILVHNGYKNMIT
ATPG_RICPR       H---SENLILQVKEKIMCAVKNLEV--------------------SNCIIYFNKFKNAMT
ATPG_BDEBA       I---SYELASKVANRVMNDYLEGSY--------------------DEVRIVHNEFKSAIS
ATPG_MESFL       ID-FSPAQAKQIGNELLSYYSSGEF--------------------DEIQIVYTKFINNVT
ATPG_MYCMS       IN-FTNEKAKIISNDLLAMYINREF--------------------DEIKIVYTKFINNVT
ATPG_MYCPU       DY-VTYKIAKLISDSALNSFLNKDV--------------------NQIKVVYTKFINLIN
ATPG_MYCS5       DK-LDYSIATEIGNLNFELFAKNKI--------------------SSCKIIYTKFVNNLI
ATPG_MYCGE       RD-INFDYCQTIFDQIMDAFKEFKL--------------------DRICMVYTKFKNSLI
ATPG_MYCPN       RD-LSFDYCQQVSDQIMEQFDLHQL--------------------DRICIIYTQFKNPLI
ATPG_MYCGA       KN-IDFESSYMIGKHVLELHEKNQY--------------------DSIDCVYTNYINSLN
                                                              .              

ATPG_CLOAB       QKVEVKKVLPIEPKKMEKV------------------------------SVAEFEPD-AE
ATPG_CLOPA       QDIIIKRVLPFDMKDIKYD------------------------------GSIEFEPE-IN
ATPG_CLOPE       QEVVEEKLLPLDLTGEKGK------------------------------VSFLIEPD-ED
ATPG_ACEWD       QHAQMMKLLPLSAEELITSGKVKTTEE---------TKEEKSKMSDRELTIMTYEPE-PE
ATPG_RUMA7       QEPQHLRILPV----------------------------ENLEYLGQKHPMTIYDPS-PE
ATPG_CALS4       QKVRTLRLLPLDVENFMSIAAEE---------------EEAVEEHVVIDSDMIYEPS-PS
ATPG_BACFR       QELLRERYLPIDLSAVQNDEER-----------------------GGVVNDYIIEPS-AA
ATPG_BACFN       QELLRERYLPIDLSAVQNDEER-----------------------GGVVNDYIIEPS-AA
ATPG_BACTN       QILLRETYLPIDLTRVVDEEEKQKEEEVQG---------------GEIANDYIIEPS-AE
ATPG_BACCA       QEVTERKLLPLTDFLAEN----KQRTV------------------------YEFEPS-QE
ATPG_GEOSE       QEVTERKLLPLTDFLAEN----KQRTV------------------------YEFEPS-QE
ATPG_BACP3       QEVTERKLLPLTD-LAEN----KQRTV------------------------YEFEPS-QE
ATPG_GEOKA       QEVTERKLLPLTD-LAEN----KQRTV------------------------YEFEPS-QE
ATPG_BACMQ       QEVTEKKLLPLTD-LQPS----GKLVG------------------------YEFEPS-QE
ATPG_BACLD       QEVTEKKLLPLTD-IAPN----KKKTS------------------------FEFEPD-EE
ATPG_BACSU       QEVTEKKLLPLSD-LGSGG--GKRTAS------------------------YEFEPS-EE
ATPG_BACC1       QEVTENKILPLTD-VASD----KPTTA------------------------YEFEPS-EE
ATPG_BACCR       QEVTENKILPLTD-VASD----KPTTA------------------------YEFEPS-EE
ATPG_BACCZ       QEVTENKILPLTD-VASD----KPTTA------------------------YEFEPS-EE
ATPG_BACHK       QEVTENKILPLTD-VASD----KPTTA------------------------YEFEPS-EE
ATPG_BACHD       QDVTEKKVLPLTDLSD-----TKVSTT------------------------YEYEPN-EQ
ATPG_BACPE       QDVTEMKLLPLTDIGSDEK-ATSASAS------------------------YEYEPN-EQ
ATPG_BACSK       QRVTEQKLLPLASVNEGDE--TSSTSL------------------------YEFEPS-EQ
ATPG_OCEIH       QVVTNKQLLPIDNLDESG----AATSD------------------------YEFDPN-QE
ATPG_LISIN       SELRKEQLLPLTEFHEKGKETDVDLTT------------------------YEFEPS-EQ
ATPG_LISMO       SELRKEQLLPLTEFHEKGKETDVDLTT------------------------YEFEPS-EQ
ATPG_LISMF       SELRKEQLLPLTEFHEKGKETDVDLTT------------------------YEFEPS-EQ
ATPG_STAAM       NKPTSRQVLPLSQEDSSKG--HGHLSS------------------------YEFEPD-KE
ATPG_STAAW       NKPTSRQVLPLSQEDSSKG--HGHLSS------------------------YEFEPD-KE
ATPG_STAAN       NKPTSRQVLPLSQEDSSKG--HGHLSS------------------------YEFEPD-KE
ATPG_STAHJ       NKPTTKQVLPLSREDSSQG--QGQMSS------------------------YEFEPD-KE
ATPG_STAES       NKPATKQVLPLSQEDSGQG--HGQMSS------------------------YEFEPD-KE
ATPG_STAEQ       NKPATKQVLPLSQEDSGQG--HGQMSS------------------------YEFEPD-KE
ATPG_STAS1       NTPSTKTVLPLSPEDSSLG--HGQMSS------------------------YEFEPD-KE
ATPG_ENTFA       SQFRVEKMLPITDLDPSEATSYEQ--------------------------EYLLEPS-PE
ATPG_ENTHA       SQFRVEKMLPISDLDPEEATTFDQ--------------------------EYIFEPS-KE
ATPG_STRA3       SQVRMQQMLPIKELDADEASEDRVI------------------------TGFELEPN-RE
ATPG_STRA5       SQVRMQQMLPIKELDAEEASEDRVI------------------------TGFELEPN-RE
ATPG_STRP1       SQVRVQQMLPISDLVADEAAEEGV-------------------------TGFELEPN-RH
ATPG_STRP8       SQVRVQQMLPISDLVADEAAEEGV-------------------------TGFELEPN-RH
ATPG_STRP6       SQVRVQQMLPISDLVADEAAEEGV-------------------------TGFELEPN-RH
ATPG_STRP3       SQVRVQQMLPISDLVADEAAEEGV-------------------------TGFELEPN-RH
ATPG_STREI       SQVRVQQMLPIAELDADEAAEEGV-------------------------SGFELEPN-RE
ATPG_STRMU       SQVRVEKMLPISDLDADEASEDNV-------------------------ANFELEPS-RE
ATPG_STRTR       REVRVEKMLPIADFDPNES-EGHVL------------------------TKFELEPD-RD
ATPG_STRT2       REVRVEKMLPIADFDPNES-EGHVL------------------------TKFELEPD-RD
ATPG_STRT1       REVRVEKMLPIADFDPNES-EGHVL------------------------TKFELEPD-RD
ATPG_STRPN       SQMRVEQMLPIVDLDPNEADEEYS-------------------------LTFELETS-RE
ATPG_STRR6       SQMRVEQMLPIVDLDPNEADEEYS-------------------------LTFELETS-RE
