CLUSTAL format seed alignment for MF_00818

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

QUEF_THEEB      ----------------------------------MQVSEMKYGERAIQE----GQLITFP
QUEF_TRIEI      ----------------MNYD-----ETNNELFQESNMQELKYGERNILE----GELITFP
QUEF_TRIV2      ----------------MSNS-------SPETVS-QPSQEVKYGEREIAE----GQLITFP
QUEF_NOSS1      ----------------MSNS-------SPETVS-QPSQEVKYGEREIAE----GQLITFP
QUEF_ACAM1      ----------------MSQSPIQNPTSDPNAQSVQETSESKYGERQIAE----GTLITFP
QUEF_MICAN      ----------------MVQS--------------SEKIEVKYGEREIAE----GTLITFP
QUEF_GLOVI      ----------------MSDL----------PVAPTPAEPVKYGERAIEA----GQLITFP
QUEF_SYNY3      ----------------MTET-----------TITTSDNVEKYGEREIRD----AQLITFP
QUEF_SYNSC      -----------------------------------MTQTPLYGERAIAE----AELICFD
QUEF_SYNPX      -------------------------------MTDQLTQTPLYGERAIAE----AELICFD
QUEF_SYNS9      ----------------MTGA-----------ASQQQTETPLYGERAIDE----AELICFD
QUEF_PROM3      ------------------MS-----------STEAQASKPLYGERVIAE----GELICFD
QUEF_PROMM      ------------------MS-----------STQAQASKTLYGERVIAE----GELICFD
QUEF_PROMA      ------------------MT-----------ISEKSNESELYGERFISD----AEIVCFP
QUEF_PROMT      -----------------MIR-----------QEKDIKDEIMYGEREIEA----GSLICFP
QUEF_PROMP      ----------------MGTA-----------NLHDSTNKPLYGERIIEE----SNIICFE
QUEF_PROM5      ----------------MSTP-----------NLYDSTNKPLYGERLIEE----SKIICFD
QUEF_PROMS      ----------------MSTA-----------KLEDSTQRPLYGERIIEE----SKIICFD
QUEF_PROM9      ----------------MSTA-----------KLDDSTQRPLYGERIIEE----SKIICFE
QUEF_PROM0      ----------------MSKA-----------KLDDSTQRPLYGERIIEE----SKIICFD
QUEF_PROM2      ----------------MSTA-----------KLDDSTQRPLYGERIIKE----SKIICFE
QUEF_NITSB      ---------------------------------------MRYGEKEIQEFDPKKDLEIWP
QUEF_SULDN      ---------------------------------------MKYGEKIVSEFDVEKDLEIWP
QUEF_SULNB      ---------------------------------------MKYGEKEIQEFDINAEENFWP
QUEF_CAMJJ      ---------------------------------------MRYGEKEIKEFDVE-NMEIWP
QUEF_CAMJE      ---------------------------------------MRYGEKEIKEFDVE-NMEIWP
QUEF_CAMJD      ---------------------------------------MRYGEKEIKEFDVE-NMEIWP
QUEF_CAMJR      ---------------------------------------MRYGEKEIKEFDVE-NMEIWP
QUEF_CAMJ8      ---------------------------------------MRYGEKEIKEFDVE-NMEIWP
QUEF_WOLSU      ---------------------------------------MRYGEMEVKNFNPE-EIEVWP
QUEF_AQUAE      ----------------------------------MEAKEKKYGEIEIEK----AQLEAWP
QUEF_NEIMF      ---------MSRNTEE-----------------LQGISLLGNQKTRYPTGYAPEILEAFD
QUEF_NEIMA      ---------MSRNTEE-----------------LQGISLLGNQKTRYPTGYAPEILEAFD
QUEF_NEIMB      ---------MSRNNEE-----------------LQGISLLGNQKTQYPTGYAPEILEAFD
QUEF_NEIG1      ---------MSRNNEE-----------------LQGISLLGNQKTQYPTGYAPEILEAFD
QUEF_STRTD      ----------MSQQEE-----------------MKNLTLLGSKETPYIFEYSPQVLESFD
QUEF_STRT1      ----------MSQQEE-----------------MKNLTLLGSKETPYIFEYSPQVLESFD
QUEF_STRT2      ----------MSQQEE-----------------MKNLTLLGSKETPYIFEYSPQVLESFD
QUEF_STRPN      ----------MQHYET-----------------VEAVTFAYGQ---------RHHLEIQI
QUEF_STRR6      ----------MQHYET-----------------VEAVTFAYGQ---------HHHLEIQI
QUEF_STRMU      ----------MSQ-EE-----------------IKDLTLLGNQKTNYNFDYDLNILEAFD
QUEF_BACCZ      --------MAGRLDED-----------------LKDVTLLGNQNTKYLFEYSPEILEVFD
QUEF_BACC1      --------MAGRLDED-----------------LKDVTLLGNQNTKYLFEYSPEILEVFD
QUEF_BACAN      --------MAGRLDED-----------------LKDVTLLGNQNTKYLFEYSPEILEVFD
QUEF_BACHK      --------MAGRLDED-----------------LKDVTLLGNQNTKYLFEYSPKILEVFD
QUEF_BACCR      --------MTGRLDED-----------------LKDVTLLGNQNTKYLFEYSPEILEVFD
QUEF_BACCN      --------MAGRLDED-----------------LKDVTLLGNQNTKYLFEYSPEILETFD
QUEF_BACSK      --------MAGRQEKE-----------------LQNVTLLGSEQTEYKYSYDPRVLETFD
QUEF_GEOKA      --------MAGRKEEE-----------------LKDLTLLGNQGTTYSFTYNPNLLEVFD
QUEF_GEOTN      --------MNGRKDEE-----------------LKDLTLLGNQGTTYSFTYDPNLLEVFD
QUEF_OCEIH      --------MVGRDENE-----------------LQDVQLLGSQGTTYDFNYTPEVLEVFD
QUEF_BACLD      -------MTT-RKDSE-----------------LEGVTLLGNQGTNYLFDYSPEVLESFP
QUEF_BACSU      -------MTT-RKESE-----------------LEGVTLLGNQGTNYLFEYAPDVLESFP
QUEF_BACP2      -------MTT-RKPEE-----------------LEGVTLLGNQGTNYLFDYAPQVLETFP
QUEF_BACHD      -------MTG-RKEEE-----------------LEGVTLLGNQGTTYTFDYNPDILEVFE
QUEF_STAA8      -------MAHGRQQDE-----------------LQDITLLGNQDNTYNFDYRPDVLESFD
QUEF_STAAE      -------MAHGRQQDE-----------------LQDITLLGNQDNTYNFDYRPDVLESFD
QUEF_STAAS      -------MAHGRQQDE-----------------LQDITLLGNQDNTYNFDYRPDVLESFD
QUEF_STAAT      -------MAHGRQQDE-----------------LQDITLLGNQDNTYNFDYRPDVLESFD
QUEF_STAA9      -------MAHGRQQDE-----------------LQDITLLGNQDNTYNFDYRPDVLESFD
QUEF_STAAB      -------MAHGRQQDE-----------------LQDITLLGNQDNTYNFDYRPDVLESFD
QUEF_STAA3      -------MAHGRQQDE-----------------LQDITLLGNQDNTYNFDYRPDVLESFD
QUEF_STAAW      -------MAHGRQQDE-----------------LQDITLLGNQDNTYNFDYRPDVLESFD
QUEF_STAAC      -------MAHGRQQDE-----------------LQDITLLGNQDNTYNFDYRPDVLESFD
QUEF_STAAM      -------MAHGRQQDE-----------------LQDITLLGNQDNTYNFDYRPDVLESFD
