CLUSTAL format seed alignment for MF_00817

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

QUEF_ECOL6      ----MSSYANHQALAGLTLGKS-TDYRDTYDASLLQGVPRSLNRDPLGLKA---DNLPFH
QUEF_ECOL5      ----MSSYANHQALAGLTLGKS-TDYRDTYDASLLQGVPRSLNRDPLGLKA---DNLPFH
QUEF_ECO24      ----MSSYANHQALAGLTLGKS-TDYRDTYDASLLQGVPRSLNRDPLGLKA---DNLPFH
QUEF_ECOK1      ----MSSYANHQALAGLTLGKS-TDYRDTYDASLLQGVPRSLNRDPLGLKA---DNLPFH
QUEF_ECOUT      ----MSSYANHQALAGLTLGKS-TDYRDTYDASLLQGVPRSLNRDPRGLKA---DNLPFH
QUEF_SHIF8      ----MSSYANHQALAGLTLGKS-TDYRDTYDASLLQGVPRSLNRDPLGLKA---DNLPFH
QUEF_SHIFL      ----MSSYANHQALAGLTLGKS-TDYRDTYDASLLQGVPRSLNRDPLGLKA---DNLPFH
QUEF_SHIBS      ----MSSYANHQALAGLTLGKS-TDYRDTYDASLLQGVPRSLNRDPLGLKA---DNLPFH
QUEF_SHISS      ----MSSYANHQALAGLTLGKS-TDYRDTYDASLLQGVPRSLNRDPLGLKA---DNLPFH
QUEF_ECOHS      ----MSSYANHQALAGLTLGKS-TDYRDTYDASLLQGVPRSLNRDPLGLKA---DNLPFH
QUEF_ECOLC      ----MSSYANHQALAGLTLGKS-TDYRDTYDASLLQGVPRSLNRDPLGLKA---DNLPFH
QUEF_ECOLI      ----MSSYANHQALAGLTLGKS-TDYRDTYDASLLQGVPRSLNRDPLGLKA---DNLPFH
QUEF_ECO57      ----MSSYANHQALAGLTLGKS-TDYRDTYDASLLQGVPRSLNRDPLGLKA---DNLPFQ
QUEF_SHIDS      ----MSSYANHQALAGLTLGKS-TDYRDTYDASLLQGVPRSLNRDPLGLKA---DNLPFH
QUEF_CITK8      ----MSSYENHQALDGLTLGKS-TDYRDNYDASLLQGVPRSLNRDPLDLKA---DNLPFH
QUEF_SALCH      ----MSSYENHQALDGLTLGKS-TDYRDNYDASLLQGVPRSLNRDPLGLTA---DNLPFH
QUEF_SALTI      ----MSSYENHQALDGLTLGKS-TDYRDNYDASLLQGVPRSLNRDPLGLTA---DNLPFH
QUEF_SALTY      ----MSSYENHQALDGLTLGKS-TDYRDNYDVSLLQGVPRSLNRDPLGLTA---DNLPFH
QUEF_SALPA      ----MSSYENHQALDGLTLGKS-TDYRDNYDVSLLQGVPRSLNRDPLGLTA---DNLPFH
QUEF_SALPB      ----MSSYENHQALDGLTLGKS-TDYRDNYDASLLQGVPRSLNRDPLGLTA---DNLPFH
QUEF_SALAR      ----MSSYENHRALDGLTLGKS-TDYRDNYDASLLQGVPRSLNRDPLGLTA---DNLPFH
QUEF_KLEP7      ----MSSYDNHQALAGLTLGKS-TDYRDTYDASLLQGVPRSLNRDPLGLHA---DNLPFH
QUEF_CROS8      ----MTSYENHQALHGLTLGKS-TDYRDVYDASLLQPVPRSLNRDPLGLRA---DALPFH
QUEF_YERP3      ----MSSYQNHKALAELTLGKP-TAYCDHYDATLLQAVPRSMNREPLGLYP---DNLPFH
QUEF_YERPS      ----MSSYQNHKALAELTLGKP-TAYCDHYDATLLQAVPRSMNREPLGLYP---DNLPFH
QUEF_YERPN      ----MSSYQNHKALAELTLGKP-TAYCDYYDATLLQAVPRSMNREPLGLYP---DNLPFH
QUEF_YERPA      ----MSSYQNHKALAELTLGKP-TAYCDYYDATLLQAVPRSMNREPLGLYP---DNLPFH
QUEF_YERPP      ----MSSYQNHKALAELTLGKP-TAYCDYYDATLLQAVPRSMNREPLGLYP---DNLPFH
QUEF_YERPE      ----MSSYQNHKALAELTLGKP-TAYCDYYDATLLQAVPRSMNREPLGLYP---DNLPFH
QUEF_YERE8      ----MSSYQDHKALAELTLGKP-TAYCDHYDVTLLQAVPRSMNREPLGLYP---DNLPFH
QUEF_PECAS      ----MSVYDKHQALSRLTLGKP-TPYHDRYDAALLQPVPRSLNRDPLGIYP---DSLPFH
QUEF_PHOLL      ----MSLYRDHQALEQLTLGKT-TLYRDQYDASLLQAVPRNMNREPLEIFP---DNLPFH
QUEF_SODGM      ----MTNYDQHHALQSLTLGKP-TPYRERYDPSLLQAVPRALNRDLLGLQA---TALPFH
QUEF_BAUCH      -----MTDQQYQLLQKFKLDKSKISYRTHYNPMLLQPIPRTIHRELLGISS---ISLPFQ
QUEF_ACTP2      ------MNYNDKSLSALKLGQK-TEYKSEYDPTLLQPVPRKLNRDGLGITE---QQPFDR
QUEF_HAEDU      ------MSYTDTVLSSLKLGQK-TEYTGEYDPTLLQAVPRKLNRDHLGITE---QQPFNQ
QUEF_HAEI8      ------MNYQDNSLKSLKLGQK-TEYASQYDRTLLQPVPRALNRDGLGITQ---NQPFTI
QUEF_HAEIG      ------MNYQDNSLKSLKLGQK-TEYASQYDRTLLQPVPRALNRDGLGITQ---NQPFTI
QUEF_HAEIE      ------MNYQDNSLKSLKLGQK-TEYASQYDRTLLQPVPRALNRDGLGITQ---NQPFTI
QUEF_HAEIN      ------MNYQDNSLKSLKLGQK-TEYASQYDRTLLQPVPRALNRDGLGITQ---NQPFTI
QUEF_ACTSZ      ------MNRYDNSLSGLKLGQK-TEYNAKYDRTLLQPVPRRLNRDDLGISA---QQPFNQ
QUEF_MANSM      ------MDYKDNSLKTLKLGQK-TDYIANYDRTLLQPVPRALNRDGLGITK---QQPFSV
QUEF_HAES1      ------MQYHDQSLQTLKLGKK-TEYISTYDRTLLQAVPRKLNRDDLGIST---KQPFSF
QUEF_HISS2      ------MQYHDQSLQTLKLGKK-TEYISTYDRTLLQAVPRKLNRDDLGIST---KQPFSF
QUEF_PASMU      ------MQYQHDSLDKLKLGQQ-TQYASNYDHTLLQPVPRHLNRDTLGITH---TQPFHF
QUEF_VIBPA      ----MSKYSDAKELAGLTLGKK-TEYANQYDASLLQPVPRSLNRDDLELG----DTLPFL
QUEF_VIBCB      ----MSKYSDAKELAGLTLGKK-TEYANQYDASLLQPVPRSLNRDDLELG----DSLPFL
QUEF_VIBVU      ----MSKYSDAKELAGLTLGKK-TDYANQYDPSLLQPVPRSLNRDDLQLG----DELPFM
QUEF_VIBVY      ----MSKYSDAKELAGLTLGKK-TDYANQYDPSLLQPVPRSLNRDDLQLG----DELPFM
QUEF_VIBCH      ----MSKYSDAKELASLTLGKK-TEYANQYDPSLLQPVPRSLNRNDLHLS----ATLPFQ
QUEF_ALIF1      ----MTKYTNADELKSLTLGQK-TEYKHTYEPELLQAVPRSLNRDDLALG----DELPFV
QUEF_PHOPR      ----MSKYKDAKELAGLTLGQK-TDYIDQYDASLLQPVPRSLNRSDLNLG----ESLPFT
QUEF_SHESM      MTHNHDPYSDAKELAGLTLGKA-TDYQAEYDASLLQGVPRSLNRNAINLTA---ESLPFH
QUEF_SHESR      MTHNHDPYSDAKELAGLTLGKA-TDYQAEYDASLLQGVPRSLNRNAINLTA---ESLPFH
QUEF_SHEON      MTQNHDPYSDAKELAGLTLGKA-TDYQAEYDASLLQGVPRSLNRNAINLTA---ESLPFH
QUEF_SHEDO      MTHNHDPYSDAQALKGLTLGQA-TQYQAEYDPSLLQGVPRKLNRDAIELTT---E-LPFH
QUEF_SHEFN      MTHNHDPYSDAAALKGLTLGQA-TAYQAEYDASLLQGVPRKLNRDAIQLSG---E-LPFH
QUEF_IDILO      -------MPKKDALDHLSLGQH-TDYPNEYDPKQLQPVPRSLNREPIGLK----DKLPFS
QUEF_COLP3      ----MANYQNATELSKLTLGKS-TQYCSEYTADLLQGVPRSLNRDDLALNQ---SNLPFV
QUEF_PSEHT      ----MTDYSNSPDLKGSVLGQS-TEYIDQYTPSLLFPIARKLNRDALNIDE---AALPFK
QUEF_LEGPA      -MNKELESIYQNIANQSELGQT-ANYDSYYNPKRLYPIPRAPKRQEINLDP---NSTTFY
QUEF_LEGPC      -MNKELESIYQNIANQSELGQT-ANYDSYYNPKRLYPIPRAPKRQEINLDP---NSTTFY
QUEF_LEGPL      -MNKELEIIYQNIANQSELGQS-SNYDDHYNPKRLYPIPRAPKRQEINLDP---NSTTFY
QUEF_HYDCU      -MTKP-----TSTADKSLLGQT-TPYCQAYDPTILFPIPRQEKRDELGFDL---KTLPFT
QUEF_RICBR      -----------MTLSNSALGKK-STYKDTYDPTLLFKIPRIDNRKELGIVN---DKLPFH
QUEF_RICB8      -----------MTLSNSALGKK-STYKDTYDPTLLFKIPRIDNRKELGIVN---DKLPFH
QUEF_RICRS      -----------MPLSTSLLGKK-STYKDSYDVTLLFKIPRINNRNELGINS---NNLPFY
QUEF_RICRO      -----------MPLSTSLLGKK-STYKDSYDVTLLFKIPRINNRNELGINS---NNLPFY
QUEF_RICCN      -----------MPLSTSLLGKK-STYKDSYDVTLLFKIPRINNRNELGINS---NNLPFY
QUEF_RICM5      -----------MPLSTSLLGKK-STYKDSYDVTLLFKIPRINNRNELGINS---NNLPFY
QUEF_RICFE      -----------MPLSTSLLGKK-STYKDSYDATLLFKIPRINNRNELGINS---NNLPFY
QUEF_RICAH      -----------MPLSTSLLGKT-STYKDSYDATLLFKIPRINNRNALGINS---NNLPFY
QUEF_RICCK      -----------MPLSASLLGKN-STYKDSYDATLLFKIPRINNRNELGINS---NNLPFY
QUEF_RICPR      -----------MPLSTSLLGKK-NTYKDSYDATLLFKIPRINNRNVLGIDS---NHLPFY
QUEF_RICTY      -----------MPLSTSLLGKK-STYKDSYDATLLFKIPRINNRNVLGIN----NNLPFY
QUEF_CUPNH      ----------MSLPEHSPLGKP-SAYKTEYDASLLFPIPRQPKRTEIGLP--EGKPVPFF
QUEF_CUPPJ      ----------MSLPEHSPLGKP-SAYKTEYDATLLFPIARQPKRTEIGLP--AGKPVPFF
QUEF_CUPMC      ----------MTLPEHSPLGKP-SAYKTEYDASLLFPIPRQPKRAEIGLP--EGRALPFF
QUEF_RALSO      ----------MSHPEHSPLGKA-SAYKTQYDPSLLFPIPRQAKRDEIGLA--AGSALPFF
QUEF_BURM9      -----------MNPEHSPLGKA-TVYANQYDASLLFPIPRAGAREQIGI----GAPLPFF
QUEF_BURMA      -----------MNPEHSPLGKA-TVYANQYDASLLFPIPRAGAREQIGI----GAPLPFF
QUEF_BURM7      -----------MNPEHSPLGKA-TVYANQYDASLLFPIPRAGAREQIGI----GAPLPFF
QUEF_BURP6      -----------MNPEHSPLGKA-TVYANQYDASLLFPIPRAGAREQIGI----GAPLPFF
QUEF_BURMS      -----------MNPEHSPLGKA-TVYANQYDASLLFPIPRAGAREQIGI----GAPLPFF
QUEF_BURP1      -----------MNPEHSPLGKA-TVYANQYDASLLFPIPRAGAREQIGI----GAPLPFF
QUEF_BURPS      -----------MNPEHSPLGKA-TVYANQYDASLLFPIPRAGAREQIGI----GAPLPFF
QUEF_BURP0      -----------MNPEHSPLGKA-TVYANQYDASLLFPIPRAGAREQIGI----GAPLPFF
QUEF_BURTA      -----------MNPEHSPLGKT-TVYANQYDASLLFPIPRAGAREQIGI----GAPLPFF
QUEF_BURCM      -----------MNPEHSPLGKA-TVYAAQYDASLLFPIPRAGAREQLGI----TSALPFF
QUEF_BURVG      -----------MNPEHSPLGKA-TVYAAQYDASLLFPIPRAGAREQLGI----AAALPFF
QUEF_BURCA      -----------MNPEHSPLGKA-TVYAAQYDASLLFPIPRAGAREQLGI----TSALPFF
QUEF_BURCH      -----------MNPEHSPLGKA-TVYAAQYDASLLFPIPRAGAREQLGI----TSALPFF