ATPG_STRSA       SQMRVEQMLPIIDLDPNEADEDYT-------------------------LNLELESS-RD
ATPG_LACLM       SEARMEKMLPISFDEKGDEKASLV--------------------------TFELEPD-RE
ATPG_LACLA       SDARMEKMLPISFEESGQQKPSLE--------------------------TFELEPD-RE
ATPG_LACAC       SAFRVEKMLPIVDLDIGVKEAEAHKE-----------------------LEYDIEPD-VN
ATPG_LACJO       SAFRVESMLPISDIDINHKETMPK--------------------------DYIIEPD-ID
ATPG_LACPL       SGFRAVKMLPISEETFEQSESDNRKAKDSR----------VD-----VGPEYEMEPS-EE
ATPG_OENOE       NDVVNQQILPIRSENFQRDEKGNLTA-DKY----------KG-----QSSIYEFEPA-PE
ATPG_COREF       QKPVVHQLLPVEPVIEDDIFERGESALSDG----------K----NEIEPDYEFEPD-AD
ATPG_CORGL       QNPVVHQLLPVEPVIEDEIFEKGEDLLSSS---------------GEVEPDYEFEPD-AD
ATPG_CORDI       QTARAHQLLPIEPVIETVEIPEADGILDQS---------------GEPTPDVEFEPD-AD
ATPG_CORJK       QKPEAHRLLPIETVVEEEKFELGEDLVSDK----------V----DHIAADYDFEPD-PD
ATPG_MYCBO       QSAEAHRIAPMVVEYVEED--------------------------IGPRTLYSFEPD-AT
ATPG_MYCTU       QSAEAHRIAPMVVEYVEED--------------------------IGPRTLYSFEPD-AT
ATPG_MYCPA       QSAVAHRIAPMVVEYVEEP--------------------------PEVRTLYSFEPD-AT
ATPG_MYCLE       QSTKARRMAPMVVEYVEES--------------------------KLPRTLYSFEPD-AT
ATPG_NOCFA       QTPEVRRLAPIQVSFVDENFDMGEDSFSDS----------PT---AEVQAQYEFEPD-AD
ATPG_STRCO       QTAVDSRLLPLSLDEVAEESG----------------------AKDEILPLYDFEPS-AE
ATPG_STRLI       QTAVDSRLLPLSLDEVAEESG----------------------AKDEILPLYDFEPS-AE
ATPG_STRAW       QTAIDARLLPLSLEEVAEESS----------------------TQGEIRPLYDFEPS-AE
ATPG_LEIXX       QEPQVVRLLPMEVVEGVEEP-----------------------DRTQVLPLYEFEPD-VN
ATPG_CUTAK       QTPKVIRLLPLAVVDPQDTPEGQLAEGDPG----------VGANAEEIFHEYRFEPN-PV
ATPG_LEPIC       QKPEVTRVLPLEPAGE---------------------------GSVSDMMVYE--PS-PE
ATPG_RHOBA       QEAVIETLLPLGSLGDESDSASD--------------------GSDDTNAEYEFLPS-AE
ATPG_ACIAD       QQPKVEQLVPLAPA---------------------AEGDD---LNRTYGWDYIYEPE-AE
ATPG_PSYA2       QKPTINQLVPLPDS---------------------AFAEEESGIQTELSWDYIYEPD-IK
ATPG_LEGPL       QKPFVKQLLPLPKS---------------------EEDKK----TLGHHWDYIYEPE-AK
ATPG_LEGPH       QKPFVKQLLPLPKS---------------------EEDKK----TLGHHWDYIYEPE-AK
ATPG_LEGPA       QKPFVKQLLPLPKS---------------------EEDKK----TLGHHWDYIYEPE-AK
ATPG_PSE14       QQPTVEQLIPLVAT---------------------PD--Q----GLKHHWDYLYEPD-AK
ATPG_PSEU2       QQPTVEQLIPLVAT---------------------PD--Q----GLKHHWDYLYEPD-AK
ATPG_PSEF5       QQPTVEQLIPLEAT---------------------PD--Q----ELKHHWDYLYEPD-AK
ATPG_PSEPK       QKPTVEQLVPLVAT---------------------PD--Q----DLKHHWDYLYEPD-AK
ATPG_PSEAE       QKPTVEQLIPLVAD---------------------DD--Q----ELKHHWDYLYEPD-AK
ATPG_METCA       QKPKLECLAPI-KA---------------------EELSD----ELKGHWDYLYEPD-AK
ATPG_COXBU       QKPLVRQLLPLKTD---------------------EE--E----VEGGYWDYIYEPDESK
ATPG_COLMA       QEPTIDQLLPLPKS---------------------DDE------AISHRWDYIYEPD-AN
ATPG_COLP3       QDATIDQLLPLPKS---------------------DDE------EISHRWDYIYEPD-AN
ATPG_SHEON       QTPVIEQLLPLPKS---------------------EDD------EVAHRWDYIYEPD-PK
ATPG1_PHOPR      QEPVIDQLLPLPKS---------------------KDEEM----QRNHSWDYIYEPE-PK
ATPG_ALIF1       QEPAIEQLLPLPKS---------------------EDEAM----QRTHAWDYIYEPE-PK
ATPG_VIBVU       QQPTIDQLLPLPKS---------------------DSKDM----QREHSWDYIYEPE-PQ
ATPG_VIBVY       QQPTIDQLLPLPKS---------------------DSKDM----QREHSWDYIYEPE-PQ
ATPG_VIBAL       QQPTIDQLLPLPKS---------------------DSEEM----QREHSWDYIYEPE-PK
ATPG_VIBCH       QKPKIDQLLPLPKS---------------------DSEDM----QRDHMWDYIYEPE-PK
ATPG_PECAS       QEPLIVQVLPLPPS---------------------DDSE-----LKKKAWDYLYEPD-PK
ATPG_YERPS       QEPRIMQLLPLPPA---------------------EDGE-----LKKKSWDYLYEPD-PK
ATPG_ECOLI       QVPTISQLLPLPAS---------------------DDDD-----LKHKSWDYLYEPD-PK
ATPG_ECO57       QVPTISQLLPLPAS---------------------DDDD-----LKHKSWDYLYEPD-PK
ATPG_ECOL6       QVPTISQLLPLPAS---------------------DDDD-----LKHKSWDYLYEPD-PK
ATPG_SHIFL       QVPTISQLLPLPAS---------------------DDDD-----LKHKSWDYLYEPD-PK
ATPG_SALCH       QVPTITQLLPLPAS---------------------EDDD-----LKRKAWDYLYEPD-PK
ATPG_SALTY       QVPTITQLLPLPAS---------------------EDDD-----LKRKAWDYLYEPD-PK
ATPG_SALPA       QVPTITQLLPLPAS---------------------EDDD-----LKRTAWDYLYEPD-PK
ATPG_PHOLL       QEPTITQLLPLPAG---------------------DDET-----LKKKSWDYLYEPD-PK
ATPG2_PHOPR      QNPRITQLLPHPDK---------------------DESQDSKPNDATSRWDYIYEPD-PK
ATPG_IDILO       QEPTIHQLLPLPQA---------------------GSEED----VQTGSWDYLYEPN-PE
ATPG_HAEIN       QKPVVQQLVPLPES---------------------KDDHLN---ERQQTWDYLYEPE-PK
ATPG_HAEI8       QKPVVQQLVPLPES---------------------KDDHLN---ERQQTWDYLYEPE-PK
ATPG_MANSM       QKPSFAQLVPLPEL---------------------DTDNLG---ERQQAWDYIYEPD-PK