QUEF_STAA2      -------MAHGRQQDE-----------------LQDITLLGNQDNTYNFDYRPDVLESFD
QUEF_STAAN      -------MAHGRQQDE-----------------LQDITLLGNQDNTYNFDYRPDVLESFD
QUEF_STAA1      -------MAHGRQQDE-----------------LQDITLLGNQDNTYNFDYRPDVLESFD
QUEF_STAAR      -------MAHGRQQDE-----------------LQDITLLGNQDNTYNFDYRPDVLESFD
QUEF_STAES      -------MTQGRQKDE-----------------LKDITLLGNQNNTYEFDYRPEVLETFD
QUEF_STAEQ      -------MTQGRQKDE-----------------LKDITLLGNQNNTYEFDYRPEVLETFD
QUEF_STAHJ      -------MTQGRQKEE-----------------LQDITLLGNQNNKYEFDYTPEVLETFD
QUEF_STAS1      -------MTEGRNKEE-----------------LEDITLLGNQNNKYDFDYRPDVLESFD
QUEF_BACFN      ---------MTELKE--------------------QLSLLGRK-TEYKQDYAPEVLEAFD
QUEF_BACFR      ---------MTELKE--------------------QLSLLGRK-TEYKQDYAPEVLEAFD
QUEF_BACTN      ---------MAELKD--------------------QLSLLGRK-TEYKQDYAPEVLEAFD
QUEF_PORGI      ---------MTGIREG-----------------EKELSLLGSK-TEYRNDYAPEVLEAFT
QUEF_HELPH      -------------MTP-----------------ELNLKSLG-AKTTYIFEYNSQLLEAFP
QUEF_HELPY      -------------MTP-----------------ELNLKSLG-AKTPYIFEYNSQLLEAFP
QUEF_HELPJ      -------------MTP-----------------ESNLKSLG-AKTPYIFEYNSDLLEAFP
QUEF_HELAH      -------------MSS-----------------ELNLKLLG-TKTPYIFEYNKDLLEAFP
QUEF_BDEBA      ------MKKKNGRDSK-----------------ELADFALGESQTNYPETYAPEVLEAFD
QUEF_SYNE7      --------MGREGWSRVLSATGENRERSLQKFMTETLTQLGQM-VGLPASPEVAVLETFD
QUEF_SYNP6      --------MGREGWSRVLSATGENRERSLQKFMTETLTQLGQM-VGLPASPEVAVLETFD
QUEF_MAGSA      --------MGTG---------------------TEHLTQLGQS-TALPASPDKAVLETVP
QUEF_BRASB      --------MAKRSIKS----------------ETSPELQLGRP-VTAPDSPETARLDRVP
QUEF_BRASO      --------MAKRSNTT----------------MTSAGLQLGRE-VAPPDSPETAKLDRVP
QUEF_RHOPS      --------MSRSPRKT----------------PKSPSLQLGQA-VEWPATPDAARLDRVP
QUEF_RHOP2      --------MSRSPRKT----------------SKSAGLQLGRA-VAWPATPDAAQIDRVP
QUEF_RHOPB      --------MSKTPRKP----------------SQSPALQLGRA-VDWPQTPDEAKLDRVP
QUEF_RHOPA      --------MSKTPRKS----------------APSPSLQLGQA-VEWPDRPEAAKLDRVP
QUEF_RHOP5      --------MSKPPRRSPRKPT-----------PASPELQLGHE-VVWPTSPDAARLDRVA
QUEF_BRADU      --------MTTMAKKS---------------------LQLGRA-VEWPHTPEEAQLDRVP
QUEF_NITWN      --------MPRKPPSS----------------PKSSPLQLGRA-VAWPDSPEQAKLDRVP
QUEF_NITHX      --------MPRKLPSS----------------PKTSALQLGRA-VAWPGSPEEAKLDRVP
QUEF_PARL1      --------MAKKPVKD--------------------LKQLGHA-TPVPASPEEATLERVP
QUEF_CAUVC      --------MTD-----------------------LNVTQLGRV-VDAPESPEAAVLERVP
QUEF_CAUSK      --------MTE-----------------------LHVTQLGQV-VEPAASPDQAVLERVP
QUEF_HYPNA      --------MADNPIY-------------------QKLGQLGQH-TVQPASPEEAQLERVE
QUEF_ZYMMO      --------------------------------MQTT--HLGKN-SPIPQSPEEASLDYVP
QUEF_NOVAD      -----MPSGAFRCRSGHKAVV-----------MANTPLFLGQN-SSLPASPDEAVLDYVA
QUEF_CHESB      --------MTDT----------------------RNLTQLGSK-TQAPASPEAATLETAP
QUEF_RHILO      --------MIDT----------------------KTLTQLGAH-VETPQSPEAAVLETVP
QUEF_GLUOX      MSDHHPTGPSAPGTDA--------------------LSQLGRA-TTTPQSPEEAVLERVP
QUEF_GRABC      ---------MAENYAG--------------------LTQLGQT-VSQPASPDQAVLEKVP
QUEF_RHIL3      --------MPNTDVSS--------------------LSMLGQQ-TETAQSPEEAVLEKVP
QUEF_RHIEC      --------MPNTDVSS--------------------LSMLGHQ-TETASSPEEAVLEKVP
QUEF_AGRFC      --------MSVTDVSG--------------------LSQLGTK-VDTPESPEKAVLEKVP
QUEF_RHIME      --------MTKTDVSG--------------------LSQLGAK-VDLPQSPEEAVLERVP
QUEF_SINMW      --------MTKTDVSG--------------------LSQLGTK-VDLPQNPEEAVLERVP
QUEF_BRUO2      -------MSENTIYSG--------------------LKQLGSH-TDIPLTPEEAVLERVA
QUEF_BRUSI      -------MSENTIYSG--------------------LKQLGSH-TDIPLTPEEAVLERVA
QUEF_BRUSU      -------MSENTIYSG--------------------LKQLGSH-TDIPLTPEEAVLERVA
QUEF_BRUC2      -------MSENTIYSG--------------------LKQLGSH-TDIPLTPEEAVLERVA
QUEF_BRUAB      -------MSENTIYSG--------------------LKQLGSH-TDIPLTPEEAVLERVA
QUEF_BRUA2      -------MSENTIYSG--------------------LKQLGSH-TDIPLTPEEAVLERVA
QUEF_BRUME      -------MSENTIYSG--------------------LKQLGSH-TDIPLTPEEAVLERVA
QUEF_OCHA4      -------MSEKTIYSD--------------------LKQLGSN-ASIPQNPEDAILERVA
QUEF_RUEST      -------MSE-DIYQN--------------------LKQLGGE-TRIPASPEEAELERVA
QUEF_PARDP      -------MTE-TIYSG--------------------LKQLGGA-TLLPESPDKAELERVR
QUEF_RUEPO      -------MANQDIYAN--------------------LTQLGGK-TELPNSPEEAVLEKVP
QUEF_ACICJ      --------MTDTRYDA--------------------LQQLGRE-SRMPDSPEAAVLERVA
QUEF_MARMM      --------MTDNRYDN--------------------LGQLGTS-TPLPDNPDTAALERVA
QUEF_LEPIN      --------MKTNHPE----------------------TYDGRQ--DHIPSLQTPEIESFT
QUEF_LEPIC      --------MKTNHPE----------------------TYDGRQ--DHIPSLQTPEIESFT
QUEF_LEPBL      --------MKTNHPE----------------------TYDGRQ--DHIPSLKTPEIESFT
QUEF_LEPBJ      --------MKTNHPE----------------------TYDGRQ--DHIPSLKTPEIESFT
QUEF_METCA      -----------------------------------------------MPSQPSKTLETFD
QUEF_NITOC      -----------------------------------------------MPSQPNRELETFA
QUEF_HALHL      -----------------------------------------------MSTEPSKTLETFE
QUEF_THIDA      -----------------------------------------------MPSTPSKTLETFP