QUEF_BURL3      -----------MNPEHSPLGKA-TVYAAQYDASLLFPIPRAGAREQLGI----TSALPFF
QUEF_PARXL      -----------MTPEQSPLGKA-STYTEQYDASLLFPIARKNAREAIGI----GAQLPFF
QUEF_POLSJ      ----------MNTPEHSQLGKS-SAYVDQYDASLLFPIPRAEKRAEIGV----TGTPPFF
QUEF_POLNA      ----------MNTPEHSELGKS-SAYVDQYDASLLFPIPRLAKRLEMGV----GATPIFF
QUEF_ACIAC      ----------MNTPDQSQLGRV-SGYADQYDASLLFPLPRQPKRHEIGV----TGTPPFF
QUEF_ACISJ      ----------MNTPEHSQLGKA-SAYADQYDASLLFPIPRADKRAEIGI----DGNAPFF
QUEF_VEREI      ----------MNPPESSPLGKA-SACVDQYDATLLFPIARADQRAELGI----SGAAPFF
QUEF_RHOFT      ----------MNTPQNSPLGQA-TAYLDQYDASLLFPIARATKRAEIGV----TGALPFL
QUEF_BORBR      -----------MSLSNAPLGQH-VAYPSQYDPGLLFPIPRATNRASLQLG----ATLPFT
QUEF_BORPE      -----------MSLSNAPLGQH-VAYPSQYDPGLLFPIPRATNRASLQLG----AALPFT
QUEF_BORPA      -----------MSLSNAPLGQH-VAYPSQYDPGLLFPIPRATNRASLQLG----ATLPFT
QUEF_BORA1      -----------MPLSDAPLGHN-VAYPSEYNAALLFPIARAENRAGLGLD----GALPFD
QUEF_CHRVO      ------MNIHAATPEHSPLGKT-VSYQDQYDPSLLFPIARQTKRDEIGVDE---AALPFA
QUEF_XANAC      ----------MNTPEDSTLGRE-VAYPSGYDPSLLFPIPRAAGRQAIGL----TGDLPFI
QUEF_XANC5      ----------MNTPEDSTLGRE-VAYPSGYDPSLLFPIPRAAGRQAIGL----TGELPFI
QUEF_XANOM      ----------MNTPEDSTLGRE-VAYPSGYDPSLLFPIPRAAGREAIGL----TGALPFT
QUEF_XANOR      ----------MNTPEDSTLGRE-VAYPSGYDPSLLFPIPRAAGREAIGL----TGALPFT
QUEF_XANC8      ----------MNTPEDSSLGRE-VAYPSGYDPSLLFPIPRAAGRAAIGL----RGALPFV
QUEF_XANCP      ----------MNTPEDSSLGRE-VAYPSGYDPSLLFPIPRAAGRAAIGL----RGALPFV
QUEF_XYLFT      ----------MNTSHYSVLGHT-VPYPKVYDPSLLFPISRAVGRTQIGI----GVVLPFV
QUEF_XYLFA      ----------MNTSHYSVLGHA-VPYPKAYDPSLLFPISRAVGRAQIGI----GVVLPFV
QUEF_CHRSD      ------MSERDKTLEHAPLGRE-SAYPEHYDAGLLFPIPRQANRAPLGLD---DAALPFE
QUEF_AZOSB      ---MNDTQNPLHGAEASPLGKP-VAYRDTYAPELLFPIARQLKRDEIGVRA---DALPFC
QUEF_AROAE      ---MNPSDTHDHGAEASPLGQS-VVYRDSYAPELLFPIARQIKRDELGLAP---DTLPFV
QUEF_DECAR      --MTLTTTHIADPSHASPLGKA-TEYQSHYAPELLYPIPRQLKRSELGITD---ANLPFV
QUEF_COXBR      ------MSTLRVLHEKSELGKT-TVYPKEYAPHLLLPIPRDLNRKTLNVNVS--EPPPFY
QUEF_COXBU      ------MSTLRVLHEKSELGKT-TVYPKEYAPHLLLPIPRDLNRKTLNVNVS--EPPPFY
QUEF_COXBN      ------MSTLRVLHEKSELGKT-TVYPKEYAPHLLLPIPRDLNRKTLNVNVS--EPPPFY
QUEF_PSE14      ---------MHPAAEHSPLGKS-SEYIATYTPSLLFPISRAAKWAELGLTA---QTLPYQ
QUEF_PSEU2      ---------MHPAAEHSPLGKS-SEYIATYTPSLLFPIPRAAKWAELGLTA---QTLPYQ
QUEF_PSESM      ---------MHPAAEHSPLGKS-SEYIATYTPSLLFPIPRAAKWAELGLTA---QTLPYK
QUEF_PSEF5      ---------MHPAAEHSPLGKS-SEYVSTYTPSLLFPIPRAAKWAELGLSA---DTLPYK
QUEF_PSEPF      ---------MHPAAEHSPLGKS-SEYIATYTPSLLFPIPRTAKWAELGLTA---ETLPYK
QUEF_PSEMY      ---------MQHPAEHSPLGKS-SQYIAEYSPELLFPISRTSKWAELGLDG---ANLPYQ
QUEF_PSEP1      ---------MHPAAEHSPLGKS-SEYIATYSPEQLFPIPRTAKWAELGVTA---QTLPWQ
QUEF_PSEPK      ---------MHPAAEHSPLGKS-SEYIATYSPEQLFPIPRTAKWAELGVTA---QTLPWQ
QUEF_PSEPG      ---------MHPAAEHSPLGKS-SEYIATYSPEQLFPIPRTAKWAELGVTA---QTLPWQ
QUEF_PSEE4      ---------MHPAAEHSPLGKS-SEYIATYTPSLLFPIPRLAKWAELGVSG---DALPWQ
QUEF_PSEAB      ---------MQHPAEHSPLGKT-SEYVSSYTPSLLFPISRTAKWAELGLSA---ETLPYR
QUEF_PSEAE      ---------MQHPAEHSPLGKT-SEYVSSYTPSLLFPISRTAKWAELGLSA---ETLPYR
QUEF_PSEA7      ---------MHHPAEHSPLGKT-SEYVSRYTPSLLFPIARAAKWAELGLSA---ATLPYR
QUEF_HAHCH      ----------MELEKHTHLGKA-TEYPEEYSPSWLTPIPRAKSRETLGLSG---KP-DFV
QUEF_SACD2      -------------MSSIELGKQ-AEYPEQYSPDCLEPIARSLSRSGLGLNA---SALPFT
QUEF_DESPS      --------MTENINAGIPLGKQ-VGHSETYDPSHLFPVARREARKSLGLAD----DLPFS
QUEF_PSYA2      -----------MSIHGILGEQT-TDYPTEYSPETLYPIARSMGRDVIGWQN----DKLEV
QUEF_PSYCK      -----------MSIHGILGEQT-TDYPTEYSPETLYPIARSMGREVIGWQD----DKLEV
QUEF_ACIAD      -----------MSVEQSLLGKE-TEYPTTYSPSVLFPISRDAAREKYA-QI----EGISQ
                                    :        *    *  :.*                    

QUEF_ECOL6      GTDIWTLYELSWLNAKGLPQVAVGHVELDYTSVNLIESKSFKLYLNSFNQTRFNNWDEVR
QUEF_ECOL5      GTDIWTLYELSWLNAKGLPQVAVGHVELDYTSVNLIESKSFKLYLNSFNQTRFNNWDEVR
QUEF_ECO24      GTDIWTLYELSWLNAKGLPQVAVGHVELDYTSVNLIESKSFKLYLNSFNQTRFNNWDEVR
QUEF_ECOK1      GTDIWTLYELSWLNAKGLPQVAVGHVELDYTSVNLIESKSFKLYLNSFNQTRFNNWDEVR
QUEF_ECOUT      GTDIWTLYELSWLNAKGLPQVAVGHVELDYTSVNLIESKSFKLYLNSFNQTRFNNWDEVR
QUEF_SHIF8      GTDIWTLYELSWLNAKGLPQVAVGHVELDYTSVNLIESKSFKLYLNSFNQTRFNNWDEVR
QUEF_SHIFL      GTDIWTLYELSWLNAKGLPQVAVGHVELDYTSVNLIESKSFKLYLNSFNQTRFNNWDEVR
QUEF_SHIBS      GTDIWTLYELSWLNAKGLPQVAVGHVELDYTSVNLIESKSFKLYLNSFNQTRFNNWDEVR
QUEF_SHISS      GTDIWTLYELSWLNAKGLPQVAVGHVELDYTSVNLIESKSFKLYLNSFNQTRFNNWDEVR
QUEF_ECOHS      GTDIWTLYELSWLNAKGLPQVAVGHVELDYTSVNLIESKSFKLYLNSFNQTRFNNWDEVR
QUEF_ECOLC      GTDIWTLYELSWLNAKGLPQVAVGHVELDYTSVNLIESKSFKLYLNSFNQTRFNNWDEVR
QUEF_ECOLI      GTDIWTLYELSWLNAKGLPQVAVGHVELDYTSVNLIESKSFKLYLNSFNQTRFNNWDEVR
QUEF_ECO57      GTDIWTLYELSWLNAKGLPQVAVGHVELDYTSVNLIESKSFKLYLNSFNQTRFNNWDEVR
QUEF_SHIDS      GADIWTLYELSWLNAKGLPQVAVGHVELDYTSVNLIESKSFKLYLNSFNQTSFNNWDEVL
QUEF_CITK8      GADIWTLYELSWLNAKGVPQVAVGHVELDYTSVNLIESKSFKLYLNSFNQTRFDSWDAVR
QUEF_SALCH      GADIWTLYELSWLNSQGLPQVAVGHVELDYTSVNLIESKSFKLYLNSFNQTRFDTWETVR
QUEF_SALTI      GADIWTLYELSWLNSQGLPQVAVGHVELDYTSVNLIESKSFKLYLNSFNQTRFDTWETVR
QUEF_SALTY      GADIWTLYELSWLNSQGLPQVAVGHVELDYTSVNLIESKSFKLYLNSFNQTRFDTWETVR
QUEF_SALPA      GADIWTLYELSWLNSQGLPQVAVGHVELDYTSVNLIESKSFKLYLNSFNQTRFDTWETVR
QUEF_SALPB      GADIWTLYELSWLNSQGLPQVAVGHVELDYTSVNLIESKSFKLYLNSFNQTRFDTWETVR
QUEF_SALAR      GADIWTLYELSWLNSHGLPQIAIGHVELDYTSVNLIESKSFKLYLNSFNQTRFDTWETVR
QUEF_KLEP7      GADIWTLYELSWLNGKGLPQVAVGHVELPDTSLNLVESKSFKLYLNSFNQTRFASWQDVA
QUEF_CROS8      GADIWTMYELSWLNRNGLPQVAIGQVEINATSVNLVESKSFKLYLNSFNQTQFESLEAVR
QUEF_YERP3      GADIWTLYELSWLNSNGLPQVAVGEISLNADSINLIESKSFKLYLNSFNQTIFADKESVR
QUEF_YERPS      GADIWTLYELSWLNSNGLPQVAVGEISLNADSINLIESKSFKLYLNSFNQTIFADKESVR
QUEF_YERPN      GADIWTLYELSWLNSNGLPQVAVGEISLNADSINLIESKSFKLYLNSFNQTIFADKESVR
QUEF_YERPA      GADIWTLYELSWLNSNGLPQVAVGEISLNADSINLIESKSFKLYLNSFNQTIFADKESVR
QUEF_YERPP      GADIWTLYELSWLNSNGLPQVAVGEISLNADSINLIESKSFKLYLNSFNQTIFADKESVR
QUEF_YERPE      GADIWTLYELSWLNSNGLPQVAVGEISLNADSINLIESKSFKLYLNSFNQTIFADKESVR
QUEF_YERE8      GADIWTLYELSWLNSKGLPQVAIGEISLNADSVNLIESKSFKLYLNSFNQTVFTDWESVR
QUEF_PECAS      GADIWTLYELSWLNNRGVPQVAVGEMHLNAESLNLIESKSFKLYLNSFNQTTFDSWESVR
QUEF_PHOLL      GADIWTLYELSWLNNRGLPQVAVGHVSLNAASTNLIESKSFKLYLNSFNQTRFENWQAVE
QUEF_SODGM      GADIWTLYELSWLNDAGIPQVAIGEIALNATSTNLIESKSFKLYLNSLNQTSFPSREAVR
QUEF_BAUCH      GADFWTLYELSWLNKYGLPQVAIGEMIIDATSDNLIESQSLKLYLNSINQTCFSSEQELR
QUEF_ACTP2      GADVWTCYELSWLNENGLPQVAIADVAIDFRSENLIESKSFKLYLNSFNQTKFASLEQVE
QUEF_HAEDU      GADVWTCYEVSWLNLNGLPQVAIAEVVIDANSENLIESKSFKLYLNSVNQTTFESLEQVE
QUEF_HAEI8      GADIWTAYEISWLNEKGLPQVAIADIYLDYQSQNLIESKSFKLYLNSFNQSKFTDFNAVQ
QUEF_HAEIG      GADIWTAYEISWLNEKGLPQVAIADIYLDYQSQNLIESKSFKLYLNSFNQSKFTDFNAVQ
QUEF_HAEIE      GADIWTAYEISWLNEKGLPQVAIADIYLDYQSQNLIESKSFKLYLNSFNQSKFADFNAVQ
QUEF_HAEIN      GADIWTAYEISWLNEKGLPQVAIADIYLDYQSQNLIESKSFKLYLNSFNQSKFADFNAVQ
QUEF_ACTSZ      GADIWTAYEISWLNPKGLPQIAIADAEIDFRSENLVESKSFKLYLNSFNQTKFASPAEVQ
QUEF_MANSM      GADIWTAYEISWLNIKGLPQVAIADVEIDYRSTNLIESKSFKLYLNSFNQTKFSDMSEVQ
QUEF_HAES1      GADIWTAYEISWLNLKGVPQVAIADVEIDYQSENLIESKSFKLYLNSFNQSQFENLQQVE
QUEF_HISS2      GADIWTAYEISWLNLKGVPQVAIADVEIDYQSENLIESKSFKLYLNSFNQSQFENLQQVE
QUEF_PASMU      GADIWTAYEISWLNLNGLPQVAIADVAIDFQSENLIESKSFKLYLNSFNQSKFATFEEVQ
QUEF_VIBPA      GHDIWTLYELSWLNSKGLPQVAVGEVYIPATSANLIESKSFKLYLNSYNQTRFASWEEVA