ATPG_PASMU       QKPVLEKLIPLPEL---------------------DNDELG---ERKQVWDYIYEPD-AK
ATPG_HAEDU       QKTVIAQLLPLPKL---------------------ENDEL----ETKCSWDYLYEPN-PQ
ATPG_ACIFR       QRATVEQLLPVEKP---------------------TASAE----QRAELWDYIYEPE-AR
ATPG_AROAE       QEPVLEQLLPLTG------------------EKLGTPEG---------SWDYLYEPD-PQ
ATPG_DECAR       QEPVFEKLLPLSG------------------DAVGSAKT---------KWDYVYEPE-AK
ATPG_BORBR       QEPVFLRLLPLSNGLDDPFQSGV--------ETLAKTAEI----KSDYSWDYIYEPD-AK
ATPG_BORPE       QEPVFLRLLPLSNGLDDPFQSGV--------ETLAKTAEI----KSDYSWDYIYEPD-AK
ATPG_BURMA       QETVIEQLLPLSS------------------EHFDANDG-----TPATSWDYIYEPD-AQ
ATPG_BURPS       QETVIEQLLPLSS------------------EHFDANDG-----TPATSWDYIYEPD-AQ
ATPG_CUPPJ       QEPMVEQLLPLAA------------------DKLAQTEEE----KRAYSWDYIYEPD-AQ
ATPG_RALSO       QEPVVEQLLPLTA------------------DKLTQTAAE----KQAYSWDYIYEPD-AQ
ATPG_NITEU       QMPVMEQLLPLTD------------------DRISSEDGEAR--PTRAPWDYIYEPE-AK
ATPG_XANAC       QKASFDQLLPLPA-------------------AEHKVAHH--------DWDYLYEPD-AA
ATPG_XANOR       QKASFDQLLPLPA-------------------AEHKVAHH--------DWDYLYEPD-AA
ATPG_XANCP       QKASFEQLLPLPA-------------------AEHKVAHH--------DWDYLYEPD-AA
ATPG_XANC8       QKASFEQLLPLPA-------------------AEHKVAHH--------DWDYLYEPD-AA
ATPG_XYLFA       QKASFDQLLPLLA-------------------AKDKVAHH--------DWDYLYEPD-AA
ATPG_XYLFT       QKASFDQLLPLLA-------------------AKDKVAHH--------DWDYLYEPD-AA
ATPG_NEIG1       QEPRMEVLLPIGE------------------NVIGDSAPKS-----PFSWEYRYEPT-AL
ATPG_NEIMA       QEPRMEVLLPIGE------------------NVIGDSAPKS-----PFSWEYRYEPT-AL
ATPG_CHRVO       QEPALEQLLPLTP------------------HHM---VVEH-----SHSWDYLYEPD-AP
ATPG_BUCAI       QYPTITQLLPFS--------------------------KKNDQDASNNNWDYLYEPE-SK
ATPG_BUCAP       QYPKISQLLPLYN-------------------------EKNIFSNKKIKWDYLYEPE-SK
ATPG_BUCDN       QYPKIIQLLPLSR-------------------------IKSETISTK-RWDYLYESE-SK
ATPG_BUCMH       QIPSIIQLLPLSK-------------------------KKI-HCH-NNHWDYIYESD-SK
ATPG_BUCSC       YIPVIMQLLPLSK-------------------------KIF-KGNKNSHWDYIYESN-SG
ATPG_BUCBP       QTPTLVQLLPILK-------------------------PKLGKKEVKKTWDYIYESN-SK
ATPG_WIGBR       YVPDIKKVLPISI-------------------------KKS--SIKFKNLNYLYEPD-FS
ATPG_FRATT       QRPRLQTLLPIQDI------------------FSAEEIKANKEKATKGHWDYIYERD-IE
ATPG_NOSS1       SRPVIQTLLPLDTQGLEAADDEIFRLTTRGGQFQVERQ-TVTSQARPLPRDMIFEQD-PV
ATPG_SYNP6       SNPVVQTLLPLDPQGLASSDDEIFRLTTRGGSFTVERE-KLTSEVAPLPRDMIFEQD-PA
ATPG_SYNP1       SKPVVQTLLPLDPQGLEAADDEIFRLTTRASHLEVNRE-KVTSNLPALPPDMIFEQD-PV
ATPG_SYNY3       SQPVVQTLFPLSPQGLEAPDDEIFRLITRGGKFQVERE-KVEAPVESFPQDMIFEQD-PV
ATPG_ARTPT       SRPVTQTLLPLDLQGLEAQDDEVFRLTSKGGKFDVTRE-KVSVEPEALAQDMIFEQD-PV
ATPG_PROMA       CDPVVQTLLPLDPQGIAKEDDEIFRITTKGSRFVIEKDPAPANEEPVLPSDVVFEQS-PD
ATPG_PROMM       CNPVVQTLLPLDPQGIAEADDEIFRLTTKDSRLTVEKGVGPANEQPPLPSDIIFEQS-PE
ATPG_PROMP       CAPVVQTLLPLDPQGIAEDNDEIFRLTTKNSKLLVEKSNIEKNDSDKLPSDIVFEQS-PD
ATPG_SYNPX       CKPVVQTLLPLDPQDIADPEDEIFRLTTKDGRLTVEPGAGPANTEPKIPSDIVFEQT-PE
ATPG_GLOVI       SRPTVQTLLPLDPDALG-QEDETFKLITKGGGFEVLREKQQVRTEPEFAADTIFEQD-PT
ATPG_PARUW       RKVMVEKFLNIQ---------------------------QISPKSEKSPVDYIFEPN-PK
ATPG_DESPS       QAPVAEDLLPIQPVVSSEP-----------------------AGEQTMSGDYIYEPS-SE
ATPG_DESVH       QLPITLPILPIASEKKDE-------------------------AEAAPSKEYIYEPA-VE
ATPG_AQUAE       YKPQVRVFLPFEAQE----------------------------KEVEELGTYEFEVS-EE
ATPG_MOOTA       QVPMVERLLPIATPREK-----------------------------KDTGDYIYEPS-PE
ATPG_SYMTH       QRPKEMQLLPIQPAQADG---------------------------AHTHVEYIYEPS-PE
ATPG_AGRFC       QIPTGLQLIPAATPVVEAAETT-------------------------QTAVYEYEPD-AA
ATPG_RHIME       QIPTAQQLIPASAGEVAAAEGEG------------------------ASAIYEYEPE-AG
ATPG_BRUAB       QVSTAQQLIPASADNEAEMETA-------------------------GDAIYEYEPD-PA
ATPG_BRUME       QVSTAQQLIPASADNEAEMETA-------------------------GDAIYEYEPD-PA
ATPG_BARHE       QRPVAFGLVPMVSSGGAVETAEVEQKIDNS--------------ADLQSIVYDYEPD-AA
ATPG_BARQU       QRPVAFGLIPMGSPKGAVEAEDVTQKVDEN--------------KNLQSIVYDYEPD-VA
ATPG_RHOPA       QIPTAQQLIPLEVTAPAAGTVA---------------------------TSYEYEPE-ED
ATPG_RHOBL       QVPTAQQVIPAKFEA---AETNA---------------------------LYDYEPS-EE
ATPG_RUEPO       QLPTAQQIIPAAFEAEGESDEVA---------------------------LFDYEPS-EE
ATPG_RHOCA       QVPTAKQVIPAQFETDA-ASASA---------------------------VYDYEPG-DQ
ATPG_CAUVC       QIPTGLQLIPAVVETGEAASGPT--------------------------AVYEYEPS-EE
ATPG_GLUOX       QIPVQAPLVPLSVPE-----NDNAA-------------------PDADTAQYEFEPD-EA
ATPG_RHORU       QVVTRQQIIPFAVPTTVAAGNDNDR-------------------TAGPKAIYEYEPS-EE
ATPG_PELUB       QIPQEQQIIPLKTSEAEENSSED---------------------------NYEFEPD-ED
ATPG_ZYMMO       QVPTETQIIPAAPEGDDTKNQAAAN--------------------DASSGAIEFEPD-EE