QUEF_METFK      -----------------------------------------------MSSQPSKALETFD
QUEF_NITEU      -----------------------------------------------MTTQPSKQLETFE
QUEF_NITEC      -----------------------------------------------MTTQPSKQLETFE
QUEF_NITMU      -----------------------------------------------MPSRPDKNLETFP
QUEF_ALKEH      -----------------------------------------------MSTQPSKDLETFP
QUEF_RUTMC      -----------------------------------------------MSYQPNKVLEVFD
QUEF_VESOH      -----------------------------------------------MSSQPNKNLKVFD
QUEF_ANADE      -----------------------------------------------MPTQPSRDLQTFP
QUEF_ANADF      -----------------------------------------------MPTKPARDLQTFP
QUEF_SYNAS      ------------------------------MQKSTPPEDLSRLTLLGREAKPSRKLETFP
QUEF_FRACC      ---------------------------------------MALTKLGNPEAKADRSLETF-
QUEF_PELLD      --------------------------------------------------MKQEILEVFD
QUEF_CHLPM      --------------------------------------------------MKKEILEVFD
QUEF_CHLTE      --------------------------------------------------MNKEIIEVFD
QUEF_CHLPD      --------------------------------------------------MKKEILEVFD
QUEF_CHLCH      --------------------------------------------------MKLEILESFE
QUEF_RHOBA      ---------------------------------------------MSDTASFRDTLEVFE
QUEF_DESVH      -------------------------MTTRSTDQTEHLRALGQKTPYPAAGPSTDLLEAFP
QUEF_DESVV      -------------------------MTTRSTDQTEHLRALGQKTPYPAAGPSTDLLEAFP
QUEF_THEP1      -----------------------------------MPKAEGRIFDFKGHDAIRTDFLEAI
QUEF_THEMA      -----------------------------------MPKAEGRIFDFKGHDAIRTDFLEAI
QUEF_CALS4      ----------------------------------MTDKYKERRFDIYGYEKIDKEVLESI
                                                                            

QUEF_THEEB      NPR-PGRQYTIEITLPEFTCKCPFSGYPDFATLYVSYIPHE-KVVELKAIKLYINSYRDR
QUEF_TRIEI      NPR-IGRRYEINISLPEFTCKCPFSGYPDFATIHIKYIPNE-RVVELKAIKLYINSYRER
QUEF_TRIV2      NPR-VGRRYDINITLPEFTCKCPFSGYPDFATIYITYVPDE-RVVELKALKLYINSYRDR
QUEF_NOSS1      NPR-VGRRYDINITLPEFTCKCPFSGYPDFATIYITYVPDE-RVVELKALKLYINSYRDR
QUEF_ACAM1      NPR-VGRRYDIHITLPEFTCKCPFSGYPDFATIHLTYVPDQ-RVVELKALKLYINSYRDR
QUEF_MICAN      NPR-PGRNYDIQITLPEYTCKCPFSGYPDFATIYLSYVPDQ-KVMELKAIKLYINSYRDR
QUEF_GLOVI      NPR-PGRDYDIHITLPEFTCKCPFSGYPDFATIYLTYVPHE-KVVELKALKLYVNSFRDR
QUEF_SYNY3      NPR-PGRRYDVHITLPEFTCKCPFSGYPDFATLYLTYCPDQ-KVVELKSIKLYINSYRDR
QUEF_SYNSC      NPR-PGRPYEVSIELPEFTCKCPFSGYPDFAVLRMIYQPGP-RVVELKAIKLYVNSYRDQ
QUEF_SYNPX      NPR-PGRPYEVSIELPEFTCKCPFSSYPDFAVLRLIYQPGP-RVVELKAIKLYVNSYRDQ
QUEF_SYNS9      NPR-PGRAYEVSIELPEFTCKCPFSGYPDFAVLRLIYQPGP-RVVELKAIKLYVNSYRDR
QUEF_PROM3      NPR-PERPYEISIELPEFTCQCPFSGYPDFAVLRLLYQPGP-RVIELKAIKLYVNSYRNC
QUEF_PROMM      NPR-PERPYEISIELPEFTCQCPFSGYPDFAVLRLLYQPGS-RVIELKAIKLYVNSYRNC
QUEF_PROMA      NPS-PNRTYEISIELPEFTCQCPFSGYPDFAIIRLLYQPGE-KVLELKSMKLYVNSFRNR
QUEF_PROMT      NPN-INRDYEISIDFPEFTCKCPFSGYPDFATLKIKYQPNT-KVIELKAIKLYLNSFREK
QUEF_PROMP      NPN-KKRIYEISIELPEFTCKCPFSGYPDFAKLNIYYQPNM-KVYELKSLKLYINKFRDL
QUEF_PROM5      NPN-KKRIYEISIELPEFTCKCPFSGYPDFAKLNIFYQPNS-KVYELKSLKLYINHFRDL
QUEF_PROMS      NPN-KKRIYEISIQLPEFTCKCPFSGYPDFAKLNITYQPNL-KVYELKSLKLYINNFRDI
QUEF_PROM9      NPN-KKRIYEISIQLPEFTCKCPFSGYPDFAKLNIIYQPNL-SVYELKSLKLYINNFRDI
QUEF_PROM0      NPN-KKRIYEISIQLPEFTCKCPFSGYPDFAKLSIIYQPNL-KVYELKSLKLYINSFRDI
QUEF_PROM2      NPN-KKRIYEISIDLPEFTCKCPFSGYPDFAKLNIIYQPNL-RVYELKSLKLYINNFRDI
QUEF_NITSB      N-K-HNKPYKIKITLPEFSCLCPRSGYPDYATMHLEYIPDQ-YVVELKALKLYINSFRNR
QUEF_SULDN      N-E-HKRDYLIKMTLPEFSCLCPRSGYPDYATIYLEYTPNE-RVVELKAIKLYINSFRDR
QUEF_SULNB      N-E-HEKNYTINIELPEFMCLCPRSGYPDFAIMKLSYVPDK-KVIELKALKLYINSFMYR
QUEF_CAMJJ      N-D-AKNDYIIKITLPEFMCCCPRSGYPDFATIYLEYMPDK-FVVELKAIKLYINTFMYR
QUEF_CAMJE      N-D-AKNDYIIKITLPEFMCCCPRSGYPDFATIYLEYMPDK-FVVELKAIKLYINTFMYR
QUEF_CAMJD      N-D-AKNDYIIKITLPEFMCCCPRSGYPDFATIYLEYMPDK-FVIELKAIKLYINTFMYR
QUEF_CAMJR      N-D-AKNDYIIKITLPEFMCCCPRSGYPDFATIYLEYMPNK-FVVELKAIKLYINTFMYR
QUEF_CAMJ8      N-D-AKNDYIIKITLPEFMCCCPRSGYPDFATIYLEYMPDK-FVVELKAIKLYINTFMYR
QUEF_WOLSU      N-R-NDRHYTIKITLPEFSCLCPRSGYPDYATVYIEYVPSS-LVVELKAIKLYINSFRDR
QUEF_AQUAE      NPN-PERDYMIEITFPEFTCLCPRSGYPDFATIKIRYIPDK-YIVELKSLKLWLNKFRNR
QUEF_NEIMF      NKH-PDNDYFVKFVCPEFTSLCPMTGQPDFATIYIRYIPHI-KMVESKSLKLYLFSFRNH
QUEF_NEIMA      NKH-PDNDYFVKFVCPEFTSLCPMTGQPDFATIYIRYIPHI-KMVESKSLKLYLFSFRNH
QUEF_NEIMB      NKH-PDNDYFVKFVCPEFTSLCPMTGQPDFATIYIRYIPHI-KMVESKSLKLYLFSFRNH
QUEF_NEIG1      NKH-PDNDYFVKFVCPEFTSLCPMTGQPDFATIVIRYIPHI-KMVESKSLKLYLFSFRNH
QUEF_STRTD      NRH-ADNDYFIKFNCPEFTSLCPITGQPDFASIYISYIPDQ-LCVESKSLKLYLFSYRNH
QUEF_STRT1      NRH-ADNDYFIKFNCPEFTSLCPITGQPDFASIYISYIPDQ-LCVESKSLKLYLFSYRNH
QUEF_STRT2      NRH-ADNDYFIKFNCPEFTSLCPITGQPDFASIYISYIPDQ-LCVESKSLKLYLFSYRNH
QUEF_STRPN      TRE-IAKEQGIRHHILDMSLLGQITAQPDFATIHISYIPDK-LCVESKSLKLYLFSYRNH
QUEF_STRR6      TRE-IAKEQGIRHHILDMSLLGQITAQPDFATIHISYIPDK-LCVESKSLKLYLFSYRNH
QUEF_STRMU      NRH-QDNDYFIKFNCPEFTSLCPITGQPDFATIYLSYIPDK-KCVESKSLKLYLFSYRNH
QUEF_BACCZ      NNH-PNRDYFVKFNCPEFTSLCPKTGQPDFATIYISYIPEQ-RMVESKSLKLYLFSFRNH
QUEF_BACC1      NNH-PNRDYFVKFNCPEFTSLCPKTGQPDFATIYISYIPEQ-RMVESKSLKLYLFSFRNH