QUEF_VIBCB      GHDIWTLYELSWLNSKGLPQVAVGEVYIPATSANLIESKSFKLYLNSYNQTRFATWEEVT
QUEF_VIBVU      GHDIWTLYELSWLNSKGLPQVAVGEVYIPATSANLIESKSFKLYLNSYNQTRFDSWEEVR
QUEF_VIBVY      GHDIWTLYELSWLNNKGLPQVAVGEVYIPATSANLIESKSFKLYLNSYNQTRFDSWEEVR
QUEF_VIBCH      GCDIWTLYELSWLNQKGLPQVAIGEVSIPATSANLIESKSFKLYLNSYNQTRFASWDEVQ
QUEF_ALIF1      GCDVWTLYELSWLNQNGLPQVAVGEVALPATSPNLVESKSFKLYLNSFNQTKFTSWDEVK
QUEF_PHOPR      GYDIWTLYELSWLNSKGLPQVAIGEVRLPASSPNLIESKSFKLYLNSFNQTRFDSWQQIA
QUEF_SHESM      GADIWTAYELSWLNAKGKPMVAIADIQLSHESQNLIESKSFKLYLNSFNQTKFDNIDAVQ
QUEF_SHESR      GADIWTAYELSWLNAKGKPMVAIADIQLSHESQNLIESKSFKLYLNSFNQTKFDNIDAVQ
QUEF_SHEON      GADIWTAYELSWLNAKGKPMVAIADIQLSHASQNLIESKSFKLYLNSFNQTKFDNLDAVQ
QUEF_SHEDO      GTDIWTGYELSWLNGKGKPVVAILQVHLDIHSVNLIESKSFKLYLNSLNQTRFNNLDAVK
QUEF_SHEFN      GTDIWTGYELSWLNAKGKPVVAILEVQLDINSVNLIESKSFKLYLNSFNQTKFDSVEAVQ
QUEF_IDILO      GVDLWTGYEISWLNANGLPQVAVGYFAVPAESPNLIESKSFKLYLNSFNDSRFDTWEYVQ
QUEF_COLP3      GEDVWYGYELSWLNGKGKPVVAVAEFRFACTSDNIVESKSFKLYLNSFNQTRFSSIKDVE
QUEF_PSEHT      GQDIWTGYELSWLNAKGKPQVAIAVFTFACQSSHLVESKSFKLYLNSFNQTRFNSRDEVK
QUEF_LEGPA      GFDCWNHYEVSWLNSKGKPVVAMAVISYDCHSPCIIESKSLKLYFNSLNNSTFPDVETVV
QUEF_LEGPC      GFDCWNHYEVSWLNSKGKPVVAMAVISYDCHSPCIIESKSLKLYFNSLNNSTFPDVETVV
QUEF_LEGPL      GFDCWNHYEVSWLNSKGKPVVAMAVISYDCHSPCIIESKSLKLYFNSLNNTTFPDVETVV
QUEF_HYDCU      GEDVWTGYEISWLNLKGKPQVGWAEFVFSAEAPNLIESKSFKLYLNSFNGTRFESEDAVI
QUEF_RICBR      GVDIWNAYELSWLDKKGKPCVAIFTFFVPTTSSHIVESKSVKLYLNSFNNFVVDSMEELK
QUEF_RICB8      GVDIWNAYELSWLDKKGKPCVAIFTFFVPTTSSHIVESKSVKLYLNSFNNFVVDSMEELK
QUEF_RICRS      GVDVWNTYELSCLNKNGKPWVGVGTFYIPTDSENIVESKSFKLYLNSFNNFVVESVKELE
QUEF_RICRO      GVDVWNTYELSCLNKNGKPWVGVGTFYIPTDSENIVESKSFKLYLNSFNNFVVESVKELE
QUEF_RICCN      GVDVWNTYELSCLNKNGKPWVGVGTFYIPTDSENIVESKSFKLYLNSFNNFVVESVKELE
QUEF_RICM5      GVDVWNTYELSCLNKNGKPWVGVGTFYIPTDSENIVESKSFKLYLNSFNNFVVESVKELE
QUEF_RICFE      GVDIWNTYELSCLNKNGKPWVGVGTFYIPTDSENIVESKSFKLYLNSFNNFVVESVEELE
QUEF_RICAH      GVDIWNTYELSCINKKGKPWVGVGTFYIPTDSENIVESKSFKLYLNSFNNFVVESVEELE
QUEF_RICCK      GVDIWNTYELSCLNKNGKPWVGVGTFYIPTDSENIVESKSFKLYLNSFNNFVVESIEELE
QUEF_RICPR      GVDIWNTYEISCLNKNGKPLVGIGTFYIPADSENIVESKSFKLYLNSFNNFIIESIEELE
QUEF_RICTY      GVDIWNTYEISCLNKNGKPLVGIGTFYIPADSENIVESKSFKLYLNSFNNFIVKSIEELE
QUEF_CUPNH      GVDIWNAYELSWLNLKGKPQVALASFIIPSDTPNIIESKSFKLYLNSFNQTRIASPEALQ
QUEF_CUPPJ      GVDIWNAYEVSWLNMRGKPQVALATFIIPSDTPNIIESKSFKLYLNSFNQTKIASPEALQ
QUEF_CUPMC      GVDIWNAYEVSWLNLKGKPQVALATFIIPADTPNIVESKSFKLYLNSFNQTKIASPEALQ
QUEF_RALSO      GIDLWNLYELSWLNLKGKPQVAIGTVIVPADSPNIVESKSFKLYLNTFNQTKVASSEALQ
QUEF_BURM9      GTDIWNAYELSWLNARGKPQIAIATFYVPAESPNIVESKSFKLYLGSFAQTAFESADAVR
QUEF_BURMA      GTDIWNAYELSWLNARGKPQIAIATFYVPAESPNIVESKSFKLYLGSFAQTAFESADAVR
QUEF_BURM7      GTDIWNAYELSWLNARGKPQIAIATFYVPAESPNIVESKSFKLYLGSFAQTAFESADAVR
QUEF_BURP6      GTDIWNAYELSWLNARGKPQIAIATFYVPAESPNIVESKSFKLYLGSFAQTAFESADAVR
QUEF_BURMS      GTDIWNAYELSWLNARGKPQIAIATFYVPAESPNIVESKSFKLYLGSFAQTAFESADAVR
QUEF_BURP1      GTDIWNAYELSWLNARGKPQIAIATFYVPAESPNIVESKSFKLYLGSFAQTAFESADAVR
QUEF_BURPS      GTDIWNAYELSWLNARGKPQIAIATFYVPAESPNIVESKSFKLYLGSFAQTAFESADAVR
QUEF_BURP0      GTDIWNAYELSWLNARGKPQIAIATFYVPAESPNIVESKSFKLYLGSFAQTAFESADAVR
QUEF_BURTA      GTDIWNAYELSWLNARGKPQVAIATFYVPAESPNIVESKSFKLYLGSFAQTAFESIDAVR
QUEF_BURCM      GTDIWNAYELSWLNARGKPQVAVATFYVPAESPNIVESKSFKLYLGSFAQSKFDSLDAVR
QUEF_BURVG      GTDIWNAYELSWLNARGKPQLAVATFYVPAESPNIVESKSFKLYLGSFAQSKFDSVDAVR
QUEF_BURCA      GTDIWNAYELSWLNARGKPQVAIATFYVPAESPNIVESKSFKLYLGSFAQSKFDSVDAVR
QUEF_BURCH      GTDIWNAYELSWLNARGKPQVAIATFYVPAESPNIVESKSFKLYLGSFAQSKFDSVDAVR
QUEF_BURL3      GTDIWNAYELSWLNARGKPQIAVATFYVPAESPNIVESKSFKLYLGSFAQTTFDSIDAVR
QUEF_PARXL      GTDIWNAYELSWLNARGKPQIAVATFFVPADSPNIVESKSFKLYLGSFAQTAFESMDAVR
QUEF_POLSJ      GADMWTAFELSWLNMRGKPQVALAHITVPCESPNIVESKSFKLYLNSFNNTRFSDARDVR
QUEF_POLNA      GADLWTAFELSWLNLRGKPQVALAQFIVPCETPNIIESKSFKLYLNSFNNTRFPDAAEVQ
QUEF_ACIAC      GADLWTAFELSWLNLRGKPQVALAHITVPCETPNIIESKSFKLYLNSFNNTRFADAAQVQ
QUEF_ACISJ      GADLWTAFELSWLNLRGKPQVAIAHITVPCETPHIVESKSFKLYLNSFNNTRFASEAEVR
QUEF_VEREI      GADLWTAFELSWLNQRGKPQVALAHITVPCETPRIVESKSFKLYLNSFSNTRFADAAQVQ
QUEF_RHOFT      GADMWTAFELSWLNLRGKPQVALARFTVPCESPNIIESKSFKLYLNSFNNTRFADVDAVK
QUEF_BORBR      GVDLWNAYELSWLDARGKPRVAMATFSFPADSPNIVESKSFKLYLNSFNQTRLPNAQALR
QUEF_BORPE      GVDLWNAYELSWLDARGKPRVAMATFSFPADSPNIVESKSFKLYLNSFNQTRLPNAQALR
QUEF_BORPA      GVDLWNAYELSWLDARGKPRVAMATFSFPADSPNIVESKSFKLYLNSFNQTRLPNAQALR
QUEF_BORA1      GTDIWNAYELSWLDAKGKPRIAMASFRIPASSPNIIESKSFKLYLNSFNQTRLPNAQTLR
QUEF_CHRVO      GVDIWTGFELSWLNARGKPQIGIATFRIPAGSPRLIESKSFKLYLNSYNQTRMDGIDALA
QUEF_XANAC      GRDRWHAYELSWLDAQGKPCVATATLHVPCDSPSLIESKSLKLYLNSLNATRFNSAEAVR
QUEF_XANC5      GRDRWHAYELSWLDAQGKPCVATATLHVPCDSPSLIESKSLKLYLNSLNATRFNSAEAVR
QUEF_XANOM      GRDRWHAYELSWLDAHGKPCVATATLHVPHDSPALIESKSLKLYLNSLNATRFNSAEAVR
QUEF_XANOR      GRDRWHAYELSWLDAHGKPCVATATLHVPHDSPALIESKSLKLYLNSLNATRFNSAEAVR
QUEF_XANC8      GRDRWHAYELSWLDAHGKPCVATATLHVPCESPALIESKSLKLYLNSLNATRFNSAEAVR
QUEF_XANCP      GRDRWHAYELSWLDAHGKPCVATATLHVPCESPALIESKSLKLYLNSLNATRFNSAEAVR
QUEF_XYLFT      GEDRWHAYELSWLDARGKPCVATATFHVPCDSPYLIESKSLKLYLNSFSAEVFNRAEALR
QUEF_XYLFA      GEDRWHAYELSWLDARGKPCVATATFHVPCDSPYLIESKSLKLYLNSFSAEVFNRAEALR
QUEF_CHRSD      GEDEWHAFELSWLDAKGKPIVAVARFRLPADSPSLIESKSWKLYLNSFNQTRFDRREAVI
QUEF_AZOSB      GEDLWNAYELSWLNPRGKPVVALAEFRVPADTPRLVESKSLKLYLNSFNQSRFDDAAAVR
QUEF_AROAE      GEDLWNAYELSWLNSRGKPVAAIGTFRVPVTSPRLIESKSLKLYLNSFNQHRFVDPTLVH
QUEF_DECAR      GEDLWNAYELSWLNSKGKPVVAVGTFRVPANSPNLIESKSFKLYLNSFNQSSFDNIAAVS
QUEF_COXBR      GYDLWNAYELSWLNEKGKPFAARGEFIIPATSSHLIESKSFKLYLNSFNNERFADAAAVS
QUEF_COXBU      GYDLWNAYELSWLNEKGKPFAARGEFIIPATSSHLIESKSFKLYLNSFNNERFADAAAVS
QUEF_COXBN      GYDLWNAYELSWLNEKGKPFAARGEFIIPATSSHLIESKSFKLYLNSFNNERFADAAAVS
QUEF_PSE14      GVDFWNCYELSWLLPSGKPVVAIAEFSIPADSPNIIESKSFKLYLNSLNQTAFATVEQVQ
QUEF_PSEU2      GVDFWNCYELSWLLPSGKPVVAIGEFSIPAESPNIIESKSFKLYLNSLNQTAFATVEQLQ
QUEF_PSESM      GVDFWNCYELSWLLPSGKPVVAIAEFSIPADSPNIIESKSFKLYLNSLNQTAFDGAARVQ
QUEF_PSEF5      GVDYWNCFELSWLLPSGKPVVAIGEFSIPADSPNIIESKSFKLYLNSLNQTPFDDRATLE
QUEF_PSEPF      GVDFWNCFELSWLLPSGKPVVAIGEFSIPADSPNIIESKSFKLYLNSLNQTPFADTASLE
QUEF_PSEMY      GVDYWNCYELSWLLPSGKPVVAIGEFAIPADSPNIIESKSFKLYLNSLNQTVFASWGELQ
QUEF_PSEP1      GVDYWNCFELSWLLPSGKPVVAIGEFAIPADSPNIIESKSFKLYLNSLNQTVFASLDALQ
QUEF_PSEPK      GVDYWNCFELSWLLPSGKPVVAIGEFAIPADSPNIIESKSFKLYLNSLNQTVFTSLGALQ
QUEF_PSEPG      GVDYWNCFELSWLLPSGKPVVAIGEFAIPADSPNIIESKSFKLYLNSLNQTVFASLGELQ
QUEF_PSEE4      GVDYWNCFELSWLLPSGKPVVAIGEFAIPCDSPNIIESKSFKLYLNSLNQTKFESVAQLQ
QUEF_PSEAB      GVDIWNCYELSWLTPAGKPVVAIGEFSIPADSPNIIESKSFKLYLNSLNQSAFDSREALR
QUEF_PSEAE      GVDIWNCYELSWLTPAGKPVVAIGEFSIPADSPNIIESKSFKLYLNSLNQSAFDSREALR
QUEF_PSEA7      GVDIWNCYELSWLTPAGKPVVAIGEFSIPADSPNIIESKSFKLYLNSLNQSSFDSRDALR
QUEF_HAHCH      GEDLWNGYELSWLNSKGKPEVALGVFRIRCDSLNIIESKSFKLYLNSFNQSRFTSREEVE
QUEF_SACD2      GLDVWTGYELSWLDLSGKPQVAIGYFEFDAKTDAIVESKSFKYYLNSFNQTRFESWAAVQ
QUEF_DESPS      GPDIWNAYELSWLDSKGKPCVALGEITFPCTSENIIESKSLKLYLNSFNLTRFTSTARVK
QUEF_PSYA2      GVDWWQAFELSWLNQQGISQVAIARFGIPANSPFIVESKSLKLYLNSINFTEFGSWAEVQ
QUEF_PSYCK      GFDWWQAFELSWLNEQGISQVAIARFGIPASSPFIVESKSLKLYLNSINFTEFGSLETVQ
QUEF_ACIAD      GKDWWHVFELSWLNSDNIPQVAIGRITLPATSPYLIESKSLKLYFNSLNFHVFASKQELI