ATPG_HELHP       QELESQAILPLTIN-IKQNEQPS-------------------------VLNIEPEDE-EN
ATPG_WOLSU       QELKVQDLLPIKADAIEAKESLG-------------------------MMEVEPSEQ-ER
ATPG_HELPY       QEIRVKTILPIGYKIIHQNPQPSETQE---------------------TITSEPSGS-ED
ATPG_HELPJ       QEIRVKTILPIGYKIIHQNPQPSETQE---------------------TITSEPSGS-ED
ATPG_CAMJR       QELKINHLIPVEPKSIEQTHNSL--------------------------LELEPEG---T
ATPG_RICPR       QIPTKQKILPIEKHQDYSVVAND-----------------------------YFEYE-GK
ATPG_BDEBA       QVVTAETLLPIDLGMTTFKKEADTASNF--------------------AVDMIFEPA-PE
ATPG_MESFL       FEPTKLRVFPIIKEETQETSSSYYS----------------------------FEPS-AE
ATPG_MYCMS       FEPAIIRIFPIVKSELHFTHKQKII----------------------------FEPD-AD
ATPG_MYCPU       QQEKISTILPIKKNPMKSEIKENAI--------------------------LEFEPD-VE
ATPG_MYCS5       QEVSVKQLFPYDSSHLEIKKESEQMEG-----------------------DIEFEPS-AE
ATPG_MYCGE       QQSQLFQVFPFDVETFKTLNPVVTDQQ------------------------LDFEPD-QA
ATPG_MYCPN       QHANSFQVFPFDVAMFKAFNPVKMEQK------------------------LDFEPD-EE
ATPG_MYCGA       FEAKKIQLIPADPSIFQADTLDRINDKFPK--------------------NISFEPG-VD
                                                                             

ATPG_CLOAB       IILEKAIRLHIEQQLFNLLLNSKASEQASRMSSMDSATKNANDLLDALNIKYNRIRQSAI
ATPG_CLOPA       ELIEGIVAVYLKSQLFNFLLNSKASEQASKMTAMDSATKNANELLDDLNLRYNRIRQSAI
ATPG_CLOPE       EIIDSLVSSYLKGKFMNAMFNSKASEQSARMQAMDGATKNADDLLNSLDAKYNRIRQSII
ATPG_ACEWD       ELLKYLIPNFVSSTVYGSMIESAASEQGARRTAMESATTNANEMIDGLTLQYNRVRQAAI
ATPG_RUMA7       EVFDSLIPEYMGGMLYSAIVDSFASEQAARRTAMESASDNANEMIEKLSLLYNRARQAQI
ATPG_CALS4       EVFDAIVPEYLKGLIYSILVQAFASEHFSRMVAMDGATSNADEMIEKLTLLYNKLRQASI
ATPG_BACFR       QLIADLIPQVLSQKIFTAALDSNASEHAARTLAMQIATDNANELIQELTKQYNKTRQQAI
ATPG_BACFN       QLIADLIPQVLSQKIFTAALDSNASEHAARTLAMQIATDNANELIQELTKQYNKTRQQAI
ATPG_BACTN       ELIANLIPTVLSQKLFTAAVDSNASEHAARTLAMQVATDNANELIQDLTKQYNKSRQQAI
ATPG_BACCA       EILDVLLPQYAESLIYGALLDAKASEHAARMTAMKNATDNANDVIRTLTLSYNRARQAAI
ATPG_GEOSE       EILDVLLPQYAESLIYGALLDAKASEHAARMTAMKNATDNANDVIRTLTLSYNRARQAAI
ATPG_BACP3       EILDVLLPQYAESLIYGALLDAKASEHAARMTAMKNATDNANELIRTLTLSYNRARQAAI
ATPG_GEOKA       EILDVLLPQYAESLIYGALLDAKASEHAARMTAMKNATDNANELIRTLTLSYNRARQAAI
ATPG_BACMQ       EILEVLLPQYAESLIYGGLLDGKASEHAARMTAMKSATDNAKDLINNLTLSYNRARQAAI
ATPG_BACLD       EILEVLLPQYAESLIFGALLDSKASEHAARMTAMRNATDNAKEIIADLELSYNRARQASI
ATPG_BACSU       EVLEVLLPQYAESLIFGALLDSKASEHAARMTAMKNATDNAKELIDSLSLSYNRARQAAI
ATPG_BACC1       EILKVLLPQYAESLVYGALLDGKASEHAARMTAMKSATDNAMEVIDSLTLSFNRARQAAI
ATPG_BACCR       EILKVLLPQYAESLVYGALLDGKASEHAARMTAMKSATDNAMEVIDSLTLSFNRARQAAI
ATPG_BACCZ       EILKVLLPQYAESLVYGALLDGKASEHAARMTAMKSATDNAMEVIDSLTLSFNRARQAAI
ATPG_BACHK       EILKVLLPQYAESLVYGALLDGKASEHAARMTAMKSATDNAMEVIDSLTLSFNRARQAAI
ATPG_BACHD       VILEALLPQYAESLVYGALLDAKASEFAARMTAMSAATDNATNLIDELTLSYNRARQAAI
ATPG_BACPE       AILEKLLPQYAESLIYGSLLDAKASEFGARMTAMSAATDNASALIEELTLKFNRARQAAI
ATPG_BACSK       QILEAVLPRYAESLIYGALLDAKASEFGARMTAMSAATDNASALIDELTLSYNRARQAAI
ATPG_OCEIH       QILEVLLPQYAESLIFGALLDGKASEHAASMTAMRSATDNASDLIDDLSLSYNRARQAAI
ATPG_LISIN       EILEVLLPQYVESLIFGALLDAKAAEHAARMTAMRSATDNASDLISDLSLQYNRARQAAI
ATPG_LISMO       EILEVLLPQYVESLIFGALLDAKAAEHAARMTAMRSATDNASDLISDLSLQYNRARQAAI
ATPG_LISMF       EILEVLLPQYVESLIFGALLDAKAAEHAARMTAMRSATDNASDLISDLSLQYNRARQAAI
ATPG_STAAM       SILSVILPQYVESLIYGTILDAKASEHATRMTAMKNATDNATELIDDLSLEYNRARQAEI
ATPG_STAAW       SILSVILPQYVESLIYGTILDAKASEHATRMTAMKNATDNATELIDDLSLEYNRARQAEI
ATPG_STAAN       SILSVILPQYVESLIYGTILDAKASEHATRMTAMKNATDNATELIDDLSLEYNRARQAEI
ATPG_STAHJ       SILSVILPQYVESLIYGTILDAKASEHAARMTAMKNASDNATELIDDLSLQYNRARQAEI
ATPG_STAES       SILSVILPQYVESLIYGTILDAKASEHASRMTAMRNASDNATELIDDLSLEYNRARQAAI
ATPG_STAEQ       SILSVILPQYVESLIYGTILDAKASEHASRMTAMRNASDNATELIDDLSLEYNRARQAAI
ATPG_STAS1       AILSVILPQYVESLIYGTILDAKASEHATRMTAMKNASDNASEIIDDLSIQYNRARQAAI
ATPG_ENTFA       AILDQLLPQYAESLIYGAIIDAKTAEHAAGMTAMKTATDNAQNIISDLTISYNRARQGAI
ATPG_ENTHA       EILAQLLPQYAESLIYGAIVDAKTAEHAAGMTAMKTATDNAATIIDDLTVSYNRARQGAI
ATPG_STRA3       VILEQLLPQYTESLIYGAIIDAKTAEHAAGMTAMQTATDNAKNVINDLTIQYNRARQAAI
ATPG_STRA5       VILEQLLPQYTESLIYGAIIDAKTAEHAAGMTAMQTATDNAKNVINDLTIQYNRARQAAI
ATPG_STRP1       DILDQLLPQFTESLIYGAIIDAKTAEHAAGMTAMQTATDNAKNVINDLTIQYNRARQAAI
ATPG_STRP8       DILDQLLPQFTESLIYGAIIDAKTAEHAAGMTAMQTATDNAKNVINDLTIQYNRARQAAI
ATPG_STRP6       DILDQLLPQFTESLIYGAIIDAKTAEHAAGMTAMQTATDNAKNVINDLTIQYNRARQAAI
ATPG_STRP3       DILDQLLPQFTESLIYGAIIDAKTAEHAAGMTAMQTATDNAKNVINDLTIQYNRARQAAI
ATPG_STREI       MILEQLLPQYTESLIYGAIVDAKTAEHAAGMTAMQTATDNAKNVINDLTIQYNRARQAAI
ATPG_STRMU       AILEQLLPQYAESLIYGAIIDAKTAEHAAGMTAMQTATDNADKVIEDLTKLYNRVRQAAI