QUEF_BACAN      NNH-PNRDYFVKFNCPEFTSLCPKTGQPDFATIYISYIPEQ-RMVESKSLKLYLFSFRNH
QUEF_BACHK      NNH-PNRDYFVKFNCPEFTSLCPKTGQPDFATIYISYIPEQ-RMVESKSLKLYLFSFRNH
QUEF_BACCR      NNH-PNRDYFVKFNCPEFTSLCPKTGQPDFATIYISYIPEQ-KMVESKSLKLYLFSFRNH
QUEF_BACCN      NNH-PNRDYFVKFNCPEFTSLCPKTGQPDFATIYISYIPEK-KMVESKSLKLYLFSFRNH
QUEF_BACSK      NQH-PYRDYMVKFNCPEFTTLCPKTGQPDFATLYISYIPEQ-KMVESKSLKLYLFSFRNH
QUEF_GEOKA      NKH-PDRDYFVKFNCPEFTTLCPKTGQPDFATIYISYIPDK-KCVESKSLKLYLFSFRNH
QUEF_GEOTN      NKH-PDRDYFVKFNCPEFTSLCPKTRQPDFATIYISYIPDK-KCVESKSLKLYLFSFRNH
QUEF_OCEIH      NKH-VSRDYFVKFNCPEFTTLCPKTNQPDFGTIYISYIPDI-KMVESKSLKLYLFSFRNH
QUEF_BACLD      NKH-ENRDYFVKFNCPEFTSLCPKTGQPDFATIYISYIPDK-KMVESKSLKLYLFSFRNH
QUEF_BACSU      NKH-VNRDYFVKFNCPEFTSLCPKTGQPDFATIYISYIPDE-KMVESKSLKLYLFSFRNH
QUEF_BACP2      NKH-TNRDYFVKFNCPEFTSLCPQTGQPDFATVYISYIPNE-IMVESKSLKLYLFSFRNH
QUEF_BACHD      NKH-QGRDYFVKFNCPEFTTLCPMTGQPDFATVYISYIPDV-KMVESKSLKLYLFSFRNH
QUEF_STAA8      NKH-QGRDYFVKFNCPEFTSLCPITGQPDFATIYISYIPNV-KMVESKSLKLYLFSFRNH
QUEF_STAAE      NKH-QGRDYFVKFNCPEFTSLCPITGQPDFATIYISYIPNV-KMVESKSLKLYLFSFRNH
QUEF_STAAS      NKH-QGRDYFVKFNCPEFTSLCPITGQPDFATIYISYIPNV-KMVESKSLKLYLFSFRNH
QUEF_STAAT      NKH-QGRDYFVKFNCPEFTSLCPITGQPDFATIYISYIPNV-KMVESKSLKLYLFSFRNH
QUEF_STAA9      NKH-QGRDYFVKFNCPEFTSLCPITGQPDFATIYISYIPNV-KMVESKSLKLYLFSFRNH
QUEF_STAAB      NKH-QGRDYFVKFNCPEFTSLCPITGQPDFATIYISYIPNV-KMVESKSLKLYLFSFRNH
QUEF_STAA3      NKH-QGRDYFVKFNCPEFTSLCPITGQPDFATIYISYIPNV-KMVESKSLKLYLFSFRNH
QUEF_STAAW      NKH-QGRDYFVKFNCPEFTSLCPITGQPDFATIYISYIPNV-KMVESKSLKLYLFSFRNH
QUEF_STAAC      NKH-QGRDYFVKFNCPEFTSLCPITGQPDFATIYISYIPNV-KMVESKSLKLYLFSFRNH
QUEF_STAAM      NKH-QGRDYFVKFNCPEFTSLCPITGQPDFATIYISYIPNV-KMVESKSLKLYLFSFRNH
QUEF_STAA2      NKH-QGRDYFVKFNCPEFTSLCPITGQPDFATIYISYIPNV-KMVESKSLKLYLFSFRNH
QUEF_STAAN      NKH-QGRDYFVKFNCPEFTSLCPITGQPDFATIYISYIPNV-KMVESKSLKLYLFSFRNH
QUEF_STAA1      NKH-QGRDYFVKFNCPEFTSLCPITGQPDFATIYISYIPNV-KMVESKSLKLYLFSFRNH
QUEF_STAAR      NKH-QGRDYFVKFNCPEFTSLCPITGQPDFATIYISYIPNV-KMVESKSLKLYLFSFRNH
QUEF_STAES      NKH-QGRDYFVKFNCPEFTSLCPITGQPDFATIYISYIPNI-KMVESKSLKLYLFSFRNH
QUEF_STAEQ      NKH-QGRDYFVKFNCPEFTSLCPITGQPDFATIYISYIPNI-KMVESKSLKLYLFSFRNH
QUEF_STAHJ      NKH-QGRDYFVKFNCPEFTSLCPITGQPDFATIYISYIPNI-KMVESKSLKLYLFSFRNH
QUEF_STAS1      NKH-QGRDYFVKFNCPEFTSLCPITGQPDFATIYISYIPNI-KMVESKSLKLYLFSFRNH
QUEF_BACFN      NKH-PENDYWVRFNCPEFTSLCPITGQPDFAEIRISYLPDV-KMVESKSLKLYLFSFRNH
QUEF_BACFR      NKH-PENDYWVRFNCPEFTSLCPITGQPDFAEIRISYLPDV-KMVESKSLKLYLFSFRNH
QUEF_BACTN      NKH-PENDYWVRFNCPEFTSLCPITGQPDFAEIRISYIPDI-KMVESKSLKLYLFSFRNH
QUEF_PORGI      NKH-QENDYWVRFNCPEFTSLCPITGQPDFATIYINYIPDV-KMVESKSLKLYLFSFRNH
QUEF_HELPH      NPN-PNLDPLITLECKEFTSLCPITSQPDFGVIFIRYIPKD-KMVESKSLKLYLFSYRNH
QUEF_HELPY      NPN-PNLDPLITLECKEFTSLCPITSQPDFGVIFIRYIPKD-KMVESKSLKLYLFSYRNH
QUEF_HELPJ      NPN-PNLDPLITLECKEFTSLCPITSQPDFGVIFIRYIPKD-KMVESKSLKLYLFSYRNH
QUEF_HELAH      NPN-PNLDPLITLECKEFTSLCPITSQPDFGVVYIRYIPKD-KMVESKSLKLYLFSYRNH
QUEF_BDEBA      NKN-PGKIAWTTFVCTEFTSLCPKTRQPDFAKIFINYIADK-KMVESKSLKLYLFSFRNH
QUEF_SYNE7      NPH-PDRQYLVRFVAPEFTSLCPLTGQPDFAHLVLDYVPDQ-RLVESKSLKLFLGSFRNH
QUEF_SYNP6      NPH-PDRQYLVRFVAPEFTSLCPLTGQPDFAHLVLDYVPDQ-RLVESKSLKLFLGSFRNH
QUEF_MAGSA      NPH-PGTLYLVRFTAPEFTSLCPITGQPDFAQLVIDYAPEG-SLVESKSLKLFLGSFRNH
QUEF_BRASB      NPQ-KDTDYLARFTVPEFTSLCPVTGQPDFAHLVIDYAPGP-WLVESKSLKLYLASFRNH
QUEF_BRASO      NPQ-RDTDYLARFTVPEFTSLCPVTGQPDFAHLVIDYAPGP-WLVESKSLKLYLASFRNH
QUEF_RHOPS      NPQ-AGTDYLVRFTAPEFTSLCPVTGQPDFAHLVIDYAPGA-WLVESKSLKLYLASFRNH
QUEF_RHOP2      NPQ-AGTDYLVRFTAPEFTSLCPVTGQPDFAHLVIDYAPGA-WLVESKSLKLYLASFRNH
QUEF_RHOPB      NPQ-ADTDYLVRFTAPEFTSLCPVTGQPDFAHLMIDYAPGA-WLVESKSLKLYLASFRSH
QUEF_RHOPA      NPQ-KDTNFLARFTAPEFTSLCPVTGQPDFAHLVIDYVPGP-WLLESKSLKLYLASFRNH
QUEF_RHOP5      NPQ-RDTDYLARFTAPEFTSLCPVTGQPDFAHLVIDYAPGA-WLLESKSLKLYLASFRSH
QUEF_BRADU      NPQ-KGTDYLVRFTVPEFTSLCPVTGQPDFAHLMIDYAPGP-WLLESKSLKLYIASFRNH
QUEF_NITWN      NPQ-KGTNYVARFTAPEFTALCPVTGQPDFAHLVIDYVPGS-WLLESKSLKLYLASFRNH
QUEF_NITHX      NPQ-KGTNYVARFTAPEFTTLCPVTGQPDFAHLVIDYVPGS-WLLESKSLKLYLASFRNH
QUEF_PARL1      NPH-PDANYVARFTVPEFTSLCPVTGQPDFAHLVIDYVPGK-WLIESKSLKLYLQSFRNH
QUEF_CAUVC      NPQ-SDVLYLARFVAPEFTSLCPVTGQPDFAHLVIDYAPGD-WLIESKSLKLYLTSFRNH
QUEF_CAUSK      NPQ-SDVTYLARFVAPEFTSLCPVTGQPDFAHLVIDYAPGD-WLIESKSLKLYLTSFRSH
QUEF_HYPNA      NPH-SGTLYLTRFVAPEFTSLCPVTGQPDFAHLVIDYAPGP-WLVESKSLKLYLTSFRNH
QUEF_ZYMMO      NPR-QGKNYLIRFAIPEFTSLCPVTGQPDFAHLVIDYVPDK-LIVESKSLKLFLGSFRNH
QUEF_NOVAD      NPR-PGALYMIRFAAPEFTSLCPVTGQPDFAHLVIDYAPGE-CIVESKALKLFLGSFRNH
QUEF_CHESB      FSRGDGPAAIVRFTCPEFTSLCPVTGQPDFAHIVIDYAPDK-LLVESKSLKLFLTSFRNH
QUEF_RHILO      FSRGDGPPAIVRFTCPEFTSLCPVTGQPDFAHIVIDYAPDA-ALVESKSLKLFMTSFRNH
QUEF_GLUOX      SPH-QGRQYVVRFTAPEFTSLCPVTGQPDFAHIVIDYIPGE-WIVESKSLKLFLTSFRNH
QUEF_GRABC      NPT-PGKAYMIRFTAPEFTSLCPLTGQPDFAHIVLDYVPRD-WIVESKSLKLFLTSFRNV
QUEF_RHIL3      SNH-AGTDYVVRFTAPEFTSLCPMTGQPDFAHIVIDYIPGE-WLVESKSLKLFLHSFRNH
QUEF_RHIEC      SNH-AGTDYVVRFTAPEFTSLCPMTGQPDFAHIVIDYIPGE-WLVESKSLKLFLHSFRNH
QUEF_AGRFC      NGN-AGTDYVVRFTAPEFTSLCPMTGQPDFAHIVIDYIPGD-FLVESKSLKLFLQSFRNH
QUEF_RHIME      SGH-GGTDFVVRFTAPEFTSLCPMTGQPDFAHIVIDYVPDG-WLVESKSLKLFLHSFRNH