                * * *  :*:* :   . .  .         :  ::**:* * *:.:     .     : 

QUEF_ECOL6      QTLERDLSTCAQGKV-------------SVALYRLDE-LEGQPIGHFNG--TCIDDQDIT
QUEF_ECOL5      QTLERDLSTCAQGKV-------------SVALYRLDE-LEGQPIGHFNG--TCIDDQDIT
QUEF_ECO24      QTLERDLSTCAQGKV-------------SVALYRLDE-LEGQPIGHFNG--TCIDDQDIT
QUEF_ECOK1      QTLERDLSTCAQGKV-------------SVALYRLDE-LEGQPIGHFNG--TCIDDQDIT
QUEF_ECOUT      QTLERDLSTCAQGKV-------------SVALYRLDE-LEGQPIGHFNG--TCIDDQDIT
QUEF_SHIF8      QTLERDLSTCAQGKI-------------SVALYRLDE-LEGQPIGHFNG--TCIDDQDIT
QUEF_SHIFL      QTLERDLSTCAQGKI-------------SVALYRLDE-LEGQPIGHFNG--TCIDDQDIT
QUEF_SHIBS      QTLERDLSTCAQGKI-------------SVALYRLDE-LEGQPIGHFNG--TCIDDQDIT
QUEF_SHISS      QTLERDLSTCAQGKI-------------SVALYRLDE-LEGQPIGHFNG--TCIDDQDIT
QUEF_ECOHS      QTLERDLSTCAQGKI-------------SVALYRLDE-LEGQPIGHFNG--TCIDDQDIT
QUEF_ECOLC      QTLERDLSTCAQGKI-------------SVALYRLDE-LEGQPIGHFNG--TCIDDQDIT
QUEF_ECOLI      QTLERDLSTCAQGKI-------------SVALYRLDE-LEGQPIGHFNG--TCIDDQDIT
QUEF_ECO57      QTLERDLSTCAQGEV-------------SVALYRLDE-LEGQPIGHFNG--TCIDDQDIT
QUEF_SHIDS      KTLERDLSTCAQGKV-------------SVALYRLDE-LEGQPIGHFNG--TCIDDQDIT
QUEF_CITK8      QTLENDLRACAQGEV-------------SVALYRLDE-LEGQPAAHFHG--TCIDDQDIT
QUEF_SALCH      QTLERDLRACAQGNV-------------SVRLHRLDE-LEGQPVAHFHG--TCIDDQDIS
QUEF_SALTI      QTLERDLRACAQGNV-------------SVRLHRLDE-LEGQPVAHFHG--TCIDDQDIS
QUEF_SALTY      QTLERDLRACAQGNV-------------SVRLHRLDE-LEGQPVAHFHG--TCIDDQDIS
QUEF_SALPA      QTLERDLRACAQGNV-------------SVRLHRLDE-LEGQPVAHFHG--ACIDDQDIS
QUEF_SALPB      QTLERDLRACAQGSV-------------SVRLHRLDE-LEGQPVAHFHG--TCIDDQDIS
QUEF_SALAR      QTLERDLRACAQGNV-------------SVKLHRLDE-LEGLPVAHFHG--ACIDDQDIS
QUEF_KLEP7      ETLTRDLSACAQGKV-------------KVSLYRLDE-LEGQPIARLHG--TCIDDQDIE
QUEF_CROS8      ETLERDLRACAQGDV-------------SVTLRRLED-VEGEPVARFSG--DCIDNQDIN
QUEF_YERP3      MTLQRDLAACAQGNV-------------SVALYDLDE-ITGQPISNFNG--ECLDKQDIR
QUEF_YERPS      MTLQRDLAACAQGNV-------------SVALYDLDE-ITGQPISNFNG--ECLDKQDIR
QUEF_YERPN      MTLQRDLAACAQGNV-------------SVALYDLDE-ITGQPISNFNG--ECLDKQDIR
QUEF_YERPA      MTLQRDLAACAQGNV-------------SVALYDLDE-ITGQPISNFNG--ECLDKQDIR
QUEF_YERPP      MTLQRDLAACAQGNV-------------SVALYDLDE-ITGQPISNFNG--ECLDKQDIR
QUEF_YERPE      MTLQRDLAACAQGNV-------------SVALYDLDE-ITGQPISNFNG--ECLDKQDIR
QUEF_YERE8      TTLQQDLSACAQGEV-------------SITLYRLDE-MTHQPIANFSG--ECLDEQDLY
QUEF_PECAS      ATLANDLAHCAQGDV-------------SVTLFKLSE-LEGQPLAGFTG--ECIDDQDIQ
QUEF_PHOLL      ETLQRDLAACAEGEV-------------EVALHHLDH-FNNQPISTFTG--ECIDDQDIE
QUEF_SODGM      VRLAEDLSRCADGEV-------------QVVLRALSD-FTSSPLLDFDG--ECIDDQPIH
QUEF_BAUCH      NTLITDITKCINSQV-------------KITIHSLSQ-WMTVPILEFTG--ECIDNQSIQ
QUEF_ACTP2      QTLAKDLSQCASGQV-------------SVKVYKLSA-YTQQPIVDFAG--ECIDEQDIQ
QUEF_HAEDU      YIIESDLSRCACGLV-------------WVKIHKLSE-YKNEIIADFSG--ECIDEQDIE
QUEF_HAEI8      QTMQRDLIECAQGDV-------------KVRLNPVAV-YDAQKIEHLQG--DCIDEQDIE
QUEF_HAEIG      QTMQRDLIECAQGDV-------------KVRLNPVAV-YDAQKIEHLQG--DCIDEQDIE
QUEF_HAEIE      QTMQRDLIECAQGDV-------------KVRLNPVAV-YDAQKIEHLQG--DCIDEQDIE
QUEF_HAEIN      QTMQRDLSECAQGDV-------------KVRLNPMAV-YDSQKIDHLQG--DCIDEQDIE
QUEF_ACTSZ      DTIRRDLQDCVQGEV-------------KVRLNSVAF-YTHQPIHELSG--EIIDNQDIE
QUEF_MANSM      RTISEDLSICAEGNV-------------RVQLHSLSN-YSHERIADFAG--ECLDELDIE
QUEF_HAES1      QILQQDLIKCAKGQV-------------KVRLNSLQN-YAQQPIATLQG--ECIDEQDIE
QUEF_HISS2      QILQQDLIKCAKGQV-------------KVRLNSLQN-YAQQPIATLQG--ECIDEQDIE
QUEF_PASMU      QHLTQDLSNCAKGKV-------------SVKLHPLSK-YCHEPIVELAG--ECIDQQDIE
QUEF_VIBPA      ERLTQDLSACAGEKV-------------LVEVNPVGH-YTNQPIVTMEG--ECIDDQDIE
QUEF_VIBCB      ERLTQDLSACAGEAV-------------LVEVNPVNH-YTNQPIVTMEG--ECIDDQDIE
QUEF_VIBVU      QRLITDLSHCAGEAV-------------EVAVNSVTH-YTQQPIVTMEG--ECIDEQDID
QUEF_VIBVY      QRLITDLSHCAGEAV-------------EVAVNSVTH-YTQQPIVTMEG--ECIDEQDID
QUEF_VIBCH      TRLVHDLSACAGETV-------------TVNVKSLNE-YTAEPIVTMQG--ECIDDQDIE
QUEF_ALIF1      ETLVKDLSACAGETV-------------KVDIFPVQR-YSQQPIVDMQG--ECIDDQDII
QUEF_PHOPR      DTLQKDLTACAGQEV-------------DVTIQPLED-FTDQTVINFAG--NCIDEQDIE
QUEF_SHESM      KTLVQDLSECAQGQV-------------TVKIIEPKS-FGIQRVVELPG--TCIDDLDIE
QUEF_SHESR      KTLVQDLGECAQGQV-------------TVKIIEPKS-FGIQRVVELPG--TCIDDLDIE
QUEF_SHEON      KTLVKDLSECAQGDV-------------TVKIIEPKS-FGIQRVVELPG--TCIDDLDIE
QUEF_SHEDO      DTLTTDLSQCAQGEV-------------TVKIIEPKH-FTIERISELPG--NCIDDLDIE
QUEF_SHEFN      ETLSRDLAACAEGEV-------------TVKVIEPKH-FNLERIIDLPG--TCIDDLDIE
QUEF_IDILO      QLMETDLSACAGTPV-------------KVKLKQLSE-LEGESVATFPG--HCIDDQNIS
QUEF_COLP3      KVLTKDLSKIAGSEA-------------SVNLFGVDH-CPALDIAKKSDKCICIDGEDIS
QUEF_PSEHT      QHLVKDLTAVVNSLV-------------QVTLYNADE-YNCLPYTPLPG--ECIDDLDIE
QUEF_LEGPA      QTISKDLSHCIGSEV-------------AVNVYPLSEIASQTIYAAFDG--ICLDKLDIE
QUEF_LEGPC      QTISKDLSYCIGSEV-------------AVNVYPLSDIPNQTIYAAFDG--VCLDKLDIE
QUEF_LEGPL      QTISKDLSHCIGSEV-------------AVNVYPLSEIASQTIYAAFDG--ICLDKLDIE
QUEF_HYDCU      ACWQNDLSQACGKPV-------------GVRFYRLDE--SIVLQGNLPG--HCLDALDIE
QUEF_RICBR      RTILQDLSNNTHAEV-------------TGEIFPINT---KIEFGSPTG--INIDDIDIE
QUEF_RICB8      RTILQDLSNNTHAEV-------------TGEIFPINT---KIEFGSPTG--INIDDIDIE
QUEF_RICRS      RIILQDLSNVTHAKV-------------TGRIFPINT---KVEFGVPSG--KNIDDLDIV
QUEF_RICRO      RIILQDLSNVTHAKV-------------TGRIFPINT---KVEFGVPSG--KNIDDLDIV
QUEF_RICCN      RIILQDLSNVTHAKV-------------TGRIFPINT---KVEFGVPSG--KNIDDLDIV
QUEF_RICM5      RIILQDLSNVTHAKV-------------TGRIFPINT---KVEFGVPSG--KNIDDLDIV
QUEF_RICFE      RIILQDLSNVTHAKV-------------TGRIFPINT---KIEFSIPSG--KNIDDLDIV
QUEF_RICAH      RIILQDLSNVTHAKV-------------TGRIFPINT---KIAFGVPSG--KNIDALDIV
QUEF_RICCK      RIILQDLSNVTHAKV-------------TGQIFPINT---KIEFGLPSG--KNIDDLNIE
QUEF_RICPR      RIILQDLSNVTYAKV-------------TGRIFPINT---KIEFGIPSG--KNIDNLDIV
QUEF_RICTY      QIILQDLSNVTCAKV-------------TGRIFPINT---KIEFGIPSG--KNIDNLDIV
QUEF_CUPNH      QLLHHDLSEATGGTV--------------QVRLVTEADLGKQKMGELDG--LLLDRLDIE
QUEF_CUPPJ      QLLHHDLSEATGGTV--------------QVRLVTEADLGKQKMGELEG--LLLDRLDIE
QUEF_CUPMC      QLLHHDLSEATGGTV--------------QVRLVTEADLGTQKMGELDG--LLLDRLDIE
QUEF_RALSO      QLIHHDLSEACGAPV--------------QVRIVPQEEFARQKMGELAG--LSLDRLDVE
QUEF_BURM9      DALKRDVSAACGASV--------------TVRLATPAEFRKLQMDELDG--LSLDRLDLD
QUEF_BURMA      DALKRDVSAACGASV--------------TVRLATPAEFRKLQMDELDG--LSLDRLDLD
QUEF_BURM7      DALKRDVSAACGASV--------------TVRLATPAEFRKLQMDELDG--LSLDRLDLD
QUEF_BURP6      DALKRDVSAACGASV--------------TVRLATPAEFRKLQMDELDG--LSLDRLDLD
QUEF_BURMS      DALKRDVSAACGASV--------------TVRLATPAEFRKLQMDELDG--LSLDRLDLD
QUEF_BURP1      DALKRDVSAACDASV--------------TVRLATPAEFRKLQMDELDG--LSLDRLDLD
QUEF_BURPS      DALKRDVSAACDASV--------------TVRLATPAEFRKLQMDELDG--LSLDRLDLD
QUEF_BURP0      DALKRDVSAACGASV--------------TVRLATPAEFRKLQMDELDG--LSLDRLDLD
QUEF_BURTA      DALKRDVSAACGASV--------------TVRLATPAEFRKLQMDELDG--LSLDRLDLD
QUEF_BURCM      DTLKRDVSAACGASV--------------SVQLVSPHDFGKLQMEELDG--LSLDRLDLD
QUEF_BURVG      DVLKRDVSAACGASV--------------SVQLVSPHDFGKLQMEELDG--LSLDRLDLD
QUEF_BURCA      DVLKRDVSAACGASV--------------SVQLVSPHDFAKLEMDELDG--LSLDRLDLD
QUEF_BURCH      DVLKRDVSAACGASV--------------SVQLVSPHDFAKLEMDELDG--LSLDRLDLD
QUEF_BURL3      DTLKRDVSAACGATV--------------SVQLVSPHDFGKLEMEELDG--LSLDRLDLD