ATPG_STRTR       TILDQLLPQYAESLIYGAIVDAKTAEHAAGMTAMQTATDNAKKIINDLTIQYNRARQAAI
ATPG_STRT2       TILDQLLPQYAESLIYGAIVDAKTAEHAAGMTAMQTATDNAKKIINDLTIQYNRARQAAI
ATPG_STRT1       TILDQLLPQYAESLIYGAIVDAKTAEHAAGMTAMQTATDNAKKIINDLTIQYNRARQAAI
ATPG_STRPN       EILEQLLPQFAESMIYGAIIDAKTAENAAGMTAMQTATDNAKKVINDLTIQYNRARQAAI
ATPG_STRR6       EILEQLLPQFAESMIYGAIIDAKTAENAAGMTAMQTATDNAKKVINDLTIQYNRARQAAI
ATPG_STRSA       SILDQLLPQFAESMIYGAIIDAKTAENAAGMTAMQTATDNAKKVISDLTIQYNRARQAAI
ATPG_LACLM       TILNQLLPQYAESMIYGSIVDAKTAEHAAGMTAMRTATDNAHSVINDLTIQYNRARQASI
ATPG_LACLA       TILNQLLPQYAESMIYGSIVDAKTAEHAAGMTAMRTATDNAHSVINDLTIQYNRARQASI
ATPG_LACAC       SVLMKLLPQYARSTIYGAILDAKTAEHASSMTAMQSATDNANDLVSNLTTKLNRARQAQI
ATPG_LACJO       SVLKTVLPQFAKSMIFGAILDAKTAEHASSMTAMQSASQNADDVVSGLKTKLNRARQAQI
ATPG_LACPL       AILSAVLPQYAESLVYGAILDAKTAEHASSSTAMKAASDNAGDLIDKLNLKYNRARQAAI
ATPG_OENOE       SLLKIVLPQFAQSLLYGAILDAKTAEHAASASAMRAATDNAKDLISTLELKYNRARQAAI
ATPG_COREF       TLLEALLPQYISRRLFSIFLEAAAAESASRRNAMKSATDNATELVKDLSRVANAARQAQI
ATPG_CORGL       TLLEALLPQYVSRRLFSIFLEAAAAESASRRNAMKSATDNATELVKDLSRVANQARQAQI
ATPG_CORDI       TLLEALLPQYVSRSLFAMFLEAAAAESASRRNAMKSATDNATALVKDLSRVANQARQAQI
ATPG_CORJK       TLLKALLPQYVSRGIFAAMLESAASESAARRTAMSAATDNATDLVKQLSRVANQARQAQI
ATPG_MYCBO       MLFESLLPRYLTTRVYAALLESAASELASRQRAMKSATDNADDLIKALTLMANRERQAQI
ATPG_MYCTU       MLFESLLPRYLTTRVYAALLESAASELASRQRAMKSATDNADDLIKALTLMANRERQAQI
ATPG_MYCPA       TLFESLLPRYLTTRVYAALLESAASELASRQRAMKSATDNADDLIKALTLMANRERQAQI
ATPG_MYCLE       TLFEALLPRYLTIRVYAAMLESAASELASRQRAMKSATDNADDLIKALTLEANRERQAQI
ATPG_NOCFA       VLLAALLPKYVNTRIYASLLEAAASESAARRTAMKAATDNANELASVLQREANSVRQAQI
ATPG_STRCO       DVLDALLPRYVESRIYNALLQSAASKHAATRRAMKSATDNAGELINTLSRLANAARQAEI
ATPG_STRLI       DVLDALLPRYVESRIYNALLQSAASKHAATRRAMKSATDNAGELINTLSRLANAARQAEI
ATPG_STRAW       DVLDALLPRYVESRIYNALLQSAASKHAATRRAMKSATDNAGELINTLSRLANAARQAEI
ATPG_LEIXX       TVLDSLLPVYIESRIFNAMLQSAASKHAATQKAMKAASDNADKLITDYTRLANNARQAEI
ATPG_CUTAK       SVLDELLPLYVANRVHYALLQSAASELASRQRAMKAATDNAEQLIQTLTRQANQARQAAI
ATPG_LEPIC       KVLESLLPLVVKTAFLKAILEANCSEQIARRIAMKSATDAASEMIKLLTRGYNRVRQAKI
ATPG_RHOBA       SILEEVVPTSFKVKLFKCFLDAAVSEQVARMIAMKGATESAGDMIKQLSMTYNRARQSQI
ATPG_ACIAD       QLLNGLLVRYIESMVYQGVIENVACEQSARMVAMKAATDNAGQLIKDLQLIYNKLRQAAI
ATPG_PSYA2       TLIDELLGRYIESIVYQAVMENIASEQSSRMVAMKAATDNAGDLINDLQLVYNKLRQAAI
ATPG_LEGPL       ELLDEILERYIELQVYQAVVENIACEQAAKMIAMKSATDNAGDLIKEFQLAYNKARQAAI
ATPG_LEGPH       ELLDEILERYIELQVYQAVVENIACEQAAKMIAMKSATDNAGDLIKEFQLAYNKARQAAI
ATPG_LEGPA       ELLDEILERYIELQVYQAVVENIACEQAAKMIAMKSATDNAGDLIKEFQLAYNKARQAAI
ATPG_PSE14       ELLDGLMVRYVESQVYQAVVENNAAEQAARMIAMKNATDNAGDLISDLQLIYNKARQAAI
ATPG_PSEU2       ELLDGLMVRYVESQVYQAVVENNAAEQAARMIAMKNATDNAGDLISDLQLIYNKARQAAI
ATPG_PSEF5       ELLDGLMVRYVESQVYQAVVENNAAEQAARMIAMKNATDNAGDLISDLQLIYNKARQAAI
ATPG_PSEPK       ELLDGLMVRYVESQVYQAVVENNAAEQAARMIAMKNATDNAGDLIKELQLIYNKARQAAI
ATPG_PSEAE       SLLDGLLVRYVESQVYQAVVENNACEQAARMIAMKNATDNAGELISDLQLIYNKARQAAI
ATPG_METCA       TVLDALITRYIESLVFQGLVENNACEQAARMVAMKSASDNAGKLIKELQLIYNKARQAAI
ATPG_COXBU       DLLEMLLVRYIESQVYQAVIENIACEQSARMVAMKNATENAGQLIDELRLIYNKARQAGI
ATPG_COLMA       SLLDQLLVRYIESQVYQGVVENIACEQASRMVSMKAATDNAGDLIDDLQLVYNKARQAAI
ATPG_COLP3       SLLDKLLVRYIESQVYQGVVENIACEQAARMVAMKAATDNAGDLIDDLQLVYNKARQAAI
ATPG_SHEON       ALLDTLLVRYVESQVYQGVVENIASEQAARMVAMKAATDNAGTLIDDLQLVYNKARQAAI
ATPG1_PHOPR      PLLDTLLVRYVESQVYQGVVENLACEQAARMVAMKSATDNAGDIINDLQLVYNKARQAAI
ATPG_ALIF1       PLLDALLVRYVESQVYQGVVENLACEHVARMIAMKAATDNAGDIIDELQLVYNKARQAAI
ATPG_VIBVU       ALLDALLVRYVESQVYQGVVENLACEQAARMVAMKAATDNATNLIDDLELVYNKARQAAI
ATPG_VIBVY       ALLDALLVRYVESQVYQGVVENLACEQAARMVAMKAATDNATNLIDDLELVYNKARQAAI
ATPG_VIBAL       PLLDTLLVRYVESQVYQGVVENLACEQAARMIAMKAATDNATNLIDDLELVYNKARQAAI
ATPG_VIBCH       PLLDALLLRFIESQVYQGVVENLACEQAARMVAMKAATDNASNLIDDLQLVYNKARQAAI
ATPG_PECAS       SLLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASI
ATPG_YERPS       ALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASI
ATPG_ECOLI       ALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASI
ATPG_ECO57       ALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASI
ATPG_ECOL6       ALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASI
ATPG_SHIFL       ALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASI
ATPG_SALCH       ALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASI
ATPG_SALTY       ALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASI
ATPG_SALPA       ALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASI
ATPG_PHOLL       ALLDILLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASI
ATPG2_PHOPR      DILNALMLRYIESQVYQGTVESIACEQAARMVAMKSATDNAGDIINDLQLVYNKARQSAI
ATPG_IDILO       SILDTLIRRFVEMQVYQGVVDNFASEQAARMIAMKAATDNAEDIIDQLQLRYNKARQAAI
ATPG_HAEIN       VLLDSLLVRYLESQIYQAVVDNVASEQAARMVAMKAATDNAGNLINDLRLVYNKARQASI
ATPG_HAEI8       ALLDSLLVRYLESQIYQAVVDNLASEQAARMVAMKAATDNAGNLINDLRLVYNKARQASI
ATPG_MANSM       MLLDSLLTRYLESQVYQSVVDNLASEQAARMVAMKAATDNAGNLINDLQLVYNKARQASI
ATPG_PASMU       VLLDNLLVRYLESQVYQAAVENLASEQAARMVAMKAATDNAGNLINELQLVYNKARQASI
ATPG_HAEDU       VLLDSLLIRYLETQVYQAVVDNLASEQAARMVAMKAATDNAGALIDELQLVYNKARQASI
ATPG_ACIFR       PVLDRLMQRYVESVVYQAVIEHLACEQSARMVAMKSASDNAKRMVDDLQLAYNKARQAAI
ATPG_AROAE       VVIDEMLVRYVEALVYQAVAENMASEQSARMVAMKAASDNAKNVIGELQLVYNKTRQAAI
ATPG_DECAR       SVIDDLLIRYVEALIYQAVAENMASEQSARMVAMKSASDNAKTVIGDLKLVYNKARQAAI
ATPG_BORBR       SVIDDLLQRYVEGLLYQAVAENMASEQSARMVAMKSASDNAKKVIGDLQLVYNKTRQAAI
ATPG_BORPE       SVIDDLLQRYVEGLLYQAVAENMASEQSARMVAMKSASDNAKKVIGDLQLVYNKTRQAAI
ATPG_BURMA       AVVDELLVRYVEALVYQAVAENMASEQSARMVAMKAASDNAKTVISELQLSYNKSRQAAI
ATPG_BURPS       AVVDELLVRYVEALVYQAVAENMASEQSARMVAMKAASDNAKTVISELQLSYNKSRQAAI
ATPG_CUPPJ       TVVEDLLVRYVEALVYQAVAENMASEQSARMVAMKAASDNAKNVIGELQLDYNKTRQAAI
ATPG_RALSO       TVVDELLIRYVEALVYQAVAENMASEQSARMVAMKAASDNAKNVIGELQLVYNKTRQAAI
ATPG_NITEU       PVIDDIMVRYIEALVYQAVAENMASEQSARMVAMKAASDNAGNLIDELTLIYNKSRQAAI
ATPG_XANAC       SVLEHVMTRYIESLVYQAVLENVASEHAARMVAMKAASDNANKMIGTLQLVYNKARQAAI
ATPG_XANOR       SVLEHVMTRYIESLVYQAVLENVASEHAARMVAMKAASDNANKMIGTLQLVYNKARQAAI
ATPG_XANCP       TVLEHVMTRYIESLVYQAVLENVASEHAARMVAMKAASDNANKMIGTLQLVYNKARQAAI
ATPG_XANC8       TVLEHVMTRYIESLVYQAVLENVASEHAARMVAMKAASDNANKMIGTLQLVYNKARQAAI
ATPG_XYLFA       TVLEHVMRRYIESLVYQAMLENIASEHAARMVAMKAASDNANKLIGTLQLVYNKARQAAI
ATPG_XYLFT       TVLEHVMTRYIESLVYQAMLENIASEHAARMVAMKAASDNANKLIGTLQLVYNKARQAAI
ATPG_NEIG1       AVLEYLVRRYLESVVYQALSDNMASEQAARMVAMKAATDNAGNAIKELRLVYNKSRQAAI
ATPG_NEIMA       AVLEYLVRRYLESVVYQALSDNMASEQAARMVAMKAATDNAGNAIKELRLVYNKSRQAAI
ATPG_CHRVO       TLMEFLVRRYLESVVYQALAENMASEQAARMVAMKAATDNAGNTIKQLRLVYNKARQAAI
ATPG_BUCAI       LILDTLFNRYIESQVYQSILENIASEHAARMIAMKTATDNSGNRIKELQLVYNKVRQANI
ATPG_BUCAP       LILDTLFDRYIESQIYQSLLENIASEQAARMVAMKTATDNSGNRIKELQLIYNKVRQANI
ATPG_BUCDN       LIIDSLFKRYIESQVYQSILENIASEHAARMMAMKTATENSTERIKELKLLYNKVRQATI
ATPG_BUCMH       LLLNKLLNNYLEFQIYQASLENYTSEQAARMIAMKQATDNSKDLIRELQIIYNKARQDNI
ATPG_BUCSC       ILLDTLLNDYIESQIYQSILENCTCEQASRMISMKQATDNSEDLIKKLRILYNKARQDNI
ATPG_BUCBP       VLLNVVLNRYIEFQIYQSILENLVCEQASRMLAMKQATDNSADLLKALQMNYNKVRQSSI
ATPG_WIGBR       SLFESILPRYIESLIYQSIVENISSEQSARMVAMKSAMDNSKNLIEELSLIYNKARQSNI
ATPG_FRATT       EVLNALFIRYIEAQVRGAILENAACEQAARMMAMKNATDNASDIIDQLKLDYNKVRQAMI
ATPG_NOSS1       QILDSLLPLYLSNQLLRALQESAASELAARMTAMSNASENAGELIKSLSLSYNKARQAAI
ATPG_SYNP6       QILSALLPLYLSNQLLRALQEAAASELAARMTAMNSASDNANALVGQLTLVYNKARQAAI
ATPG_SYNP1       QILDALLPLYLSNQLLRALQEAAASELAARMTAMNNASDNAQTLIGTLTLSYNKARQAAI
ATPG_SYNY3       QILEALLPLYNTNQLLRALQESAASELAARMTAMSNASDNAGQLIGTLTLSYNKARQAAI
ATPG_ARTPT       EILNALLPLFLTNQLLRAWQESTASELAARMTAMSNASDNASDLVKTLTLSYNKARQASI
ATPG_PROMA       QLLNSLLPLYLQNQLLRALQEAAASELASRMTAMNNASDNAKELAKTLNLTYNKARQAAI
ATPG_PROMM       QLLNALLPLYLQNQMLRALQESAASELASRMTAMNNASDNAKALAKTLTLDYNKARQAAI
ATPG_PROMP       QLLDSLLPLYLQNQILRALQESAASELACRMTAMNNASDNAKELASTLNLTYNKARQAAI
ATPG_SYNPX       QLLNALLPLYLQNQLLRSLQESAASELASRMTAMNNASDNAKELAKTLTLDYNKARQAAI
ATPG_GLOVI       QLLDALLPLYLTSEVLHALQESSASELAARMTAMSAASDNAKKLLSTLTIVYNKARQASI
ATPG_PARUW       QIYGAILFNYCMTKFQSILNESYASELAARIFAMKAATSNADDMIEKLTLVRNKVRQAGI
ATPG_DESPS       EIMDAMQPLYLNVLVYHAMLEVGASEHAARMTAMDNATTACRDIVSNLTIVYNKARQAAV
ATPG_DESVH       GLLAELLPRFIKVQIYRGLLDTSASEHAARMAAMDNATRSCDDMIGALTLLFNKTRQASI
ATPG_AQUAE       EFFDYIVNLYLNYQVYRAMVESNAAEHFARMIAMDNATKNAEDLIRQWTLVFNKARQEAI
ATPG_MOOTA       AVLRVLLPRYCEIKVYRALLEAKASEHGARMTAMDNATKNAAEMIDKFTLSFNRARQAAI
ATPG_SYMTH       RVLDTLVPRYAETMFYQLMLESKASEHGARMTAMGNATDNAEEMIAKLTLAYNRARQAAI
ATPG_AGRFC       SILEDLIPRNISVQVFRALLENVAGEMGAKMSAMDNATRNAGEMINKLTLSYNRQRQAQI
ATPG_RHIME       AILSDLIPRNISVQIFRALLENVAGEMGAKMSAMDNATRNAGEMIDKLTLSYNRQRQAQI
ATPG_BRUAB       AILSTLIPRNISVQIFRALLENVAGEMGAKMSAMDNATRNAGDMINKLSITYNRQRQAQI
ATPG_BRUME       AILSTLIPRNISVQIFRALLENVAGEMGAKMSAMDNATRNAGDMINKLSITYNRQRQAQI
ATPG_BARHE       SLLDVLVPRNLSVQIFRALLENVAGEMGAKMTAMDNASRNAGEMINKLTVAYNRQRQAQI
ATPG_BARQU       SLLEELVPRNLSVQIFQALLENVAGEMGAKVTAMDNASRNAGEMINKLTVAYNRQRQAQI
ATPG_RHOPA       EILSGLLPRNLAVQIFRALLENNASFYGAQMSAMDNATRNAGEMIRKQTLVYNRTRQAMI
ATPG_RHOBL       AILADLLPRGVATQIFTALLENAASEQGARMSAMDNATRNAGDMINKLTIQYNRSRQAAI
ATPG_RUEPO       AILADLLPRGVATQIFSALLENGASEQGARMSAMDNATRNAGEMIDKLTIEFNRSRQAVI
ATPG_RHOCA       EILTALLPRAVATAIFAALLENNASFNGAQMSAMDNATRNAGDMIDRLTIEYNRSRQAAI