QUEF_SINMW      SGH-GGTDFVVRFTAPEFTSLCPMTGQPDFAHLVIDYVPDG-WLVESKSLKLFLHSFRNH
QUEF_BRUO2      NPQ-EGTPYCVRFTAPEFTSLCPMTGQPDFAHLVIDYVPGK-WLVESKSLKLFLFSFRNH
QUEF_BRUSI      NPQ-EGTPYCVRFTAPEFTSLCPMTGQPDFAHLVIDYVPGK-WLVESKSLKLFLFSFRNH
QUEF_BRUSU      NPQ-EGTPYCVRFTAPEFTSLCPMTGQPDFAHLVIDYVPGK-WLVESKSLKLFLFSFRNH
QUEF_BRUC2      NPQ-EGTPYCVRFTAPEFTSLCPMTGQPDFAHLVIDYVPGK-WLVESKSLKLFLFSFRNH
QUEF_BRUAB      NPQ-EGTPYCVRFTAPEFSSLCPMTGQPDFAHLVIDYVPGK-WLVESKSLKLFLFSFRNH
QUEF_BRUA2      NPQ-EGTPYCVRFTAPEFSSLCPMTGQPDFAHLVIDYVPGK-WLVESKSLKLFLFSFRNH
QUEF_BRUME      NPQ-EGTPYCVRFTAPEFSSLCPMTGQPDFAHLVIDYVPGK-WLVESKSLKLFLFSFRNH
QUEF_OCHA4      NPQ-AGTPYCVRFTAPEFTSLCPMTGQPDFAHLVIDYVPGQ-WLVESKSLKLFLFSFRNH
QUEF_RUEST      NPQ-ADVAYNVRFTAPEFTSLCPMTGQPDFAHLVIDYVPGP-WLVESKSLKLFLTSFRNH
QUEF_PARDP      NPQ-ADVAYNVRFTAPEFTSLCPMTGQPDFAHLVIDYVPGE-WLVESKSLKLYLGSFRNH
QUEF_RUEPO      NPQ-AGTDYAVRFTAPEFTSLCPLTAQPDFAHIVIDYVPGD-WLVESKSLKLYLGSFRNH
QUEF_ACICJ      APS-RGKNYVVRFTCPEFTSLCPITGQPDFAHVVIDYIPDS-WIVESKSLKLYLGSFRNH
QUEF_MARMM      NPC-DAP-YMTRFVCPEFTSLCPVTGAPDFAHLVIDYVPRD-WIVESKSLKLYLGSFRNH
QUEF_LEPIN      NVY-EGKDYTIDFTVPEFTAVCPKTGLPDFGVILVSYIPNK-RCIELKSFKEYILSYRNV
QUEF_LEPIC      NVY-EGKDYTIDFTVPEFTAVCPKTGLPDFGVILVSYIPNK-RCIELKSFKEYILSYRNV
QUEF_LEPBL      NVY-EGKDYTIDFTVPEFTAVCPKTGLPDFGVIYVSYVPTK-RCIELKSFKEYILSYRNV
QUEF_LEPBJ      NVY-EGKDYTIDFTVPEFTAVCPKTGLPDFGVIYVSYVPTK-RCIELKSFKEYILSYRNV
QUEF_METCA      NPR-PDHDYTIRIEIPEFTCLCPKTGQPDFATILLEYVPDR-QCIELKSLKMYIWSFRDE
QUEF_NITOC      NPL-PERDYTIRIRIPEFTCLCPKTGQPDFATLQLEYVPDQ-ACVELKSLKLYIWSYRDQ
QUEF_HALHL      NPN-PERDYTIRMEIPEFTCLCPKTGQPDFATLNLEYIPER-HCVELKSLKLYIWSYRDV
QUEF_THIDA      NPK-PGRDFHIHMEVPEFTCLCPKTGQPDFATLVLDYIPNQ-ACVELKSLKLYMWSFRDE
QUEF_METFK      NPT-PGRDFHIHMEIPEFTCLCPKTGQPDFAVLYLDYIPDQ-KCVELKSLKLYIWSFRDE
QUEF_NITEU      NPV-QTRDYRIHMEIPEFTCLCPKTGQPDFARLTLDYIPDK-KCIELKSLKLYIWSYRDE
QUEF_NITEC      NPI-QTRDYRIHMEIPEFTCLCPKTGQPDFARLTLDYIPDK-KCIELKSLKLYIWSYRNE
QUEF_NITMU      NPT-QERDYHIHMEIPEFTCLCPKTGQPDFATLILDYIPDK-KCVELKSLKLYIWSFRDE
QUEF_ALKEH      NPR-PERDFVLHMRIPEFTCLCPKTGQPDFATIHLDYVPDE-RCVELKSLKLYMWSFRDQ
QUEF_RUTMC      NPK-IERDFIIQINMPEFTCLCPKTGQPDFATLHFAYIADK-ACIELKSLKMYIWLYRNE
QUEF_VESOH      NPN-IERNFIIQINMPEFTCLCPKTGQPDFATLYLEYIADK-VCIELKSLKMYIWSYRSK
QUEF_ANADE      NPK-PGRPFEIAMECPEFTCVCPMTGQPDFATIRLRYVPAE-RCVELKSLKLYLWSFRDE
QUEF_ANADF      NPK-PDRPYEIAMECPEFTCVCPVTGQPDFATIRLRYVPAE-RCVELKSLKLYLWSFRDE
QUEF_SYNAS      NRH-PDRDYIVTMETAEFTCVCPMTGQPDFADLHISYIPDA-SILESKSLKLYLWSYRNE
QUEF_FRACC      -PI-DDTSQEIRIDCREFTCRCPITGQPDWATIRIDYRPGG-RGLETKSLKLYLETFREE
QUEF_PELLD      NTY-PDRDYTIEIVNPEFTSVCPKTGLPDFGTITVSYIPDK-TCIELKSLKYYFLEFRNA
QUEF_CHLPM      NTY-PDRNYTIEIVNPEFTSVCPKTGLPDFGTITVHYVPDR-TCVELKSLKYYFLEFRNA
QUEF_CHLTE      NTY-PDRDYTIEIINPEFTSVCPKTGLPDFGTITVNYVPDK-SCIELKSLKYYFLEFRNA
QUEF_CHLPD      NTF-PGRDYTIEIVNPEFTSVCPITALPDFGTIIIRYIPDK-SCVELKSLKYYFLEFRNA
QUEF_CHLCH      NKY-PNRDYTIEIVNPEFTSVCPITGLPDFGTITIRYVPNQ-RCVELKSLKYYFFEFRNA
QUEF_RHOBA      NPA-PTRNFTIEHHCPEFTSVCPKTGQPDYGTIVFTYVPDR-VCVELKSLKMYLQKFRNE
QUEF_DESVH      NRF-PDRPYIVSIAFPEFTSLCPVTGQPDFATIVVEYIPDQ-FCVESKSFKVYMFAFRDH
QUEF_DESVV      NRF-PDRPYIVSIAFPEFTSLCPVTGQPDFATIVVEYIPDQ-FCVESKSFKVYMFAFRDH
QUEF_THEP1      DFDG--KDEYIKIETDEFSAVCPFSGLPDIGRVIIEYYPDGGKIVELKSLKYYFVSFRNV
QUEF_THEMA      DFDG--KDEYIKIETDEFSAVCPFSGLPDIGRVIIEYYPDGGKIVELKSLKYYFVSFRNV
QUEF_CALS4      EYEYPEKNTIVEYITDEFSSVCPWTGLPDNAKLTIRYIPHK-KLVELKSLKYYLTSYRNV
                                :       :  ** . : . * .      * *::* :.  :   

QUEF_THEEB      YISHEEAVNQVLDDLVAACDPLYMKIKGDFAPRGNVHTVITVEHHRQTESLC--------
QUEF_TRIEI      YISHEESVNQILDDFVAACDPLEVKIKGDFLPRGNVHTTIEVEHYKAS------------
QUEF_TRIV2      YISHEESANQILDDFVAACDPLEATVKADFTPRGNVHTVVEVKHRK--------------
QUEF_NOSS1      YISHEESANQILDDFVAACDPLEANVKADFTPRGNVHTVVEVRHTK--------------
QUEF_ACAM1      YISHEESVNQILDDIVAACDPLEITVKGDFLPRGNVHTVIEVHHQK--------------
QUEF_MICAN      YISHEEAINQILDDLVAACEPLQMKVKGDFHPRGNVHTVVEVMYKKE-------------
QUEF_GLOVI      YISHEEVVHVVLDDFVAAADPLRVQIKGDFNPRGNVHMVVEARHTRPGT-----------
QUEF_SYNY3      HIPHEEVTNQILDDFVAVANPLYARLKADFNPRGNVHTVIEVEYHQEKAS----------
QUEF_SYNSC      SISHEEVTNRILDDLVAATDPVWMQLEADFNPRGNVHTVVRVSHGTRQPC----------
QUEF_SYNPX      SISHEEVTNRILDDLVAATDPVWMQLEADFNPRGNVHTVVRVSHGTRQPC----------
QUEF_SYNS9      SISHEEVSNRIVDDLVAACDPVWLQLEADFNPRGNVHTVVRVSHGTRQPC----------
QUEF_PROM3      SISHEEAANKILDDLVVACDPVWMQLEADFNPRGNVHTVVRVSHGSRQPC----------
QUEF_PROMM      TISHEEAANKILDDLVVACNPVWMQLEADFNPRGNVHTVVRVSHGSRQPC----------
QUEF_PROMA      KISHEEVANKMLDDFVAAANPSWMQLEADFNPRGNVHTVVRVSHGLKNNC----------
QUEF_PROMT      KISHEEVTNKIIDDFVEVSDPKWMQLEADFNPRGNVHTIIRVCHGKRNNLELSL------
QUEF_PROMP      KISHEEVVNRIMDDLLKAAVPHWIHLNADFNPRGNVSMKLDIYSGQKRN-----------
QUEF_PROM5      KISHEEVVNRIMDDLLNAAAPHWIHLNADFNPRGNVSMKLDIYSGQKRN-----------
QUEF_PROMS      KISHEEVVNRIMDDLVNEGLPHWIHLNAAFNPRGNVSMQLDIFSGQKRN-----------
QUEF_PROM9      KISHEEVVNRIMDDLVNEGSPHWIHLNAAFNPRGNVSMQLDIFSGQKRN-----------
QUEF_PROM0      KISHEEVVNRIMDDLVNEGSPHWIHLNAAFNPRGNVSMQLDIFSGQKKN-----------
QUEF_PROM2      KISHEEVVNRIMDDLLSAGSPHWIHLNASFNPRGNVSMQLDIFSGQKKN-----------
QUEF_NITSB      YISHEDSTNEIFDTLYSKLKPKYMRLVADFNPRGNVHTLIEIDSEEIEKVSNG-------