QUEF_PARXL      DTIRRDVSASCGATV--------------SVHLTAPYKFGKLQMEEFEG--LSLDRLDLD
QUEF_POLSJ      ERIRADINAAVGAG--------------VGVKTLGPELFDREPVHELDG--LSLDRLDVE
QUEF_POLNA      ARLRADISEAAWRGA--------PQASTVGVKLLLPEMFDREDVAELDG--LSLDRLDVE
QUEF_ACIAC      TRIRTDISEAAWRGS--------DRQATVGVKLVLPEMFDREPVQELDG--LLLDRLDVE
QUEF_ACISJ      ARIRADVSEAVWRGA--------EHPGTVGVTLLLPEAFDREPIHELDG--LLLDRLDVE
QUEF_VEREI      ARIRADVSAAVWRGA--------ASAGSVGVTLLGPDRFAQELMQELDG--LSLDRLDVQ
QUEF_RHOFT      ARLRADLSEAVWRDAGKNVSPDAAAPPSIGVTLLLPELFDREPIYELDG--LSLDRLDVE
QUEF_BORBR      DRLERDLAAAAGAPV--------------GLEFISPQRFGELNMAELDG--IYIDKLDIE
QUEF_BORPE      DRLERDLAAAAGAPV--------------GLEFISPQRFGELNMAELDG--IYIDKLDIE
QUEF_BORPA      DRLERDLAAAAGAPV--------------GLKFISPQRFGELNMAELDG--IYIDKLDIE
QUEF_BORA1      DLLEKDLSAAAGAPV--------------DMDFILPQRFDTLRIQELSG--INLDKLDVE
QUEF_CHRVO      AQLARDLSAAAGAEV--------------AVSIALPQAFAAERIAELAG--ECIDELDIA
QUEF_XANAC      TRIATDLSTRAGADV--------------AVEFGLPPIDAVG-----EG--ESIDALDLS
QUEF_XANC5      TRIATDLSTRAGADV--------------AVEFGLPPIDAVG-----EG--ESIDALDVS
QUEF_XANOM      TRIVTDLSTRAGADV--------------SVEFGLPPIDGVG-----DG--ESIDALDVS
QUEF_XANOR      TRIVTDLSTRAGADV--------------SVEFGLPPIDGVG-----DG--ESIDALDVS
QUEF_XANC8      ARIATDLSTRAGADV--------------SVEFGLPPIDAVG-----EG--ESIDALDIA
QUEF_XANCP      ARIATDLSTRAGADV--------------SVEFGLPPIDAVG-----EG--ESIDALDIA
QUEF_XYLFT      LRIAADLSACAGAAV--------------AVEFGLPPVGSGD-----KE--ISLDRLNVD
QUEF_XYLFA      LRIAADLSACAGAAV--------------AVEFGLPPVGGGD-----KE--ISLDRLNVD
QUEF_CHRSD      DTLERDLAQAAGASV--------------AVALFGVED-DALMPRALPG--ECLDDLDVS
QUEF_AZOSB      MAIARDLSAAAGGAV--------------GVAVWPLGGQAERRFAAPEG--VCIDDLDVA
QUEF_AROAE      DTLTRDLSTAAGAPV--------------AVSIEVLSRRPTRVFGYPHG--VLLDEIDIE
QUEF_DECAR      ATMSRDLSAAAGSPI--------------IVTLEPLSASPLASIGTPDG--ILLDELDIT
QUEF_COXBR      QTMKRDLSKRVNESV--------------TVNF-ILHETEIPVAYSPKG--SLLDVLDIA
QUEF_COXBU      QTMKRDLSKRVNESV--------------TVNF-ILHETEIPVAYSPKG--SLLDVLDIA
QUEF_COXBN      QTMKRDLSKRVNESV--------------TVNF-ILHETEIPVAYSPKG--SLLDVLDIA
QUEF_PSE14      TTLEQDLSTAAGKPV--------------GVRIRSLSDIEGEGVATLPG--VCIDDLDIT
QUEF_PSEU2      TTLEQDLSAAAGKPV--------------GVRIRSLAEIEEEGVAALPG--VCIDDLDIS
QUEF_PSESM      ATLEKDLSAAAGKLV--------------GVRIRNLAEIEEEGVAVLPG--VCIDELDIT
QUEF_PSEF5      ATLRTDLSAAAGKPV--------------GVRIRSLQEVEAEGVVALPG--VCIDDLDIS
QUEF_PSEPF      ATLVKDLSAAAGKPV--------------GVRVRSLKDVEAEGVVALPG--VCIDDLDIS
QUEF_PSEMY      ATLARDLSAVAGKPV--------------AVRLRSLTEVAGEGVATLPG--QCIDELEIS
QUEF_PSEP1      ACLEKDLSAAAGKPV--------------GVKVRTLAEVEAQGVVALPG--QCIDALDVA
QUEF_PSEPK      VCLEKDLSAAAGKPV--------------GVKVRTLAEVEAQGVVALPG--QCIDALDVA
QUEF_PSEPG      ACLEKDLSAAAGKPV--------------GVKVRTLAEVEAQGVVALPG--QCIDGLDVA
QUEF_PSEE4      ACLAKDLSAAAGKVV--------------AVKVSTLADVEAQGVTTLPG--QCIDALDVT
QUEF_PSEAB      AVLQKDLSAAAGAPV--------------GVRLRSLDEVAEEGIGRLPG--RCIDELDIA
QUEF_PSEAE      AVLQKDLSAAVGAPV--------------GVRLRSLDEVAEEGIGRLPG--RCIDELDIA
QUEF_PSEA7      AVLEQDLSVAAGAAV--------------GVRLRSLDEVAEEGVGRLPG--RCIDELEIA
QUEF_HAHCH      ALMRKDLSAAAQGEV--------------SVTLLSVTDWRDEPSFWRDA--ENLDVLDID
QUEF_SACD2      TLMQQDLANASGGDV----------------NVRLEPLSAVSPLETPAG--QCIDDCPLE
QUEF_DESPS      EIIREDLSRVAGAEV--------------EVKILTPEEFTEVTISAPEG--SCIDDLELE
QUEF_PSYA2      KLIAEDLSKCVQAEV-------------QVELFHLADRHSGLLIAQPDG--ICIDDALVN
QUEF_PSYCK      TLIAKDLSKCVQAEV-------------NVELFDLEDEHSGLLIAQPDG--ICIDDALAD
QUEF_ACIAD      DLVEKDLSQAANAKV-------------SLELFDVDS----LEISKPSG--MCIDDLKPE
                     *:                                              :*     

QUEF_ECOL6      IDN-----YEFTTDYLENAT---SGEKVVEETLVSHLLKSNCLITHQPDWGSIQIQYRGR
QUEF_ECOL5      IDN-----YEFTTDYLENAT---SGEKVVEETLVSHLLKSNCLITHQPDWGSIQIQYRGR
QUEF_ECO24      IDN-----YEFTTDYLENAT---SGEKVVEETLVSHLLKSNCLITHQPDWGSIQIQYRGR
QUEF_ECOK1      IDN-----YEFTTDYLENAT---SGEKVVEETLVSHLLKSNCLITHQPDWGSIQIQYRGR
QUEF_ECOUT      IDN-----YEFTTDYLENAT---SGEKVVEETLVSHLLKSNCLITHQPDWGSIQIQYRGR
QUEF_SHIF8      IDN-----YEFTTDYLENAT---SGEKVVEETLVSHLLKSNCLITHQPDWGSIQIQYRGR
QUEF_SHIFL      IDN-----YEFTTDYLENAT---SGEKVVEETLVSHLLKSNCLITHQPDWGSIQIQYRGR
QUEF_SHIBS      IDN-----YEFTTDYLENAT---CGEKVVEETLVSHLLKSNCLITHQPDWGSIQIQYRGR
QUEF_SHISS      IDN-----YEFTTDYLENAT---CGEKVVEETLVSHLLKSNCLITHQPDWGSIQIQYRGR
QUEF_ECOHS      IDN-----YEFTTDYLENAT---CGEKVVEETLVSHLLKSNCLITHQPDWGSIQIQYRGR
QUEF_ECOLC      IDN-----YEFTTDYLENAT---CGEKVVEETLVSHLLKSNCLITHQPDWGSIQIQYRGR
QUEF_ECOLI      IDN-----YEFTTDYLENAT---CGEKVVEETLVSHLLKSNCLITHQPDWGSLQIQYRGR
QUEF_ECO57      IDN-----YEFTTDYLENAT---SGEKVVEETLVSHLLKSNCLITHQPDWGSIQIQYRGR
QUEF_SHIDS      IDN-----YEFTTDYLENAT---CGEKVVEETLVSHLLKSNCLITHQPDWGSIQIQYRGR
QUEF_CITK8      IDN-----YQFSTDYLENAA---SGEKVVEETLVSHLLKSNCLITHQPDWGSIQICYRGR
QUEF_SALCH      IDN-----YQFTTDYLQHAV---SGEKQVEETLVSHLLKSNCLITHQPDWGSIQIQYRGR
QUEF_SALTI      IDN-----YQFTTDYLQHAV---SGEKQVEETLVSHLLKSNCLITHQPDWGSIQIQYRGR
QUEF_SALTY      IDN-----YQFTTDYLQHAV---SGEKQVEETLVSHLLKSNCLITHQPDWGSIQIQYRGR
QUEF_SALPA      IDN-----YQFTTDYLQHAV---SGEKQVEETLVSHLLKSNCLITHQPDWGSIQIQYRGR
QUEF_SALPB      IDN-----YQFTTDYLQHAV---SGEKQVEETLVSHLLKSNCLITHQPDWGSIQIQYRGR
QUEF_SALAR      IDN-----YQFTASYLQHAV---SGEKRVEETLVSHLLKSNCLITHQPDWGSIQIQYRGR
QUEF_KLEP7      IDN-----YQFSADYLQGAA---SG-KIVEETLVSHLLKSNCLITHQPDWGSVQIQYRGA
QUEF_CROS8      ITD-----YEFDAALL-SGA---AGEETVEETLVSHLLKSNCLITHQPDWGSVQIHYRGP
QUEF_YERP3      IDS-----YEFNADYL-QGA---AGKDHVEESLVSHLLKSNCLITHQPDWGSVQIHYRGP
QUEF_YERPS      IDS-----YEFNADYL-QGA---AGKDHVEESLVSHLLKSNCLITHQPDWGSVQIHYRGP
QUEF_YERPN      IDS-----YEFNADYL-QGA---AGKDHVEESLVSHLLKSNCLITHQPDWGSVQIHYRGP
QUEF_YERPA      IDS-----YEFNADYL-QGA---AGKDHVEESLVSHLLKSNCLITHQPDWGSVQIHYRGP
QUEF_YERPP      IDS-----YEFNADYL-QGA---AGKDHVEESLVSHLLKSNCLITHQPDWGSVQIHYRGP
QUEF_YERPE      IDS-----YEFNADYL-QGA---AGKDHVEESLVSHLLKSNCLITHQPDWGSVQIHYRGP
QUEF_YERE8      IDS-----YEFNADYL-QGA---AGKNRVTESLVSHLLKSNCLITHQPDWGSVQISYSGP
QUEF_PECAS      IDN-----YNFNADYLATNE---QDAPVVEETLVSHLLKSNCLITHQPDWGSVQIHYRGK
QUEF_PHOLL      VTE-----YDFNRHYLQNAA---QG-PQVEEVLVSHLLKSNCLITHQPDWGSVQIHYKGS
QUEF_SODGM      IDD-----YTFTNRYL-EGA---AGGSVVSETLVSHLLKSNCLITHQPDWGSVQIRYRGA
QUEF_BAUCH      IDND---NYIFNSNLLVNSV---ER-EKVKETLVSHLLKSNCPITNQPDWGSVQISYYGM
QUEF_ACTP2      IDS-----YEFSNEHLASVA----EGEVVEETLVSHLLKSNCLITSQPDWGSVQIHYVGK
QUEF_HAEDU      IDN-----YQYSAQYLEHSA----EGEEVEETLVSHLLKSNCLITSQPDWGSVQIHYVGK
QUEF_HAEI8      ITS-----YEFNANWLKDCV----SDEIVEEKLVSHLLKSNCLITNQPDWGTLHIHYVGK
QUEF_HAEIG      ITS-----YEFNANWLKDCV----SDEIVEEKLVSHLLKSNCLITNQPDWGTLHIHYVGK
QUEF_HAEIE      ITS-----YEFNADWLKDCV----SDEIVEEKLVSHLLKSNCLITNQPDWGTLHIHYVGK
QUEF_HAEIN      ITS-----YEFNANWLKDCV----SDEIVEEKLVSHLLKSNCLITNQPDWGTLHIHYVGK
QUEF_ACTSZ      ISD-----YGFNAELLTNCT----CDVQVEETLVSHLLKSNCLITGQPDWGTLQIRYAGN
QUEF_MANSM      ISD-----YGFNAEILQNCTA--LSTEIVEETLVSHLLKSNCLITSQPDWGSVQIHYQGK
QUEF_HAES1      IRC-----YEFDPNLLENCT----NKQWVEEKLVSHLLKSNCLITNQPDWGTVQIHYIGN
QUEF_HISS2      ILC-----YEFDPNLLENCT----NKQWVEEKLVSHLLKSNCLITNQPDWGTVQIHYIGN
QUEF_PASMU      IND-----YQFNPEILTNCT----HDQMVKESLVSHLLKSNCLITNQPDWGTLQIRYEGK
QUEF_VIBPA      INS-----YDFDADLLAGAA----GEDQVEEVLHSHLLKSNCLITNQPDWGSVEIRYQGA