ATPG_CAUVC       AILETLLPRNLTVQILSALLDNMAGFYASQMTAMDNATRNAGDMIKRYTLEYNRSRQAQI
ATPG_GLUOX       TLLTQLLPRNLQVQIFSAMLESAAGEQGARMTAMDNASRNASKAIDRLSQKYNRTRQANI
ATPG_RHORU       EILADLLPKNVAIQVFRGMLESFASEQGARMTAMDNATRNAGDMIKKLSLTYNRTRQAQI
ATPG_PELUB       EILSNLLPKNISTQIFKAMLENSASEQGSRMSAMDNATRNAGEMVDKLTIEYNRSRQAAI
ATPG_ZYMMO       TILSTLLPRSIAVAIYQAMLENATSEQGSRMSAMENSTRNAGEMISKLSIQYNRLRQAAI
ATPG_HELHP       IILDELAKKYVQYNMYYALVDSLAAEHSARIQAMDAATNNAGDLVKSLTISLNKARQEAI
ATPG_WOLSU       EILDQLAKKYIEFNMYYALIDSLAAEHSARMQAMDAASNNAGELVKSLTIAYNKARQEAI
ATPG_HELPY       EILDSLAEKYVEYSLYYALIDSLAAEHSARMQAMDTATNNAKDLVKTLTISYNKARQEAI
ATPG_HELPJ       EILDSLAEKYVEYSLYYALIDSLAAEHSARMQAMDTATNNAKDLVKTLTISYNKARQEAI
ATPG_CAMJR       ELLEDLMKTYFEYNMYYALIDSLAAEHSARMQAMDNATNNAKARVKQLNLAYNKARQESI
ATPG_RICPR       NLISNLINLYVHAKINYALLQNIVSEEGARMTAMENATNNANDLISKLVLKLNRSRQTII
ATPG_BDEBA       QIIKELLEKHFELQVYRCMSESVAGEHGARMSAMENATNNAKEMINKLTLTYNKLRQEKI
ATPG_MESFL       EVLNNAVTLYLSTIIFGTIVESQVSEQASRRLAMENATNNGKELEYNLSIQYNRERQASI
ATPG_MYCMS       QILNNTISIYINAIIYGTVIESQVSEQASRRTAMENATNNGQNLEHELSLKYNRQRQGAI
ATPG_MYCPU       SVFHKAIPLYLASIIFGFLTESKVSELAARRTAMESASKNAIDLIGNLKIEYNQTRQAKI
ATPG_MYCS5       IILQRAFPLYVSSMIYVLVSLSKVSELASRRVAMESATDNADEIINDLNLEYNSKRQSVI
ATPG_MYCGE       TIINLITPQFFDVALYGGLVETKLCESASRQNAMEAATKNAKDLLDKYTLQFNKLRQNSI
ATPG_MYCPN       TIIKLISPQFFDIALYGGLVETKLCESASRQNAMDAAAKNAKDLYEKYSIQFNKLRQNSI
ATPG_MYCGA       VIIPALEKQLLQVILYGCLIESKVCEYASRRNAMDTAAKNADDLYNKYKLLYNQLRQAKI
                  .            .                 :*  :               *  **  :

ATPG_CLOAB       TQEITEIVGGAEALK---------
ATPG_CLOPA       TQEITEIVSGAEAQK---------
ATPG_CLOPE       TQEISEIVGGAEAQK---------
ATPG_ACEWD       TQEISEIVGGAEALN---------
ATPG_RUMA7       TQEITEISSASLNDNS--------
ATPG_CALS4       TQEIIEIITGASV-----------
ATPG_BACFR       TNELLDIVGGSMA-----------
ATPG_BACFN       TNELLDIVGGSMA-----------
ATPG_BACTN       TNELLDIVGGSMQ-----------
ATPG_BACCA       TQEITEIVAGRNALQ---------
ATPG_GEOSE       TQEITEIVAGRNALQ---------
ATPG_BACP3       TQEITEIVAGANALQ---------
ATPG_GEOKA       TQEITEIVAGANALQ---------
ATPG_BACMQ       TQEITEIVGGAAALE---------
ATPG_BACLD       TQEITEIVGGAAALE---------
ATPG_BACSU       TQEITEIVGGAAALE---------
ATPG_BACC1       TQEITEIVGGAAALE---------
ATPG_BACCR       TQEITEIVGGAAALE---------
ATPG_BACCZ       TQEITEIVGGAAALE---------
ATPG_BACHK       TQEITEIVGGAAALE---------
ATPG_BACHD       TQEITEIVGGAAALE---------
ATPG_BACPE       TQEITEIVGGAAALE---------
ATPG_BACSK       TQEITEIVGGAAALE---------
ATPG_OCEIH       TQEITEIVGGVAALE---------
ATPG_LISIN       TQEITEIVGGAAALE---------
ATPG_LISMO       TQEITEIVGGAAALE---------
ATPG_LISMF       TQEITEIVGGAAALE---------
ATPG_STAAM       TQQITEIVGGSAALE---------
ATPG_STAAW       TQQITEIVGGSAALE---------
ATPG_STAAN       TQQITEIVGGSAALE---------
ATPG_STAHJ       TQQITEIVGGSAALE---------
ATPG_STAES       TQQITEIVGGSSALE---------
ATPG_STAEQ       TQQITEIVGGSSALE---------
ATPG_STAS1       TQQITEIVGGSVALE---------
ATPG_ENTFA       TQEITEIVAGAAALE---------
ATPG_ENTHA       TQEITEIVAGASALE---------
ATPG_STRA3       TQEITEIVAGANALE---------
ATPG_STRA5       TQEITEIVAGANALE---------
ATPG_STRP1       TQEITEIVAGANALE---------
ATPG_STRP8       TQEITEIVAGANALE---------
ATPG_STRP6       TQEITEIVAGANALE---------
ATPG_STRP3       TQEITEIVAGANALE---------
ATPG_STREI       TQEITEIVAGANALE---------
ATPG_STRMU       TQEITEIVAGANALD---------
ATPG_STRTR       TQEITEIVGGASALE---------
ATPG_STRT2       TQEITEIVGGASALE---------
ATPG_STRT1       TQEITEIVGGASALE---------
ATPG_STRPN       TQEITEIVAGASALE---------
ATPG_STRR6       TQEITEIVAGASALE---------
ATPG_STRSA       TQEITEIVAGASALE---------
ATPG_LACLM       TQEITEIVAGASAL----------
ATPG_LACLA       TQEITEIVAGASAL----------
ATPG_LACAC       TTEITEIISGANALE---------
ATPG_LACJO       TTEITEIIGGANALE---------
ATPG_LACPL       TTEITEITGGLVAQE---------
ATPG_OENOE       TTEITEITGGMAALQ---------
ATPG_COREF       TQEITEIVGGAGALSGSGESD---
ATPG_CORGL       TQEITEIVGGAGALADSGESD---
ATPG_CORDI       TQEITEIVGGASALGDSGESD---
ATPG_CORJK       TQEITEIVGGASALADSGESD---
ATPG_MYCBO       TQEISEIVGGANALAEAR------
ATPG_MYCTU       TQEISEIVGGANALAEAR------
ATPG_MYCPA       TQEISEIVGGANALADAR------
ATPG_MYCLE       TQEISEIVGGANALANAR------
ATPG_NOCFA       TQEISEIVGGVNALASSSDRD---
ATPG_STRCO       TQEISEIVGGASALADANAGSDN-
ATPG_STRLI       TQEISEIVGGASALADANAGSDN-
ATPG_STRAW       TQEISEIVGGASALADATAGSDR-
ATPG_LEIXX       TQQISEIVGGADALSSAN------
ATPG_CUTAK       TQEITEIVGGAAALAESAPQE---
ATPG_LEPIC       TQEISEIVAGADSLN---------
ATPG_RHOBA       TGEIMEIIGGVEALEG--------
ATPG_ACIAD       TQEISEIVGGAAAV----------