QUEF_SULDN      HISHENSANEIYTVLERKLKPKYMKIVADYNPRGNVHTVIEIDSSKL-------------
QUEF_SULNB      HISHENSANEIFDALYSQLEPKSMKLIADFNPRGNVHTVIEIDSETF-------------
QUEF_CAMJJ      NVSHEASINEIYNTLKDKLKPKWIKVVGDFNPRGNVHTVIECRSDMVVPK----------
QUEF_CAMJE      NVSHEASINEIYNTLKDKLKPKWIKVVGDFNPRGNVHTVIECRSDMVVPK----------
QUEF_CAMJD      NVSHEASINEIYNTLKDKLKPKWIKVVGDFNPRGNVHTVIECRSDMVVP-----------
QUEF_CAMJR      NVSHEASINEIYNTLKDKLKPKWIKVVGDFNPRGNVHTVIECRSDMVVPK----------
QUEF_CAMJ8      NVSHEASINEIYNTLKDKLKPKWIKVVGDFNPRGNVHTVIECCSDMVVPK----------
QUEF_WOLSU      HVSHEDSANEIYDLLYKKLSPKELYLKMDFNPRGNVHTIIEIDSKKN-------------
QUEF_AQUAE      YISHEAATNEIYQALYDLLKPRFLEVVGDFHPRGNVHTVVRVRSDENYG-----------
QUEF_NEIMF      GDFHEDCVNIIMKDLIALMDPKYIEVFGEFTPRGGIAIHPFANYGKAGTEFETLARKRLF
QUEF_NEIMA      GDFHEDCVNIIMKDLIALMDPKYIEVFGEFTPRGGIAIHPFANYGKAGTEFEALARKRLF
QUEF_NEIMB      GDFHEDCVNIIMKDLIALMDPKYIEVFGEFTPRGGIAIHPFANYGKAGTEFETLARKRLF
QUEF_NEIG1      GDFHEDCVNIIMKDLIALMDPKYIEVFGEFTPRGGIAVHPFANYGKAGTEFEALARKRLF
QUEF_STRTD      GDFHENCINTIGKDLVELLNPRYLEVWGKFTPRGGISIDPYYNYGRPKTKYENMAEQRLF
QUEF_STRT1      GDFHENCINTIGKDLVELLNPRYLEVWGKFTPRGGISIDPYYNYGRPKTKYENMAEQRLF
QUEF_STRT2      GDFHENCINTIGKDLVELLNPRYLEVWGKFTPRGGISIDPYYNYGRPKTKYENMAEQRLF
QUEF_STRPN      GDFHENCINTIGKDLVNLLDPRYLEVWGKFTPRGGISIDPYYNYGKQGTKYEGLAEQRLF
QUEF_STRR6      GDFHENCINTIGKDLVNLLDPRYLEVWGKFTPRGGISIDPYYNYGKQGTKYEGLAEQRLF
QUEF_STRMU      GDFHENCINTIGKDLVDLLQPRYLEVWGKFTPRGGISIDPYYNYGRPNTKYEEMAAYRLM
QUEF_BACCZ      GDFHEDCMNVIMNDLIKLMDPRYIEVWGKFTPRGGISIDPYCNYGRPGTKYEQMADYRMM
QUEF_BACC1      GDFHEDCMNVIMNDLIKLMDPRYIEVWGKFTPRGGISIDPYCNYGRPGTKYEQMADYRMM
QUEF_BACAN      GDFHEDCMNVIMNDLIKLMDPRYIEVWGKFTPRGGISIDPYCNYGRPGTKYEQMADYRMM
QUEF_BACHK      GDFHEDCMNVIMNDLIKLMDPRYIEVWGKFTPRGGISIDPYCNYGRPGTKYEQMADYRMM
QUEF_BACCR      GDFHEDCMNVIMNDLIKLMDPRYIEVWGKFTPRGGISIDPYCNYGRPGTKYEQMADYRMM
QUEF_BACCN      GDFHEDCMNVIMNDLIELMDPRYIEVWGKFTPRGGISIDPYCNYGRPGTKYEKMAEYRMM
QUEF_BACSK      GDFHEDSVNTIMNDLIELMDPRYIEVWGKFTPRGGISIDPYCNYGKKGTKYEEIANYRLM
QUEF_GEOKA      GDFHEDCVNIIMNDLIKVMEPRYIEVWGKFTPRGGISIDPYCNWGRPGTKYEKMAEYRLL
QUEF_GEOTN      GDFHEDCVNIIMNDLINVMEPRYIEVWGKFTPRGGISIDPYCNWGRPGTKYEKMAEYRLL
QUEF_OCEIH      GDFHEDCINIIMNDLIDLMNPRYIEVRGKFTPRGGISIDPYCNYGRPGTKFEQMADQRLI
QUEF_BACLD      GDFHEDCMNIIMNDLIELMDPRYIEVWGKFTPRGGISIDPYTNYGKPGTKYEKMAEYRMM
QUEF_BACSU      GDFHEDCMNIIMNDLIELMDPRYIEVWGKFTPRGGISIDPYTNYGKPGTKYEKMAEYRMM
QUEF_BACP2      GDFHEDCMNIIMNDLIELMDPRYIEVWGKFTPRGGISIDPYTNYGKPGTKYEEMASYRMM
QUEF_BACHD      GDFHEDAMNIIMNDLIKLMDPRYIEVWGKFTPRGGISIDPYTNYGRPGTKYEKMAEYRMM
QUEF_STAA8      GDFHEDCMNIIMNDLIELMDPHYIEVWGKFTPRGGISIDPYTNYGRPNSKYEKMAEHRLM
QUEF_STAAE      GDFHEDCMNIIMNDLIELMDPHYIEVWGKFTPRGGISIDPYTNYGRPNSKYEKMAEHRLM
QUEF_STAAS      GDFHEDCMNIIMNDLIELMDPHYIEVWGKFTPRGGISIDPYTNYGRPNSKYEKMAEHRLM
QUEF_STAAT      GDFHEDCMNIIMNDLIELMDPHYIEVWGKFTPRGGISIDPYTNYGRPNSKYEKMAEHRLM
QUEF_STAA9      GDFHEDCMNIIMNDLIELMDPHYIEVWGKFTPRGGISIDPYTNYGRPNSKYEKMAEHRLM
QUEF_STAAB      GDFHEDCMNIIMNDLIELMDPHYIEVWGKFTPRGGISIDPYTNYGRPNSKYEKMAEHRLM
QUEF_STAA3      GDFHEDCMNIIMNDLIELMDPHYIEVWGKFTPRGGISIDPYTNYGRPNSKYEKMAEHRLM
QUEF_STAAW      GDFHEDCMNIIMNDLIELMDPHYIEVWGKFTPRGGISIDPYTNYGRPNSKYEKMAEHRLM
QUEF_STAAC      GDFHEDCMNIIMNDLIELMDPHYIEVWGKFTPRGGISIDPYTNYGRPNSKYEKMAEHRLM
QUEF_STAAM      GDFHEDCMNIIMNDLIELMDPHYIEVWGKFTPRGGISIDPYTNYGRPNSKYEKMAEHRLM
QUEF_STAA2      GDFHEDCMNIIMNDLIELMDPHYIEVWGKFTPRGGISIDPYTNYGRPNSKYEKMAEHRLM
QUEF_STAAN      GDFHEDCMNIIMNDLIELMDPHYIEVWGKFTPRGGISIDPYTNYGRPNSKYEKMAEHRLM
QUEF_STAA1      GDFHEDCMNIIMNDLIELMDPHYIEVWGKFTPRGGISIDPYTNYGRPNSKYEKMAEHRLM
QUEF_STAAR      GDFHEDCMNIIMNDLIELMDPHYIEVWGKFTPRGGISIDPYTNYGRPNSKYEQMAEHRLM
QUEF_STAES      GDFHEDCMNIIMNDLINLMDPHYIEVWGKFTPRGGISIDPYTNYGRPDTKYEKMAEHRLM
QUEF_STAEQ      GDFHEDCMNIIMNDLINLMDPHYIEVWGKFTPRGGISIDPYTNYGRPDTKYEKMAEHRLM
QUEF_STAHJ      GDFHEDCMNIIMNDLIDLMDPHYIEVWGKFTPRGGISIDPYTNYGRPNSKYEKMAEHRLM
QUEF_STAS1      GDFHEDCMNIIMNDLIELMDPHYIEVWGKFTPRGGISIDPYTNYGRPDSKYEKMAEHRLM
QUEF_BACFN      GAFHEDCVNIIMKDLIRLMDPKYIEVTGIFTPRGGISIYPYANYGRPGTKYEEMAIHRLM
QUEF_BACFR      GAFHEDCVNIIMKDLIRLMDPKYIEVTGIFTPRGGISIYPYANYGRPGTKYEEMATHRLM
QUEF_BACTN      GAFHEDCVNIIMKDLIKLMNPKYIEVTGIFTPRGGISIYPYANYGRPGTKFEQMAEHRLM
QUEF_PORGI      GAFHEDCVNIIMKDLIALMQPRYIEVWGDFTPRGGISIVPFCNYGKPGSRYELLAEKRME
QUEF_HELPH      GSFHESCINTILLDLVKLLEPKYLEVYGDFASRGGIAIKPFVNYAIKE--YQEFKEKRLL
QUEF_HELPY      GSFHESCINTILLDLVRLLEPKYLEVYGDFASRGGIAIKPFVNYAIKE--YQDFKEKRLL
QUEF_HELPJ      GSFHESCINTILLDLVQLLEPKYLEVYGDFVSRGGIAIKPFVNYAIKE--YQDFKEKRLL
QUEF_HELAH      GSFHESCINTILLDLVGLLEPKYLEVYGDFVSRGGIAIKPFVNYAIKE--YQDFKEKRLL
QUEF_BDEBA      GDFHEDCVQTICDDLVKLMKPKYIEVIGEFTPRGGIAIYPYANYAAKDKFFQELYKKRMS
QUEF_SYNE7      GAFHENCTLTIAKRLEEAMNPTWLRLGGYWYPRGGLPIDVFYQSGEPP-AGVWVPEQGVA
QUEF_SYNP6      GAFHENCTLTIAKRLEEAMNPTWLRLGGYWYPRGGLPIDVFYQSGEPP-AGVWVPEQGVA
QUEF_MAGSA      GAFHEDCTIAIAKRLVAACAPKWLRIGGYWYPRGGIPIDVFWQTGPAP-EGLWLPDQGVA
QUEF_BRASB      GAFHEDCTVAIGKRLATELKPKWLRIGGYWYPRGGIPIDVFWQTGKLP-KGLWVPDQGVA
QUEF_BRASO      GAFHEDCTVAIGKRLTAEIKPKWLRIGGYWYPRGGIPIDVFWQTGRLP-KGLWVPDQGVA
QUEF_RHOPS      GGFHEDCTVSIGKRIAAEIKPKWLRIGGYWYPRGGIPIDVFWQTGKLP-KGMWVPDQGVA