QUEF_VIBCB      ITS-----YDFNAALLEGAA----GDEQVEEILHSHLLKSNCLITNQPDWGSVEIRYQGA
QUEF_VIBVU      ISS-----YDFDDRLLEGAA----GEEWVTETLHSHLLKSNCLITNQPDWGSVEIRYQGH
QUEF_VIBVY      ISS-----YDFDDRLLEGAA----GEEWVTETLHSHLLKSNCLITNQPDWGSVEIRYQGH
QUEF_VIBCH      IAN-----YEFDDALLQGAA----QGEEVSEVLHSHLLKSNCLITNQPDWGSVEIAYHGA
QUEF_ALIF1      IDD-----YEFNAAYLESST----SDVNIEETLHSHLLKSNCLITNQPDWGSVEIQYKGK
QUEF_PHOPR      INS-----YDFDAQYLKDAA----EGEIVTEDLHSHLLKSNCLITNQPDWGSVKISYKGK
QUEF_SHESM      VSD-----YDFNPDYLENSTD---DKQIVAETLNSNLLKSNCLITSQPDWGSVMIRYQGP
QUEF_SHESR      VSD-----YDFNPDYLENSTD---DKQIVAETLNSNLLKSNCLITSQPDWGSVMIRYQGP
QUEF_SHEON      VSD-----YDFNPEYLENSTD---EKQIVAETLNSNLLKSNCLITSQPDWGSVMIRYQGP
QUEF_SHEDO      IFD-----YQFNPEYLLDSTE----EKNVAETLTSNLLKSNCLITSQPDWGSVMIRYQGP
QUEF_SHEFN      VTE-----YEFNPDHLIGGTD---PDKNVAETLNSNLLKSNCLITSQPDWGSVMVRYQGP
QUEF_IDILO      ISH-----YDYQPSLLATEQ------HETEEALHSHLLKSNCLITNQPDWGSVYIHYQGP
QUEF_COLP3      IDN-----YQYDPQLLATAQDE-RSGSQIEEYLVSHLLKSNCLITNQPDWASIYIHYRGK
QUEF_PSEHT      IDN-----YDIDAHSLKSQ-----SNKTVTETLHSHLLKSNCLITSQPDWASVIIRYTGE
QUEF_LEGPA      CSV-----YHVMPDFLSTSS------KLVEEVLYSDLLKSNCLVTNQPDWGSVQIIYKGK
QUEF_LEGPC      CSV-----YHVMPDFLSTSS------ELVEEVLYSDLLKSNCLVTNQPDWGSVQIIYKGK
QUEF_LEGPL      CSV-----YHVMPDFLSTSS------ELVEEVLYSDLLKSNCLVTNQPDWGSVQIIYKGK
QUEF_HYDCU      VED-----YQVNPDLLHTDSD-----QIVSETLNSHLLKSNCLVTGQPDWGSIVVRYEGA
QUEF_RICBR      CSE-----YGPPNNSLIKHED-----VLVEEELNSNLLKSNCLVTGQPDWGTIIIKYKGK
QUEF_RICB8      CSE-----YGPPNNSLIKHED-----VLVEEELNSNLLKSNCLVTGQPDWGTIIIKYKGK
QUEF_RICRS      CNN-----YGAPDNSLIEYED-----VLVEEEINSNLLKSNCLVTSQPDWGTIVIKYKGK
QUEF_RICRO      CNN-----YGAPDNSLIEYED-----VLVEEEINSNLLKSNCLVTSQPDWGTIVIKYKGK
QUEF_RICCN      CNN-----YGAPDNSLIEYED-----VLVEEEINSHLLKSNCLVTGQPDWGTIVIKYKGK
QUEF_RICM5      CNN-----YGAPDNSLIEYED-----VLVEEEINSNLLKSNCLVTGQPDWGTIVIKYKGK
QUEF_RICFE      CNN-----YGPPDNSLIEYED-----VLVEEEINSNLLKSNCLVTGQPDWGTIVIKYKGK
QUEF_RICAH      CNN-----YGPPDNSLVEYEE-----VLVEEEINSNLLKSNCLVTGQPDWGSIVIKYKGK
QUEF_RICCK      CNN-----YCPPDNSLIEYED-----VLVEEEINSNLLKSNCLVTGQPDWGTIVIKYRGK
QUEF_RICPR      CNN-----YGPPDNSLIEYED-----VLVEEEIYSNLFKSNCLVTGQPDWGTIVIKYKGK
QUEF_RICTY      CNN-----YGPPDNSLIEYED-----VLVEEEIHSNLLKSNCLVTGQPDWGTIVIKYKGK
QUEF_CUPNH      VDR-----YEPA-PELLSAD---QQESPVEETLVSHLLKSNCLVTGQPDWGSVQIRYVGA
QUEF_CUPPJ      VDR-----YEPA-PDLLKAD---QQESPVEETLVSHLLKSNCLVTGQPDWGSVQIRYVGA
QUEF_CUPMC      TDI-----YEPD-PTLLSAE---QEESPVEETLVSHLLKSNCLVTGQPDWGSVQIRYVGA
QUEF_RALSO      TDV-----YQPT-PGLLHAD---QDESPVEEVLVSHLLKSNCLVTGQPDWGSVQIRYVGA
QUEF_BURM9      AHV-----YETD-PSFLTAS---HDEAPVEETLVTDLLKSNCPVTGQPDWGSVQIHYVGA
QUEF_BURMA      AHV-----YETD-PSFLTAS---HDEAPVEETLVTDLLKSNCPVTGQPDWGSVQIHYVGA
QUEF_BURM7      AHV-----YETD-PSFLTAS---HDEAPVEETLVTDLLKSNCPVTGQPDWGSVQIHYVGA
QUEF_BURP6      AHV-----YETD-PSFLTAS---HDEAPVEETLVTDLLKSNCPVTGQPDWGSVQIHYVGA
QUEF_BURMS      AHV-----YETD-PSFLTAS---HDEAPVEETLVTDLLKSNCPVTGQPDWGSVQIHYVGA
QUEF_BURP1      AHV-----YETD-PSFLTAS---HGEAPVEETLVTDLLKSNCPVTGQPDWGSVQIHYVGA
QUEF_BURPS      AHV-----YETD-PSFLTAS---HGEAPVEETLVTDLLKSNCPVTGQPDWGSVQIHYVGA
QUEF_BURP0      AHV-----YETD-PSFLTAS---HGEAPVEETLVTDLLKSNCPVTGQPDWGSVQIHYVGA
QUEF_BURTA      ADV-----YETD-PSFLTAS---HDEAPVEETLVTDLLKSNCPVTGQPDWGSVQIHYVGA
QUEF_BURCM      TDV-----YEPD-PSLLSAA---QDEAPVEETLVSDLLRSNCPVTGQPDWGSVQIHYVGP
QUEF_BURVG      TDV-----YEPD-PSLLSAA---ADEAPVEETLVSDLLRSNCPVTGQPDWGSVQIHYVGP
QUEF_BURCA      TDV-----YEPD-PSLLSAADG-ENEAPVEETLVSDLLRSNCPVTGQPDWGSVQIHYVGP
QUEF_BURCH      TDV-----YEPD-PSLLSAADG-ENEAPVEETLVSDLLRSNCPVTGQPDWGSVQIHYVGP
QUEF_BURL3      TDV-----YEPD-PSLLKAA---EDEAPVEETLVSDLLRSNCPVTGQPDWGSVQIHYVGP
QUEF_PARXL      TDV-----YQPD-ASLLKAA---LHEAPVEETVFSNLLKSNCPVTGQPDWGSVQIHYVGP
QUEF_POLSJ      CIH-----FTPA-PELLFAE---FDEPPVDETLTSNLLKSNCLVTGQPDWGSVQISYSGP
QUEF_POLNA      CSR-----YTPA-PDLLSAV---FDEPPVSEVLTSNLLKSNCLVTGQPDWGSVRIAYSGP
QUEF_ACIAC      CTH-----YTPA-PELLHAN---HGEAPVTETLTSHLLKSNCLVTGQPDWGSVRIEYSGA
QUEF_ACISJ      CTR-----YQPA-PELLAAH---HDEAPVTETLVSHLLKSNCLVTGQPDWGSVQITYSGA
QUEF_VEREI      CTQ-----YQPA-PELLSAQ---HDAAPVSERLTSQLLKSNCPVTGQPDWASVQIAYRGP
QUEF_RHOFT      CTH-----YTPA-PDLLRVV---PDEAPVSEVLVSNLLKSNCPVTGQPDWASVQISYSGA
QUEF_BORBR      IDT-----YEPA-PQLLQCA----PGDEVEETLATRLLKSNCPVTGQPDWASLQVRYRGR
QUEF_BORPE      IDT-----YEPA-PQLLQCA----PGDEVEETLATRLLKSNCPVTGQPDWASLQVRYRGR
QUEF_BORPA      IDT-----YEPA-PQLLQCA----PGDEVEETLATRLLKSNCPVTGQPDWASLQVRYRGR
QUEF_BORA1      VDR-----YEPA-PELLGCT----GTGIIEETLMSRLLKSNCPVTGQPDWASVQIAYRGR
QUEF_CHRVO      VDN-----YAPC-PEILSAD----STAIVSETLCSNLLKSNCLVTGQPDWGSVSIRYTGP
QUEF_XANAC      IDD-----YGPPNAAYLCAHAQ----PVVEEVLTSALLKSNCPVTGQPDWASVTLRYRGA
QUEF_XANC5      IDD-----YGPPNAAYLCARAQ----PAVEEVLTSALLKSNCPVTGQPDWASVTLHYRGA
QUEF_XANOM      IDD-----YGPPNAAYLTAQAQ----PVVEEVLTSALLKSNCPVTGQPDWASVTLHYRGA
QUEF_XANOR      IDD-----YGPPNAAYLTAQAQ----PVVEEVLTSALLKSNCPVTGQPDWASVTLHYRGA
QUEF_XANC8      IDD-----YGPPKADYLATHAG----TVVEEVLASALLKSNCPVTGQPDWASVTLRYRGA
QUEF_XANCP      IDD-----YGPPKADYLATHAG----TVVEEVLASALLKSNCPVTGQPDWASVTLRYRGA
QUEF_XYLFT      IED-----YGPPNPDYLSNVAQNLVEEMVEETLTSTLFKSNCPVTGQPDWASVTVRYFGM
QUEF_XYLFA      IED-----YGPPNPDYLSNVAQNLIEEMVEETLTSTLFKSNCPVTGQPDWASVTVRYFGV
QUEF_CHRSD      IEY-----YTPT-PGLLEVG-----EEIVEETLHSHLLKSNCPVTGQPDWGSVLIRYRGP
QUEF_AZOSB      IDT-----YQPD-PTLLSA-----GDEVVSETLYSHLLKTNCLVTGQPDWGMVAVRYTGP
QUEF_AROAE      IDT-----YRTD-PAFLQSD---FNADEVSETLYSHLLKSNCLVTGQPDWGTIVLRYIGP
QUEF_DECAR      CDR-----YQPE-PALLAT----LPGENVEETLYSHLLKSNCLVTGQPDWAMVVIRYRGK
QUEF_COXBR      IDT-----YSPD-PNLLST-----SQETVTETLYSHLLKSNCPVTGQPDWGSIEIHYTGP
QUEF_COXBU      IDT-----YSPD-PNLLST-----SQETVTETLYSHLLKSNCPVTGQPDWGSIEIHYTGP
QUEF_COXBN      IDT-----YSPD-PNLLST-----SQETVTETLYSHLLKSNCPVTGQPDWGSIEIHYTGP
QUEF_PSE14      VSS-----YDRPQPELLCCD----ESQIIEESVHSHLLKSNCPVTSQPDWGSVVVEYRGA
QUEF_PSEU2      VSS-----YDRPQPELLCCD----DSRVVAESVHSHLLKSNCPVTSQPDWGSVVVEYRGA
QUEF_PSESM      VSS-----YDQPQPELLRCD----DSQVIEEAVHSHLLKSNCPVTSQPDWGSVVVEYRGA
QUEF_PSEF5      VDS-----YEHPRPELLRCD----ASRVVEESVHSHLLKSNCPVTSQPDWGSVVVQYRGA
QUEF_PSEPF      VSD-----YEHPRPELLRCD----DSRVVEESVHSHLLKSNCPVTSQPDWGSVVVEYRGA
QUEF_PSEMY      VTQ-----YAHPQPELLRCD----ASRVVEESLHSHLLKSNCPVTGQPDWGSLVVQYRGA
QUEF_PSEP1      ISN-----YEQPQPELLRCD----PARVVEETLHSHLLKSNCPVTGQPDWGSVVVEYKGR
QUEF_PSEPK      ISN-----YEQPQPELLRCN----PERVVEETLHSHLLKSNCPVTGQPDWGSVVVQYKGR
QUEF_PSEPG      ISN-----YEQPQPELLRCN----TAQVVEETLHSHLLKSNCPVTGQPDWGSVVVEYKGR
QUEF_PSEE4      IDN-----YEQPQPELLRCS----TERVVEETVHSHLLKSNCPVTGQPDWGSVVVEYKGR
QUEF_PSEAB      VDG-----YEQPRPELLRCD----AGRIVEEQLYSHLLKSNCPVTGQPDWGTLVVDYRGP
QUEF_PSEAE      VDG-----YEQPRPELLRCD----AGRIVEEQLYSHLLKSNCPVTGQPDWGTLVVDYRGP
QUEF_PSEA7      VDG-----YERPRPELLRCD----AGRFVEEQLYSHLLKSNCPVTGQPDWGTLVVDYRGP
QUEF_HAHCH      VDV-----YTPDASLLPDPV----GDDVVEETLSSDLLKSNCPVTGQPDWATLYIHYRGK
QUEF_SACD2      AAV-----YTPDAALLKVEQ------GEVSEQLFSHLLKSNCPVTGQPDWATVWVSYRGN
QUEF_DESPS      EEIN---AYRPTANYLSTGP------EETEEELYTNLLRTNCPVTGQPDWATVIINYRGK
QUEF_PSYA2      STEKVALMLHPDASLLERDSSDAQISDGKTFSFYSNLLRSNCPVTNQPDWAALAVSITSK
QUEF_PSYCK      STEKVALTLHPDASLLERNTSDAKISEGKTFSFYSNLLRSNCPVTNQPDWGTLAVSITSN
QUEF_ACIAD      R-----LESHPDASLLKLDANEQHDAD---VTLYSHLLRSNCPVTGQPDWGTVFIRYTGR
                                                . : *:::** :* ****. : :   . 