ATPG_PSYA2       TREISEIVGGAAAVS---------
ATPG_LEGPL       TQELAEIVGGAAAL----------
ATPG_LEGPH       TQELAEIVGGAAAL----------
ATPG_LEGPA       TQELAEIVGGAAAL----------
ATPG_PSE14       TQEISEIVGGAAAV----------
ATPG_PSEU2       TQEISEIVGGAAAV----------
ATPG_PSEF5       TQEISEIVGGAAAV----------
ATPG_PSEPK       TQEISEIVGGAAAV----------
ATPG_PSEAE       TQEISEIVGGAAAV----------
ATPG_METCA       TQEIAEIVGGAAAV----------
ATPG_COXBU       TREIAEIVAGAAAVE---------
ATPG_COLMA       TQELGEIVAGAAAVG---------
ATPG_COLP3       TQELGEIVAGAAAVG---------
ATPG_SHEON       TQELSEIVSGASAV----------
ATPG1_PHOPR      TQELSEIVSGASAV----------
ATPG_ALIF1       TQELSEIVSGASAV----------
ATPG_VIBVU       TQELSEIVGGAAAV----------
ATPG_VIBVY       TQELSEIVGGAAAV----------
ATPG_VIBAL       TQELSEIVGGAAAV----------
ATPG_VIBCH       TQELSEIVGGAAAV----------
ATPG_PECAS       TQELTEIVGGASAV----------
ATPG_YERPS       TQELTEIVGGASAV----------
ATPG_ECOLI       TQELTEIVSGAAAV----------
ATPG_ECO57       TQELTEIVSGAAAV----------
ATPG_ECOL6       TQELTEIVSGAAAV----------
ATPG_SHIFL       TQELTEIVSGAAAV----------
ATPG_SALCH       TQELTEIVSGAAAV----------
ATPG_SALTY       TQELTEIVSGAAAV----------
ATPG_SALPA       TQELTEIVSGAAAV----------
ATPG_PHOLL       TQELTEIVSGASAV----------
ATPG2_PHOPR      TQELSEIVAGAQAV----------
ATPG_IDILO       TQEISEIVSGAEAV----------
ATPG_HAEIN       TNELNEIVAGAAAI----------
ATPG_HAEI8       TNELNEIVAGAAAI----------
ATPG_MANSM       TNELNEIVAGAAAI----------
ATPG_PASMU       TNELNEIVAGAAAI----------
ATPG_HAEDU       TNELNEIVAGAAAI----------
ATPG_ACIFR       TQEIAEISAGAARFDDCAQHFWKF
ATPG_AROAE       TKELSEIVSGAAAV----------
ATPG_DECAR       TKELSEIVSGAAAV----------
ATPG_BORBR       TKEISEIVGGAAAV----------
ATPG_BORPE       TKEISEIVGGAAAV----------
ATPG_BURMA       TKELSEIVGGAAAV----------
ATPG_BURPS       TKELSEIVGGAAAV----------
ATPG_CUPPJ       TKELSEIVSGAAAV----------
ATPG_RALSO       TKELSEIVGGAAAV----------
ATPG_NITEU       TKELSEIVGGAAAV----------
ATPG_XANAC       TQEISEIVSGAAAV----------
ATPG_XANOR       TQEISEIVSGAAAV----------
ATPG_XANCP       TQEISEIVSGAAAV----------
ATPG_XANC8       TQEISEIVSGAAAV----------
ATPG_XYLFA       TQEISEIVGGAAAV----------
ATPG_XYLFT       TQEISEIVGGAAAV----------
ATPG_NEIG1       TTELSEIVAGAAAV----------
ATPG_NEIMA       TTELSEIVAGAAAV----------
ATPG_CHRVO       TTELSEIVAGAAAV----------
ATPG_BUCAI       TQELNEIVSGASAVSID-------
ATPG_BUCAP       TQELTEIVAGASAVSVD-------
ATPG_BUCDN       TQELTEIIAGASAVSTG-------
ATPG_BUCMH       TQELTEIVSGAAAISLN-------
ATPG_BUCSC       TQELTEIISGANAVSLY-------
ATPG_BUCBP       TQELTEIISGAAAVSLN-------
ATPG_WIGBR       TKELTEIIAGSNNIY---------
ATPG_FRATT       TQELAEICSGAAAV----------
ATPG_NOSS1       TQELLEVVGGAEALT---------
ATPG_SYNP6       TQELLEVVAGAEALNG--------
ATPG_SYNP1       TQEILEVVAGAEALR---------
ATPG_SYNY3       TQELLEVVAGANSL----------
ATPG_ARTPT       TQELLEVVAGA-------------
ATPG_PROMA       TQEILEVVGGASV-----------
ATPG_PROMM       TQEILEVVGGSCT-----------
ATPG_PROMP       TQEILEVVGGSAV-----------
ATPG_SYNPX       TQEILEVAGGAAAVG---------
ATPG_GLOVI       TQEILEVVSGANA-----------
ATPG_PARUW       TKEMLEITSGAEGLK---------
ATPG_DESPS       TNELMDIVGGAEALK---------
ATPG_DESVH       TRDLMDIVGGAEALKG--------
ATPG_AQUAE       TTELIDITNAVEALKAQ-------
ATPG_MOOTA       TNEIVEIVAGADALK---------
ATPG_SYMTH       TREISEIVGGANALQG--------
ATPG_AGRFC       TKELIEIISGAEAL----------
ATPG_RHIME       TKELIEIISGAEAL----------
ATPG_BRUAB       TKELIEIISGAEAL----------
ATPG_BRUME       TKELIEIISGAEAL----------
ATPG_BARHE       TTELIEIIAGAEAL----------
ATPG_BARQU       TTELIEIIAGAEAL----------
ATPG_RHOPA       TKELIEIISGAEAI----------
ATPG_RHOBL       TKELIEIISGAEAL----------
ATPG_RUEPO       TNELIEIISGAEAL----------
ATPG_RHOCA       TKELIEIISGAEAL----------
ATPG_CAUVC       TKELIEIISGAEAV----------
ATPG_GLUOX       TNDLIEIISGAEAV----------
ATPG_RHORU       TKELIEIISGAEAI----------
ATPG_PELUB       TKELIEIISGAESL----------
ATPG_ZYMMO       TTELVEIISGAEAL----------
ATPG_HELHP       TTELVEINAGAEAIK---------
ATPG_WOLSU       TTELVEINTGVESMK---------
ATPG_HELPY       TTELVEINAGVEALK---------
ATPG_HELPJ       TTELVEINAGVEALK---------
ATPG_CAMJR       TTELIEIISGVESMK---------
ATPG_RICPR       TTELIEIIAGAEAV----------
ATPG_BDEBA       TTELIEIVSGAEALKG--------
ATPG_MESFL       TQEISEIVSGANALMG--------
ATPG_MYCMS       TQEISEIVSGANAQS---------
ATPG_MYCPU       TQEISEIVAGSVE-----------
ATPG_MYCS5       TQEITEIVAGAQATN---------
ATPG_MYCGE       TEEIIEVIGGMN------------
ATPG_MYCPN       TQEIIEIIGGIS------------
ATPG_MYCGA       TQEINEIVAGAAK-----------
                 * :: ::  .