QUEF_RHOP2      GGFHEDCTVSIGKRIAAEIKPKWLRIGGYWYPRGGIPIDVFWQTGKLP-KNVWVPDQGVA
QUEF_RHOPB      GAFHEDCTVAIGKRIAQEIKPKWLRIGGYWYPRGGIPIDVFWQTGKLP-KGVWVPEQGVA
QUEF_RHOPA      GAFHEDCTVAIGKRIATEIKPKWLRIGGYWYPRGGIPIDVFWQTGKLP-KDVWVPDQGVQ
QUEF_RHOP5      GAFHEDCTVGIGKRIAAEIKPKWLRIGGYWYPRGGIPIDVFWQTGKLP-KGLWVPDQGVR
QUEF_BRADU      GAFHEDCTVMIGKRIASEIKPKWLRIGGYWYPRGGIPIDVFWQTGRVP-KGLWVPEQGVA
QUEF_NITWN      GAFHEDCTVAIGKRIVAAIKPKWLRIGGYWFPRGGIPIDVFWQTGAAP-RGVWIPDQDVP
QUEF_NITHX      GAFHEDCTVAIGKRIATAVRPKWLRIGGYWYPRGGIPIDVFWQTGTVP-KGVWIPDQSVP
QUEF_PARL1      GAFHEDCTLAIGKRLAGTLAPKWLRIGGYWYPRGGIPIDVFWQKGKLP-AGVWVPDQGVA
QUEF_CAUVC      GSFHEDCTVKVARKIVEIAQPRWLRIGGYWYPRGGIPIDVFWQTGPAP-EGLWVPDQGVA
QUEF_CAUSK      GSFHEDCTVKIGRKIVEIAQPRWLRIGGYWYPRGGIPIDVFWQTGPAP-EGLWVPDQGVA
QUEF_HYPNA      GAFHEECTVSIGKKIFDFTEATWLRISGYWYPRGGIPIDVFWQSGDVP-KGLYVPDTGVA
QUEF_ZYMMO      RAFHEDCTVGIGEKLFTEMKAQWLRIGGYWYPRGGIPIDVFWQSGAAP-QDVWLPEQGVP
QUEF_NOVAD      AGFHEDVTVGIGQRLFDEMKPQWLRIGGYWYPRGGIPIDVFWQSGPPP-AGLWLPDQGVA
QUEF_CHESB      GAFHEDCTVMIGRRIVEATKPLWLRIGGYWYPRGGIPIDVFWQTGTPP-KDAWVPETGVP
QUEF_RHILO      GAFHEDCTVMIGRRIVAATKPLWLRIGGYWYPRGGIPIDVFWQTGAPP-EGAWLPDTGVA
QUEF_GLUOX      GAFHEDCSIAIAERLVALLDPQWLRIGAYWYPRGGIPIDVFWQTGEPP-KGVWIPAQDVP
QUEF_GRABC      GSFHEACSMKIAERVVSLLDPVWLRIGAYWYPRGGIPIDVFWQTGSPP-DGVWIPAQDVP
QUEF_RHIL3      GAFHEDCSIYIAKRIVELLDPRWLRIGAYWYPRGGIPIDVFWQTGKPP-EGVWLPEQGVA
QUEF_RHIEC      GAFHEDCSIYIAKRIVELLDPKWLRIGAYWYPRGGIPIDVFWQTGKPP-EGVWLPEQGVA
QUEF_AGRFC      GAFHEDCSVYIAKRLVELLQPKWLRIGAYWYPRGGIPIDVFWQTGAAP-EGVWLPDQGVA
QUEF_RHIME      GAFHEDCTIEIAKRLVSLLSPKWLRIGAYWYPRGGIPIDVFWQTGNPP-EGVWLPDQGVP
QUEF_SINMW      GAFHEDCTIDIAKRLVSLLSPKWLRIGAYWYPRGGIPIDVFWQTGSPP-EGVWLPDQGVP
QUEF_BRUO2      GAFHEDCTVTIGKRLVDLLEPEWLRIGGYWYPRGGIPIDVFYQTGAAP-LNVWIPEQGVA
QUEF_BRUSI      GAFHEDCTVTIGKRLVDLLEPEWLRIGGYWYPRGGIPIDVFYQTGAAP-LNVWIPEQGVA
QUEF_BRUSU      GAFHEDCTVTIGKRLVDLLEPEWLRIGGYWYPRGGIPIDVFYQTGAAP-LNVWIPEQGVA
QUEF_BRUC2      GAFHEDCTVTIGKRLVDLLEPEWLRIGGYWYPRGGIPIDVFYQTGAAP-LNVWIPEQGVA
QUEF_BRUAB      GAFHEDCTVTIGKRLVDLLEPEWLRIGGYWYPRGGIPIDVFYQTGAAP-LNVWIPEQGVA
QUEF_BRUA2      GAFHEDCTVTIGKRLVDLLEPEWLRIGGYWYPRGGIPIDVFYQTGAAP-LNVWIPEQGVA
QUEF_BRUME      GAFHEDCTVTIGKRLVDLLEPEWLRIGGYWYPRGGIPIDVFYQTGAAP-LNVWIPEQGVA
QUEF_OCHA4      GAFHEDCTVTIGKRLVELLEPEWLRIGGYWYPRGGIPIDVFFQTGAAP-QNVWIPEQGVP
QUEF_RUEST      GAFHEDCTISIARRLVDFLDPQWLRIGGYWYPRGGIPIDVFWQSGTIP-EGVWIPDQGVP
QUEF_PARDP      GAFHEDCTVSIGRRLAGFLAPRWLRIGGYWYPRGGMPIDVFWQTGPMP-EGVWIPDQDVP
QUEF_RUEPO      GAFHEDCSVSIGKRLVELLAPKWLRVGAYWYPRGGIPIDVFYQTGPEL-PGVWIPDQGVP
QUEF_ACICJ      GAFHEACTLMIAERLVDLLAPRWLRIGAYWYPRGGIPIDVFWQTGAPP-EGAYLPDQGVP
QUEF_MARMM      GAFHEACTTGIGQRLVKELDPVWLRIGGYWYPRGGIPIDVFFATGEPP-KGVWIPDQDVP
QUEF_LEPIN      GIFHEFLVNKILEDVIKSIDPKYLKVIGDYNARGGIKTIVTREYKKP-------------
QUEF_LEPIC      GIFHEFLVNKILEDVIKSIDPKYLKVIGDYNARGGIKTIVTREYKKP-------------
QUEF_LEPBL      GVFHEFLVNKIMEDLIAAIDPKYLKVIGDYNARGGIKTVVTREYNKI-------------
QUEF_LEPBJ      GVFHEFLVNKIMEDLIAAIDPKYLKVIGDYNARGGIKTVVTREYNKI-------------
QUEF_METCA      GAFHEAVTNTILDDLVTVSRPRFMRVTARFNVRGGIYTTVVAERRAPDWEPTTPVALP--
QUEF_NITOC      GAFHEAVTNQILDDLTAVCKPRFMRLTAEFNVRGGIYTTVAAEYRQPGWDAPKIVRLP--
QUEF_HALHL      GGFHEALTNQILGDLVAATQPRYMKLTAHFNVRGGIWTTVEAEHHGR-------------
QUEF_THIDA      GHFHEDVTNRILDDLVAATDPRYMRLTAKFYVRGGIFTNVVAEHRKDGWQPAPRVDLTQF
QUEF_METFK      GCFHEAVTNQILDDLVVATDPKFMRLTAKFYVRGGIFTNVVAEHRKPGWQPQPRVELAEF
QUEF_NITEU      GAFHEAVTNRILDDLVAAMKPRFIRLTSKFYVRGGIFTNVVAEHRKKGWQPQPPVLLEVF
QUEF_NITEC      GTFHEAVTNQILDDLVIAMKPRFIRLTSKFYVRGGIFTNVVAEHRKKGWHPQPPVFLESF
QUEF_NITMU      NAFHEAVTNRIVDDLATALQPRYLRLTAKFYVRGGIFTTVVAEHRHSGWTPLPSVDLFHF
QUEF_ALKEH      GAFHEAITNEILDDLVRATEPRYMKVTAEFYVRGGIYTTVVAEHRKPGWAPAPKVELA--
QUEF_RUTMC      GAFHEAVTNQILDDLVQVSNPRFIRLKAIFNIRGGVYTTIITEHKQKNWTPKAKVDL---
QUEF_VESOH      GEFHEAVTNKILDDLIQISNPRFMRLKAIFNVRGGIYTTIIAEYQQKNWTFKTKIDLQYQ
QUEF_ANADE      GTFHEAVTNRICDDLVAALAPRWIEVVGDFAVRGGIHTVVTARHGER----PAGV-----
QUEF_ANADF      GTFHEAVTNRICDDIVQAIAPRWIEVVGDFAVRGGIHTVVTARHGER----PAGV-----
QUEF_SYNAS      GIFHEHVTNVILEDVVAALSPRWCKVTANFGVRGGISITVEAEYKKPGWSKP--------
QUEF_FRACC      GIFHEHLATLIRDDLVAALAPVQLTVTVNFNARGGIALAASSTYRREA------------
QUEF_PELLD      GIFYENVTNRILDDLVAVSSPRSMTVRTEWKARGGITETVTVSHNASA------------
QUEF_CHLPM      GIFYENITNRILDDLVAAMQPRSITVTTKWKARGGITETVTASHTAQG------------
QUEF_CHLTE      GIFYENITNRILDDLVEACQPRRMTVKTEWNARGGITETVTVSYSKSKE-----------
QUEF_CHLPD      GIFYENITNTILDDLTSVLQPREMTVITQWKARGGITETVSVTWPQKQ------------
QUEF_CHLCH      GIFYENITNKVLDDMVALLEPRSISVITEWKARGGITETVSVHYTSQS------------
QUEF_RHOBA      GIFYEQVTNRILDDFVAVVQPRKVTVESKWTPRGGLNSNIIVTYPDEA------------
QUEF_DESVH      QSFMETITNTILDDMTTKLQPLWCRVKGLFTPRGGTQLHVFAERFKEVEPARAQALRDMV
QUEF_DESVV      QSFMETITNTILDDMTTKLQPLWCRVKGLFTPRGGTQLHVFAERFKEVEPARAQALRDMV
QUEF_THEP1      GIYQEEATKRIYEDLKNLLKTDRIRVTVIYNIRGGIKTTTQMGSLEGKKSGEVE------
QUEF_THEMA      GIYQEEATKRIYEDLKNLLKTDRIRVTVIYNIRGGIKTTTQMGSLEGKKSGEVE------
QUEF_CALS4      GILQEHAINRILDDLVEFLQPKFMEIIGEFQERGGIATRI-IARYEKEEY----------
                    *     :   .     .    :   :  **.                         