QUEF_ECOL6      Q-IDREKLLRYLVSFRHHNEFHEQCVERIFNDLLRFCQPEKLSVYARYTRRGGLDINPWR
QUEF_ECOL5      Q-IDREKLLRYLVSFRHHNEFHEQCVERIFNDLLRFCQPEKLSVYARYTRRGGLDINPWR
QUEF_ECO24      Q-IDREKLLRYLVSFRHHNEFHEQCVERIFNDLLRFCQPEKLSVYARYTRRGGLDINPWR
QUEF_ECOK1      Q-IDREKLLRYLVSFRHHNEFHEQCVERIFNDLLRFCQPEKLSVYARYTRRGGLDINPWR
QUEF_ECOUT      Q-IDREKLLRYLVSFRHHNEFHEQCVERIFNDLLRFCQPEKLSVYARYTRRGGLDINPWR
QUEF_SHIF8      Q-IDREKLLRYLVSFRHHNEFHEQCVERIFNDLLRFCQPEKLSVYARYTRRGGLDINPWR
QUEF_SHIFL      Q-IDREKLLRYLVSFRHHNEFHEQCVERIFNDLLRFCQPEKLSVYARYTRRGGLDINPWR
QUEF_SHIBS      Q-IDREKLLRYLVSFRHHNEFHEQCVERIFNDLLRFCQPEKLSVYARYTRRGGLDINPWR
QUEF_SHISS      Q-IDREKLLRYLVSFRHHNEFHEQCVERIFNDLLRFCQPEKLSVYARYTRRGGLDINPWR
QUEF_ECOHS      Q-IDREKLLRYLVSFRHHNEFHEQCVERIFNDLLRFCQPEKLSVYARYTRRGGLDINPWR
QUEF_ECOLC      Q-IDREKLLRYLVSFRHHNEFHEQCVERIFNDLLRFCQPEKLSVYARYTRRGGLDINPWR
QUEF_ECOLI      Q-IDREKLLRYLVSFRHHNEFHEQCVERIFNDLLRFCQPEKLSVYARYTRRGGLDINPWR
QUEF_ECO57      Q-IDREKLLRYLVSFRHHNEFHEQCVERIFNDLLRFCQPEKLSVYARYTRRGGLDINPWR
QUEF_SHIDS      Q-IDREKLLRYLVSFRHHNEFHEQCVERIFNDLLRFCQPEKLSVYARYTRRGGLDINPWR
QUEF_CITK8      K-IDREKLLRYLVSFRHHNEFHEQCVERIFNDLLRFCQPEKLSVYARYTRRGGLDINPWR
QUEF_SALCH      K-IDREKLLRYLVSFRHHNEFHEQCVERIFNDILRFCQPETLSVYARYTRRGGLDINPWR
QUEF_SALTI      K-IDREKLLRYLVSFRHHNEFHEQCVERIFNDILRFCQPETLSVYARYTRRGGLDINPWR
QUEF_SALTY      K-IDREKLLRYLVSFRHHNEFHEQCVERIFNDILRFCQPETLSVYARYTRRGGLDINPWR
QUEF_SALPA      K-IDREKLLRYLVSFRHHNEFHEQCVERIFNDILRFCQPETLSIYARYTRRGGLDINPWR
QUEF_SALPB      K-IDREKLLRYLVSFRHHNEFHEQCVERIFNDILRFCQPETLSVYARYTRRGGLDINPWR
QUEF_SALAR      K-IDREKLLRYLVSFRHHNEFHEQCVERIFNDLLRFCQPETLSVYARYTRRGGLDINPWR
QUEF_KLEP7      K-IDREQLLRYLVSFRHHNEFHEQCVERIFNDILRFCQPESLSVYARYTRRGGLDINPWR
QUEF_CROS8      K-ICREKLLRYLVSFRHHNEFHEQCVERIFNDITRFCQPEQLSVYARYTRRGGLDINPWR
QUEF_YERP3      Q-IDHEALLRYLVSFRHHNEFHEQCVERIFNDIMRFCQPETLTVYARYTRRGGLDINPWR
QUEF_YERPS      Q-IDHEALLRYLVSFRHHNEFHEQCVERIFNDIMRFCQPETLTVYARYTRRGGLDINPWR
QUEF_YERPN      Q-IDHEALLRYLVSFRHHNEFHEQCVERIFNDIMRFCQPETLTVYARYTRRGGLDINPWR
QUEF_YERPA      Q-IDHEALLRYLVSFRHHNEFHEQCVERIFNDIMRFCQPETLTVYARYTRRGGLDINPWR
QUEF_YERPP      Q-IDHEALLRYLVSFRHHNEFHEQCVERIFNDIMRFCQPETLTVYARYTRRGGLDINPWR
QUEF_YERPE      Q-IDHEALLRYLVSFRHHNEFHEQCVERIFNDIMRFCQPETLTVYARYTRRGGLDINPWR
QUEF_YERE8      Q-INREALLRYLISFRHHNEFHEQCVERIFNDIMRFCQPETLSVYARYTRRGGLDINPWR
QUEF_PECAS      R-INREALLRYIVSFRHHNEFHEQCVERIFNDLMHYYQPEKLSVYARYTRRGGLDINPWR
QUEF_PHOLL      K-INREALLRYLISFRHHNEFHEQCVERIFSDLQQLCAPEKLSVYARYTRRGGLDINPWR
QUEF_SODGM      R-IDREALLRYLVSFRQHNEFHEQCVERIFCDVMQFCRPETLTVYARYTRRGGLDINPWR
QUEF_BAUCH      R-INREALLRYLISFRKYKIFHEQCVEQIYCDIMQFCLPNTLSVYVRYNRRGGLDINPWR
QUEF_ACTP2      K-LNREKLLRYLVSFREHNEFHEQCVERIFIDLIQFTQPEKLTVYARYTRRGGLDINPFR
QUEF_HAEDU      K-INREKLLRYLVSFREHNEFHEQCVERIFTDLMTFAKPEKLMVYARYTRRGGLEINPFR
QUEF_HAEI8      K-INHEKLLRYVISFRQHNEFHEQCVERIFCDLMHYAKPEKLTVYARYTRRGGLDINPFR
QUEF_HAEIG      K-INHEKLLRYVVSFRQHNEFHEQCVERIFCDLMHYAKPEKLTVYARYTRRGGLDINPFR
QUEF_HAEIE      K-INQEKLLRYVVSFRQHNEFHEQCVERIFCDLMHYAKPEKLTVYARYTRRGGLDINPFR
QUEF_HAEIN      K-INQEKLLRYVVSFRQHNEFHEQCVERIFCDLMHYAKPEKLTVYARYTRRGGLDINPFR
QUEF_ACTSZ      R-IDREKLLRYIVSFRQHNEFHEQCVERIFCDILHYAEPEKLTVYARYTRRGGLDINPFR
QUEF_MANSM      R-IDHEKLLRYLVSFRQHNEFHEQCVERIYCDIMKYARPEKLTVYARYTRRGGLDINPFR
QUEF_HAES1      Q-INREKLLRYLISFRQHNEFHEQCVERIFCDLMKFAQPEKLSVYARYTRRGGLDINPFR
QUEF_HISS2      Q-INREKLLRYLISFRQHNEFHEQCVERIFCDLMKFAQPEKLSVYARYTRRGGLDINPFR
QUEF_PASMU      Q-IDREKLLRYIISFRQHNEFHEQCVERIFCDLMQFAKPDKLTVYARYTRRGGLDINPFR
QUEF_VIBPA      K-IDREKLLRYLVSFREHNEFHEQCVERIFTDLMKYCQPNKLTVFARYTRRGGLDINPYR
QUEF_VIBCB      K-LDREKLLRYLVSFREHNEFHEQCVERIFTDLMKYCQPTKLTVFARYTRRGGLDINPYR
QUEF_VIBVU      K-IDREKLLRYLVSFREHNEFHEQCVERIFTDLMKYCQPESLTVFARYTRRGGLDINPYR
QUEF_VIBVY      K-IDREKLLRYLVSFREHNEFHEQCVERIFTDLMKYCQPESLTVFARYTRRGGLDINPYR
QUEF_VIBCH      K-MNREALLRYLVSFREHNEFHEQCVERIFTDIMRYCQPQSLTVYARYTRRGGLDINPFR
QUEF_ALIF1      K-IDREKLLRYLISFRQHNEFHEQCVERIYTDIMKYCAPESLTVFARYTRRGGLDINPFR
QUEF_PHOPR      Q-INREKLLRYLVSFRNHNEFHEQCVERIFTDIMKFCQPELLTVYARYTRRGGLDINPYR
QUEF_SHESM      K-IDREKLLRYLISFRQHNEFHEQCVERIFVDLKHYCHCTKLTVYARYTRRGGLDINPYR
QUEF_SHESR      K-IDREKLLRYLISFRQHNEFHEQCVERIFVDLKHYCHCTKLTVYARYTRRGGLDINPYR
QUEF_SHEON      K-IDREKLLRYLISFRQHNEFHEQCVERIFVDLKHYCHCAKLTVYARYTRRGGLDINPYR
QUEF_SHEDO      K-IDREKLLRYLISFRQHNEFHEQCVERIFMDLKQYCHCAKLTVYARYTRRGGLDINPFR
QUEF_SHEFN      K-IDREKLLRYLISFRQHNEFHEQCVERIFVDLKKYCQCTKLTVYARYTRRGGLDINPYR
QUEF_IDILO      K-LDRAALLAYLVSFRRHNEFHEQCVERIYQDLKALGM-KKLTVYARYTRRGGLDINPFR
QUEF_COLP3      A-IDHSSLLKYLISFRQHNEFHEQCVERIYCDLQQFCQLDELTIFARYTRRGGLDINPFR
QUEF_PSEHT      Q-ICRESLLRYLISFRTHNEFHEQCVERIYSDLSTQLSIKNLEVYARYTRRGGLDINPYR
QUEF_LEGPA      K-INHEGLLKYLISFRNHNEFHEQCIERIFADIMRFCQPESLAVYGRYTRRGGLDINPIR
QUEF_LEGPC      K-INHEGLLKYLISFRNHNEFHEQCIERIFADIMRFCQPESLTVYGRYTRRGGLDINPIR
QUEF_LEGPL      K-INHEGLLKYLISFRNHNEFHEQCIERIFADIMRFCQPESLTVYGRYTRRGGLDINPIR
QUEF_HYDCU      Q-INHEALLKYLISFREHNEFHEQCVERVFTDIMRFCQPKKLTVYARYLRRGGLDINPYR
QUEF_RICBR      K-LKHDALLKYLVSFRNCNEFAEQCAERIFTDIKNAINPEFLSIYIIYTRRGGIDICPYR
QUEF_RICB8      K-LKHDALLKYLVSFRNCNEFAEQCAERIFTDIKNAINPEFLSIYIIYTRRGGIDICPYR
QUEF_RICRS      K-LKYDSFLKYLISFRNCNEFAEQCAERIFTDIQNAISPDFLSIYIVYARRGGIDICPYR
QUEF_RICRO      K-LKYDSFLKYLISFRNCNEFAEQCAERIFTDIQNAISPDFLSIYIVYARRGGIDICPYR
QUEF_RICCN      K-LKYDSFLKYLISFRNCNEFAEQCAERIFTDIKNAISPDFLSIYIVYARRGGIDICPYR
QUEF_RICM5      K-LKHDSFLKYLISFRNCNEFAEQCAERIFTDIKNAISPDFLSISIVYTRRGGIDICPYR
QUEF_RICFE      K-LKHDSFLKYLISFRNCNEFAEQCAERIFTDIKNAINPDFLSIYIVYTRRGGIDICPYR
QUEF_RICAH      K-LKHDSFLKYLISFRNYHEFAEQCAERIFTDIKNAIKPDFLSLYIVYTRRGGIDICPYR
QUEF_RICCK      K-LKHDSFLKYLISFRNYNEFAEQCAERIFTDINNSINPDFLSIYIVYTRRGGIDICPYR
QUEF_RICPR      K-LKYDSFLRYLISFRNFNEFAEQCAERIFIDIKNSINLDFLSIYIVYTRRGGIDICPYR
QUEF_RICTY      K-LKYDSFLRYLISFRNCNEFAEQCAERIFIDIKNAINLDFLSIYIVYTRRGGIDICPYR
QUEF_CUPNH      P-INQEGLLKYLISFRNHNEFHEQCVERIFMDVMRECKPVKLAVYARYTRRGGLDINPFR
QUEF_CUPPJ      P-INQEGLLKYLISFRNHNEFHEQCVERIFMDVMRECKPVKLAVYARYTRRGGLDINPFR
QUEF_CUPMC      P-IDQEGLLKYLISFRNHNEFHEQCVERIFTDVMRMCKPVKLAVYARYTRRGGLDINPFR
QUEF_RALSO      P-INQEGLLKYLISFREHNEFHEQCVERIFMDIQRQCRPVKLAVYARYTRRGGLDINPFR
QUEF_BURM9      P-IDHAGLLRYIISFRNHTGFHEQCVERIFVDILRACQPVKLAVYARYTRRGGLDINPFR
QUEF_BURMA      P-IDHAGLLRYIISFRNHTGFHEQCVERIFVDILRACQPVKLAVYARYTRRGGLDINPFR
QUEF_BURM7      P-IDHAGLLRYIISFRNHTGFHEQCVERIFVDILRACQPVKLAVYARYTRRGGLDINPFR
QUEF_BURP6      P-IDHAGLLRYIISFRNHTGFHEQCVERIFVDILRACQPVKLAVYARYTRRGGLDINPFR
QUEF_BURMS      P-IDHAGLLRYIISFRNHTGFHEQCVERIFVDILRACQPVKLAVYARYTRRGGLDINPFR
QUEF_BURP1      P-IDHAGLLRYIISFRNHTGFHEQCVERIFVDILRACQPVKLAVYARYTRRGGLDINPFR
QUEF_BURPS      P-IDHAGLLRYIISFRNHTGFHEQCVERIFVDILRACQPVKLAVYARYTRRGGLDINPFR
QUEF_BURP0      P-IDHAGLLRYIISFRNHTGFHEQCVERIFVDILRACQPVKLAVYARYTRRGGLDINPFR
QUEF_BURTA      P-IDHAGLLRYIISFRNHTGFHEQCVERIFIDILRACKPVKLAVYARYTRRGGLDINPFR
QUEF_BURCM      Q-IDHAGLLRYIISFRNHTGFHEQCVERIFLDILHACKPLKLAVYARYTRRGGLDINPFR
QUEF_BURVG      Q-IDHAGLLRYIISFRNHTGFHEQCVERIFLDILQACKPLKLAVYARYTRRGGLDINPFR
QUEF_BURCA      Q-IDHAGLLRYIISFRNHTGFHEQCVERIFLDILHACKPVKLAVYARYTRRGGLDINPFR
QUEF_BURCH      Q-IDHAGLLRYIISFRNHTGFHEQCVERIFLDILHACKPVKLAVYARYTRRGGLDINPFR
QUEF_BURL3      Q-IDHAGLLRYIISFRNHTGFHEQCVERIFLDILHACKPVKLAVYARYTRRGGLDINPFR
QUEF_PARXL      Q-IDHAGLLRYIISYRNHTGFHEQCVERIFVDVLKACKPVKLAVYARYTRRGGLDINPFR
QUEF_POLSJ      Q-INQEGLLQYLVSFRNHNEFHEQCVERIFMDVWTRCRPLKLSVYARYTRRGGLDINPFR
QUEF_POLNA      Q-INQEGLLQYIVSFRNHNEFHEQCVERIFMDLWTRCKPVKLTVYARYTRRGGLDINPFR
QUEF_ACIAC      Q-IDQSGLLRYLVSFRNHNEFHEQCVERIFMDLWTRCRPIKLSVYARYTRRGGLDINPLR
QUEF_ACISJ      Q-IDQAGLLQYLVSFRNHNEFHEQCVERIFMDIWTRCRPIKLAVYARYTRRGGLDINPLR
QUEF_VEREI      P-IDQEGLLQYLVSFRNHSGFHEQCVERIFMDLWTRCQPIELTVYARYTRRGGLDINPLR
QUEF_RHOFT      P-IDQEGLLQYLVSFRNHNEFHEQCVERIFMDLWTRCKPVRLAVYARYTRRGGLDINPFR
QUEF_BORBR      P-IDRAALLKYVVSFRQHAEFHEHCVERIFGDIMRACQPRQLTVYARYTRRGGLDINPWR