QUEF_THEEB      ---------------
QUEF_TRIEI      ---------------
QUEF_TRIV2      ---------------
QUEF_NOSS1      ---------------
QUEF_ACAM1      ---------------
QUEF_MICAN      ---------------
QUEF_GLOVI      ---------------
QUEF_SYNY3      ---------------
QUEF_SYNSC      ---------------
QUEF_SYNPX      ---------------
QUEF_SYNS9      ---------------
QUEF_PROM3      ---------------
QUEF_PROMM      ---------------
QUEF_PROMA      ---------------
QUEF_PROMT      ---------------
QUEF_PROMP      ---------------
QUEF_PROM5      ---------------
QUEF_PROMS      ---------------
QUEF_PROM9      ---------------
QUEF_PROM0      ---------------
QUEF_PROM2      ---------------
QUEF_NITSB      ---------------
QUEF_SULDN      ---------------
QUEF_SULNB      ---------------
QUEF_CAMJJ      ---------------
QUEF_CAMJE      ---------------
QUEF_CAMJD      ---------------
QUEF_CAMJR      ---------------
QUEF_CAMJ8      ---------------
QUEF_WOLSU      ---------------
QUEF_AQUAE      ---------------
QUEF_NEIMF      EHDSQ----------
QUEF_NEIMA      EHDAQ----------
QUEF_NEIMB      EHDAQ----------
QUEF_NEIG1      EHDAQ----------
QUEF_STRTD      NHDLYPENIDNR---
QUEF_STRT1      NHDLYPENIDNR---
QUEF_STRT2      NHDLYPENIDNR---
QUEF_STRPN      QHDLYPEKIDNR---
QUEF_STRR6      QHDLYPEKIDNR---
QUEF_STRMU      NHDLYPETIDNR---
QUEF_BACCZ      NHDLYPETIDNR---
QUEF_BACC1      NHDLYPETIDNR---
QUEF_BACAN      NHDLYPETIDNR---
QUEF_BACHK      NHDLYPETIDNR---
QUEF_BACCR      NHDLYPETIDNR---
QUEF_BACCN      NHDLYPETVDNR---
QUEF_BACSK      NHDLYPETITNR---
QUEF_GEOKA      NHDLYPEKVDNR---
QUEF_GEOTN      NHDLYPEKIDNR---
QUEF_OCEIH      QHDMYPEKIDNR---
QUEF_BACLD      NHDLYPETIDNR---
QUEF_BACSU      NHDLYPETIDNR---
QUEF_BACP2      NHDMYPETIDNR---
QUEF_BACHD      NHDLYPETVDNR---
QUEF_STAA8      NHDLYPEKIDNR---
QUEF_STAAE      NHDLYPEKIDNR---
QUEF_STAAS      NHDLYPEKIDNR---
QUEF_STAAT      NHDLYPEKIDNR---
QUEF_STAA9      NHDLYPEKIDNR---
QUEF_STAAB      NHDLYPEKIDNR---
QUEF_STAA3      NHDLYPEKIDNR---
QUEF_STAAW      NHDLYPEKIDNR---
QUEF_STAAC      NHDLYPEKIDNR---
QUEF_STAAM      NHDLYPEKIDNR---
QUEF_STAA2      NHDLYPEKIDNR---
QUEF_STAAN      NHDLYPEKIDNR---
QUEF_STAA1      NHDLYPEKIDNR---
QUEF_STAAR      NHDLYPEKIDNR---
QUEF_STAES      NHDMYPEKIDNR---
QUEF_STAEQ      NHDMYPEKIDNR---
QUEF_STAHJ      NHDLYPEKIDNR---
QUEF_STAS1      NHDLYPEKIDNR---
QUEF_BACFN      NHE------------
QUEF_BACFR      NHE------------
QUEF_BACTN      NRE------------
QUEF_PORGI      THH------------
QUEF_HELPH      NAK------------
QUEF_HELPY      NAK------------
QUEF_HELPJ      DAK------------
QUEF_HELAH      GAK------------
QUEF_BDEBA      EYAPGKYSMELSKLY
QUEF_SYNE7      PYRGRG---------
QUEF_SYNP6      PYRGRG---------
QUEF_MAGSA      GYRGRG---------
QUEF_BRASB      PYRGRG---------
QUEF_BRASO      PYRGRG---------
QUEF_RHOPS      PYRGRG---------
QUEF_RHOP2      TYRGRG---------
QUEF_RHOPB      TYRGRG---------
QUEF_RHOPA      PYRGRG---------
QUEF_RHOP5      PYRGRG---------
QUEF_BRADU      PYRGRG---------
QUEF_NITWN      SYRGRG---------
QUEF_NITHX      AYRGRG---------
QUEF_PARL1      PYRGRG---------
QUEF_CAUVC      PYRGRG---------
QUEF_CAUSK      PYRGRG---------
QUEF_HYPNA      SYRGRG---------
QUEF_ZYMMO      PYRGR----------
QUEF_NOVAD      PYRGRG---------
QUEF_CHESB      PYRGRG---------
QUEF_RHILO      PYRGRG---------
QUEF_GLUOX      GYRGRG---------
QUEF_GRABC      GYRGRG---------
QUEF_RHIL3      TYRGRG---------
QUEF_RHIEC      TYRGRG---------
QUEF_AGRFC      PYRGRG---------
QUEF_RHIME      TYRGRG---------
QUEF_SINMW      TYRGRG---------
QUEF_BRUO2      NYRGRG---------
QUEF_BRUSI      NYRGRG---------
QUEF_BRUSU      NYRGRG---------
QUEF_BRUC2      NYRGRG---------
QUEF_BRUAB      NYRGRG---------
QUEF_BRUA2      NYRGRG---------
QUEF_BRUME      NYRGRG---------
QUEF_OCHA4      NYRGRG---------
QUEF_RUEST      PYRGRG---------
QUEF_PARDP      PYRGRG---------
QUEF_RUEPO      TYRGRG---------
QUEF_ACICJ      PYRGRG---------
QUEF_MARMM      GYRGRG---------
QUEF_LEPIN      ---------------
QUEF_LEPIC      ---------------
QUEF_LEPBL      ---------------
QUEF_LEPBJ      ---------------
QUEF_METCA      ---------------
QUEF_NITOC      ---------------
QUEF_HALHL      ---------------
QUEF_THIDA      EHQSNTRG-------
QUEF_METFK      ESQSNIRG-------
QUEF_NITEU      EQQFNTHG-------
QUEF_NITEC      DEQFNTRS-------
QUEF_NITMU      DSQPSTRG-------
QUEF_ALKEH      ---------------
QUEF_RUTMC      ---------------
QUEF_VESOH      G--------------
QUEF_ANADE      ---------------
QUEF_ANADF      ---------------
QUEF_SYNAS      ---------------
QUEF_FRACC      ---------------
QUEF_PELLD      ---------------
QUEF_CHLPM      ---------------
QUEF_CHLTE      ---------------
QUEF_CHLPD      ---------------
QUEF_CHLCH      ---------------
QUEF_RHOBA      ---------------
QUEF_DESVH      SEWKRENNRHGA---
QUEF_DESVV      SEWKRENNRHGA---
QUEF_THEP1      ---------------
QUEF_THEMA      ---------------
QUEF_CALS4      ---------------