QUEF_BORPE      P-IDRAALLKYVVSFRQHAEFHEHCVERIFGDIMRACQPRQLTVYARYTRRGGLDINPWR
QUEF_BORPA      P-IDRAALLKYVVSFRQHAEFHEHCVERIFGDIMRACQPRQLTVYARYTRRGGLDINPWR
QUEF_BORA1      P-IDRAGLLKYIISFRQHAEFHEHCVERIFCDLMQACQPEQLTVYARYTRRGGLDINPWR
QUEF_CHRVO      K-IDREALLRYLIGFRRHNEFHEQCVERIFVDVLRACAPTKLTVYARYTRRGGLDINPWR
QUEF_XANAC      P-IDREGLLRYLVSFRDHAEFHEQCVERIFNDVLTQCAPQWLVVEARYTRRGGLDINPLR
QUEF_XANC5      P-IDREGLLRYLVSFRDHAEFHEQCVERIFNDVLTQCAPQWLVVEARYTRRGGLDINPLR
QUEF_XANOM      P-IEREGLLRYLVSFRDHAEFHEQCVERIFHDVLLRCAPEWLVVEARYTRRGGLDINPLR
QUEF_XANOR      P-IEREGLLRYLVSFRDHAEFHEQCVERIFHDVLLRCAPEWLVVEARYTRRGGLDINPLR
QUEF_XANC8      P-IDREGLLRYLVSFRDHADFHEQCVERIFQDLLVRCAPQWLVVEARYTRRGGLDINPVR
QUEF_XANCP      P-IDREGLLRYLVSFRDHADFHEQCVERIFQDLLVRCAPQWLVVEARYTRRGGLDINPVR
QUEF_XYLFT      P-IDHEGLLRYFISFRHHAEFHEQCVERIFQDVLQRCAPQCLAVEARYTRRGGLDINPLR
QUEF_XYLFA      P-IDHEGLLRYFISFRHHAEFHEQCVERIFQDVLQRCSPQCLAVEARYTRRGGLDINPLR
QUEF_CHRSD      R-LERDALLKYLISYRQHQDFHEHCVEHLFVDLMARARPERLLVMARYVRRGGLDISPWR
QUEF_AZOSB      R-IDRAGLLRYIVSFREHNEFHEQCVERVFCDITARCRPQRLAVWARYTRRGGLDINPFR
QUEF_AROAE      P-IDRAGLLRYIVSFRSHNEFHEQCVERIFCDVLRRCAPRHLAVWARYTRRGGLDINPFR
QUEF_DECAR      P-IDRAGLLRYIVSFRNHNEFHEQCVERIFSDIRVRCQPEVLAVHARYTRRGGLDINPFR
QUEF_COXBR      K-IDHVQLLKYIISYRNHEEFHEACVERFFMDILRHCRPQELTVQARYTRRGGLDINPYR
QUEF_COXBU      K-IDHVQLLKYIISYRNHEEFHEACVERFFMDILRHCRPQELTVQARYTRRGGLDINPYR
QUEF_COXBN      K-IDHAQLLKYIISYRNHEEFHEACVERFFMDILRHCRPQELTVQARYTRRGGLDINPYR
QUEF_PSE14      A-LDHSSLLAYIVSFRQHSDFHEQCVERIFLDLQRLLKPEKLTVYARYVRRGGLDINPYR
QUEF_PSEU2      A-LDHASLLAYIVSFRQHSDFHEQCVERIFLDLQRLLKPEKLTVYARYVRRGGLDINPYR
QUEF_PSESM      A-LDHASLLAYIVSFRQHSDFHEQCVERIFLDLQRLLKPEKLTVYARYVRRGGLDINPYR
QUEF_PSEF5      A-LDHASLLAYLVSFRQHSDFHEQCVERIFLDLQRLLKPERLTVYARYVRRGGLDINPYR
QUEF_PSEPF      A-LDHASLLEYIVSFRQHSDFHEQCVERIFLDLQRLLKPEKLTVFARYVRRGGLDINPYR
QUEF_PSEMY      A-LDHASLLAYLVSFRQHADFHEQCVERIFLDLQRLLQPQSLTVYARYVRRGGLDINPYR
QUEF_PSEP1      A-LDHASLLTYLISFRQHADFHEQCVERIYLDLKNLLQPEHLTVYARYVRRGGLDINPYR
QUEF_PSEPK      A-LDHASLLTYLISFRQHADFHEQCVERIYLDLKNLLQPEHLTVYARYVRRGGLDINPYR
QUEF_PSEPG      A-LDHASLLTYLVSFRQHADFHEQCVERIYLDLKNLLQPEHLTVYARYVRRGGLDINPYR
QUEF_PSEE4      A-LDHASLLTYLISFRQHADFHEQCVERIYLDLKKLLQPEYLTVYARYVRRGGLDINPYR
QUEF_PSEAB      A-LDPASLLAYLVSFRQHQDFHEQCVERIFLDLQRLLQPQALSVYARYVRRGGLDINPYR
QUEF_PSEAE      A-LDPASLLAYLVSFRQHQDFHEQCVERIFLDLQRLLQPQALSVYARYVRRGGLDINPYR
QUEF_PSEA7      A-LDPASLLAYLVSFRQHQDFHEQCVERIFLDLRRLLQPQALTVYARYVRRGGLDINPYR
QUEF_HAHCH      P-LEKAALLKYIVSMRSHQDFHEHCVESVYLTLMQRYQPEKLAVYARYTRRGGLDINPLR
QUEF_SACD2      K-ITPESLLAYVVSYRQHQDFHENCVEKIFTDIMAQCAPVELSVYARYTRRGGLDINPFR
QUEF_DESPS      A-IDQRGLLRYIISFRQHEGFHENCVERIFMDILNRCAPARLTVYARFTRRGGLDINPYR
QUEF_PSYA2      KVVNQANMLRYILSFRQHNGFHEQCVEQIFADLSQYYEPSKLMVRAWYTRRGGIDINPCR
QUEF_PSYCK      KPVNNANMLRYILSFRQHNGFHEQCVEQIFADLSQYYEPSELMVRAWYTRRGGIDINPCR
QUEF_ACIAD      KHCYRS-ILAYIISYRQHNGFHEQCVEQIYADIWKNLQPEKLMVYATYTRRGGLDINPCR
                       :* *.:. *    * * * * .:  :        * :   : ****::* * *

QUEF_ECOL6      SNND--FVPSTTRLVRQ
QUEF_ECOL5      SNND--FVPSTTRLVRQ
QUEF_ECO24      SNSD--FVPSTTRLVRQ
QUEF_ECOK1      SNSD--FVPSTTRLVRQ
QUEF_ECOUT      SNSD--FVPSTTRLVRQ
QUEF_SHIF8      SNSD--FVPSTTRLVRQ
QUEF_SHIFL      SNSD--FVPSTTRLVRQ
QUEF_SHIBS      SNSD--FVPSTTRLVRQ
QUEF_SHISS      SNSD--FVPSTTRLVRQ
QUEF_ECOHS      SNSD--FVPSTTRLVRQ
QUEF_ECOLC      SNSD--FVPSTTRLVRQ
QUEF_ECOLI      SNSD--FVPSTTRLVRQ
QUEF_ECO57      SNSD--FVPSTTRLVRQ
QUEF_SHIDS      SNSD--FVPSTTRLVRQ
QUEF_CITK8      SNTD--FVPATGRLVRQ
QUEF_SALCH      SNTD--FVPATGRLARQ
QUEF_SALTI      SNTD--FVPATGRLARQ
QUEF_SALTY      SNTD--FVPATGRLARQ
QUEF_SALPA      SNTD--FVPATGRLARQ
QUEF_SALPB      SNTD--FVPATGRLARQ
QUEF_SALAR      SNTD--FVPATGRLARQ
QUEF_KLEP7      SNGD--FSPATGRLARQ
QUEF_CROS8      SNGD--FTPATGRLARQ
QUEF_YERP3      SNTD--FVPLTGRLARQ
QUEF_YERPS      SNTD--FVPLTGRLARQ
QUEF_YERPN      SNTD--FVPLTGRLARQ
QUEF_YERPA      SNTD--FVPLTGRLARQ
QUEF_YERPP      SNTD--FVPLTGRLARQ
QUEF_YERPE      SNTD--FVPLTGRLARQ
QUEF_YERE8      SNTD--FVPLTGRLARQ
QUEF_PECAS      SNTP--FNAPNGRLPRQ
QUEF_PHOLL      TNSEG-FVPATGRLARQ
QUEF_SODGM      SNTH--FSPATGRLARQ
QUEF_BAUCH      SNIS--YSPVNRPLARQ
QUEF_ACTP2      SNFE--SVPQNLRMARQ
QUEF_HAEDU      ANFD--AMPQHIRMARQ
QUEF_HAEI8      SNFE--NLPENLRLARQ
QUEF_HAEIG      SNFE--NLPENLRLARQ
QUEF_HAEIE      SNFE--NLPENLRLARQ
QUEF_HAEIN      SNFE--NLPENLRLARQ
QUEF_ACTSZ      SNFE--PVPGNFRLARQ
QUEF_MANSM      SNFE--AIPQNLRLARQ
QUEF_HAES1      SNFE--PIPLNQRLARQ
QUEF_HISS2      SNFE--PIPLNQRLARQ
QUEF_PASMU      SNFE--AVPDNQRLARQ
QUEF_VIBPA      STEQD-KPAHNHRMARQ
QUEF_VIBCB      STEQD-KPAHNNRMARQ
QUEF_VIBVU      STEQA-KPDHNHRMARQ
QUEF_VIBVY      STEQA-KPDHNHRMARQ
QUEF_VIBCH      SSHQS-APNHNQRMARQ
QUEF_ALIF1      SSHLL-APKDNLRLARQ
QUEF_PHOPR      TNQGK-TPSDNFRLARQ
QUEF_SHESM      SDFE--HPGESHRLARQ
QUEF_SHESR      SDFE--HPGESHRLARQ
QUEF_SHEON      SDFE--HPGESHRLARQ
QUEF_SHEDO      SDFE--QAPDSHRLARQ
QUEF_SHEFN      SDFE--NPPESNRLARQ
QUEF_IDILO      SDFE--PALQMQRMARQ
QUEF_COLP3      SSHIE-QAPFARTLRQ-
QUEF_PSEHT      STHNN-DTPFAVKINRQ
QUEF_LEGPA      STEPCAFDGQNIRLIRQ
QUEF_LEGPC      STEPCAFDGQNIRLIRQ
QUEF_LEGPL      STEPCVFDGQNIRLIRQ
QUEF_HYDCU      SNYEQVFDRA--RLVRQ
QUEF_RICBR      STDSNYTLPSSKRLIRQ
QUEF_RICB8      STDSNYTLPSSKRLIRQ
QUEF_RICRS      STDKNYTLPSDKRFIRQ
QUEF_RICRO      STDKNYTLPSDKRFIRQ
QUEF_RICCN      STDKSYTLPSDKRFIRQ
QUEF_RICM5      STDKSYTLPSDKRFIRQ
QUEF_RICFE      FTNKSYTLPSDKRFIRQ
QUEF_RICAH      STDKSYSLPSDKRLIRQ
QUEF_RICCK      SLDQNYNLPSNKRLIRQ
QUEF_RICPR      STDKSYTLPNDKRLIRQ
QUEF_RICTY      STDKSYALPSNKRFIRQ
QUEF_CUPNH      TNFNTAWPDNK-RNARQ
QUEF_CUPPJ      TNFNTPWPDNL-RNARQ
QUEF_CUPMC      TNYNTPWPDNR-RNARQ
QUEF_RALSO      TNFNTPWPDNL-RNARQ
QUEF_BURM9      TNYNQPMPDNA-RTARQ
QUEF_BURMA      TNYNQPMPDNA-RTARQ
QUEF_BURM7      TNYNQPMPDNA-RTARQ
QUEF_BURP6      TNYNQPMPDNA-RTARQ
QUEF_BURMS      TNYNQPMPDNA-RTARQ
QUEF_BURP1      TNYNQPMPDNA-RTARQ
QUEF_BURPS      TNYNQPMPDNA-RTARQ
QUEF_BURP0      TNYNQPMPDNA-RTARQ
QUEF_BURTA      TNYNQPMPDNA-RTARQ
QUEF_BURCM      TNYNQPMPDNA-RTARQ
QUEF_BURVG      TNYNQSMPDNA-RTARQ
QUEF_BURCA      TNYNQPMPDNA-RTARQ
QUEF_BURCH      TNYNQPMPDNA-RTARQ
QUEF_BURL3      TNYNQPMPDNA-RNARQ
QUEF_PARXL      TNYNLPMPDNM-RLARQ
QUEF_POLSJ      TSHPQALPANI-RMARQ
QUEF_POLNA      TSHPQAIPPNI-RMARQ
QUEF_ACIAC      TSHPQALPANV-RTARQ
QUEF_ACISJ      TSHPQQLQRNV-RTARQ
QUEF_VEREI      TSHPQGLPRNM-RTARQ
QUEF_RHOFT      TSYAQALPANV-RNARQ
QUEF_BORBR      SNFESAPPADV-RTARQ
QUEF_BORPE      SNFESAPPADV-RTARQ
QUEF_BORPA      SNFESAPPADV-RTARQ
QUEF_BORA1      SNAGASAPADL-RGARQ
QUEF_CHRVO      SNCDAAPTDNV-RTARQ
QUEF_XANAC      SSASVPTPLSIFRDLRQ
QUEF_XANC5      SSASVPTPLSIFRDLRQ
QUEF_XANOM      SSLSVPAPLSVFRDLRQ
QUEF_XANOR      SSLSVPAPLSVFRDLRQ
QUEF_XANC8      TSPQMPTPLSIFRDLRQ
QUEF_XANCP      TSPQMPTPLSIFRDLRQ
QUEF_XYLFT      TTSEMAWPLSVFRDPRQ
QUEF_XYLFA      TTSEMAWPISVFRDPRQ
QUEF_CHRSD      GTPGERPPTPL-RLARQ
QUEF_AZOSB      ASDRDQRADEA-MEIRQ
QUEF_AROAE      STGHFTQFDNI-AEVRQ
QUEF_DECAR      STGDYAAPDNT-REIRQ
QUEF_COXBR      STNPTFSVQNH-RSFRQ
QUEF_COXBU      STNPTFSVQNH-RSFRQ
QUEF_COXBN      STNPTFSVQNH-RSFRQ
QUEF_PSE14      STET--LDVNNRRLARQ
QUEF_PSEU2      STET--LDVDNRRLARQ
QUEF_PSESM      STEV--LDVDNRRLARQ
QUEF_PSEF5      STET--ADFANHRLVRQ
QUEF_PSEPF      STES--VQLPNHRLVRQ
QUEF_PSEMY      STEA--LRVDNARLVRQ
QUEF_PSEP1      STGA--ISPDNKRLVRQ
QUEF_PSEPK      STGP--ISPDNKRLVRQ
QUEF_PSEPG      STGV--IKPDNKRLVRQ
QUEF_PSEE4      STRA--ISPENLRLVRQ
QUEF_PSEAB      SLAE--VAPDNRRLVRQ
QUEF_PSEAE      SLAE--VAPDNRRLVRQ
QUEF_PSEA7      SLVD--VAPDNRRLVRQ
QUEF_HAHCH      SNYP--LAADNFKLPRQ
QUEF_SACD2      TNCG--AALPGWRIVRQ
QUEF_DESPS      TTHA--EHFVNLRLARQ
QUEF_PSYA2      VSDIA-LLPVPSRLIRQ
QUEF_PSYCK      VSDIA-LLPVPSRLIRQ
QUEF_ACIAD      VSDLS-WMPNPIRLARQ
                               :