CLUSTAL format seed alignment for MF_00822

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

UREE_BORPE       -----------MKIANTFIKRGAAGG------LDLS---QAPGVTLTLAERRRSRQRLDL
UREE_BORBR       -----------MKIANTFIKRGAAGG------LDLS---QAPGVTLTLAERRRSRQRLDL
UREE_BORPA       -----------MKIANTFIKRGAAGG------LDLS---QAPGVTLTLAERRRSRQRLDL
UREE_BRASO       -----------MIRATRVLGQHRWK---------EA---AADSVLLDFDDRHRRRLAMTG
UREE_BRASB       -----------MIRATRVLGQHRWT---------EA---AADSVLLDFDDRHRRRLAMTG
UREE_RHOP2       -----------MIRASKVHGQYHWK---------EP---AADTVVLDFDDRHRRRMAMTG
UREE_RHOPB       -----------MIRATSVKGQHRWS---------EA---AADTVVLDFDDRHRRRTAMVG
UREE_CHESB       -----------MIRATSVTAKF------------DR---AFDTITLDETARHRRRMMMRS
UREE_AZOC5       -----------MIRSTKIVRHLAVRP--------DR---VVDTITLDHHARHRRRVAMTA
UREE1_BRUA2      -----------MFRAIAIIRAHEVID--------AV---PASHIVLERDERHLRRKAITL
UREE_BRUAB       -----------MFRAIAIIRAHEVID--------AV---PASHIVLERDERHLRRKAITL
UREE_BRUME       -----------MFRAIAIIRAHEVID--------AV---PASHIVLERDERHLRRKAITL
UREE1_BRUSU      -----------MFRAIAIIRAHEVID--------AV---PASHIVLERDERHLRRKAITL
UREE_RHILO       MKLNLNTDFTKFPRAVSVLAAGEAGA--------AP---AFAKAVLAHDERHLRRRAVEL
UREE_AGRFC       -----------MLRVTSYHPAGTPGD--------E----PSGYVTLAHDQRHLRRKLLHL
UREE_RHILV       -----------MQRVTSYLPAGTPSS--------H----PIAQVKLPHDLRHLRRKLLHL
UREE_RHIME       ----------MPYRSTEVLSPGPGER--------A----PLHRLTLTHEQRHLRRKLLHL
UREE_RUEST       ---------MSAPRLIARHYHGHPHD--------ES---PRDCVVLDYDARFLRRKVLTC
UREE_RUEPO       ---------MDLPACRDIRRTGHWSE--------AD---DR--VTLSYDDRFLRRKRLIT
UREE_RHOCA       ---------MSLMHRASRVLPAGGWS--------G----AADHIALDYEARFLRRKRLVA
UREE_RHOS4       ---------MTELPQARRLLKQGEWT--------GP---AAGCVRLGYDERFLRRKRLET
UREE_CUPNH       -----------MLKIDKLLSAPHGIA-----PVLVR---RAPKLVLPFAERSKSRLRAVL
UREE_CUPPJ       -----------MLKIDKVLSAPHGIA-----AVLVR---RAPKLVLPFGERSKSRLRAVL
UREE_RALSO       -----------MLSIDKHLPAPHGLA-----AVLVR---RAPKLVLPFLARSRSRLRATL
UREE_BURCA       -----------MRTLDKRIAPNVKLA-----ASLVA---RAPTLTLAYDARCKSRLAATL
UREE_BURCH       -----------MRTLDKRIAPNVKLA-----ASLVA---RAPTLTLAYDARCKSRLAATL
UREE_BURCM       -----------MRTLDKRIAPNVKLA-----ASLVA---RAPTLTLAYDARCKSRLAATL
UREE_BURVG       -----------MRTLDKRIAPNVKLA-----ASLVA---RAPTLTLAFDARCKSRVAATL
UREE_BURL3       -----------MRTLDKRIAPNVKLA-----ASLVA---RAPTLTLAYDARCKSRLAATL
UREE_BURP6       -----------MRTIDKRIAPNVRLA-----ATLVA---RAPALTLAYDARCKSRLAATL
UREE_BURPS       -----------MRTIDKRIAPNVRLA-----ATLVA---RAPALTLAYDARCKSRLAATL
UREE_BURP0       -----------MRTIDKRIAPNVRLA-----ATLVA---RAPALTLAYDARCKSRLAATL
UREE_BURM9       -----------MRTIDKRIAPNVRLA-----ATLVA---RAPALTLAYDARCKSRLAATL
UREE_BURMS       -----------MRTIDKRIAPNVRLA-----ATLVA---RAPALTLAYDARCKSRLAATL
UREE_BURM7       -----------MRTIDKRIAPNVRLA-----ATLVA---RAPALTLAYDARCKSRLAATL
UREE_BURP1       -----------MRTIDKRIAPNVRLA-----ATLVA---RAPALTLAYDARCKSRLAATL
UREE_BURMA       -----------MRTIDKRIAPNVRLA-----ATL--------------------------
UREE_BURTA       -----------MRTIDKRIAPNVKLA-----TALVA---RAPTLTLAYDARCKSRLAATL
UREE_PARXL       -----------MRTIDKLIAPHLKLA-----PVLVK---RAPTLTLAFDDRRKSRLAATL
UREE_POLNA       -----------MLQISKLISQGAGLA-----PVLVK---RASTLEIDWDVRQKSRFDALD
UREE_POLSJ       -----------MIQVSKVIPQGAGLA-----PVLVK---RASTVELDWDVRQKSRFDATD
UREE_RHOFT       -----------MLTISKLIPQGQGLA-----PVLLR---RASTMELDWDVRQKSRFEATD
UREE_VEREI       -----------MLTVSRLIPRGQGLA-----PVLRQ---RASTVELDWELRQKSRLSATD
UREE_ACIAC       -----------MLTANKLLPQGHGLA-----PVLLK---RAATVELDWDVRQKSRFAATD
UREE_METPP       -----------MLTLNKLLARGAGLA-----PALLK---RAATVELDWDVRQKSRFDATD
UREE_PSEP1       -----------MIVLSRRISEPGTR----------V---VSGTVTLDVDSRIKSRLRVTL
UREE_PSEPK       -----------MIVLSRRISEPGTR----------V---VSGTVTLDVDSRIKSRLRVTL
UREE_PSEPG       -----------MIVLTRRISDPGTL----------A---VSGTVTLDVDSRIKSRLRLTL
UREE_PSEE4       -----------MIVFTRRITEADT---------------VTGTLTLAVDSRIKSRLRVTL
UREE_KLEAE       -----------MLYLTQRLEIPAA---------------ATASVTLPIDVRVKSRVKVTL
UREE_KLEP7       -----------MLYLTQRLEIPSA---------------ATASVTLPIDVRVKSRVKVTL
UREE_ECO57       -----------MLYLTRRVETPAQ---------------TTASVTLPVDMRVKSRIKVTL
UREE_CITK8       -----------MLYLTQRIETPAA---------------VTATLTLPIDVRVKSRAKVVL
UREE_ENT38       -----------MITLTQRLDHAHP---------------VTASVTLPIDIRVKSRAKVEL
UREE_ALKEH       -----------MLTLTERLPQAAP---------------ADATLTLPFEVRQKSRFRATL
UREE_ALIF1       -----------MIKFTHLVHHHHDEHHHNEEHAHNA---TELTICLTMQERTKSRLKVML
UREE_VIBPH       -----------MIRFTQVINSEGRDNFTDRENC--------LIVCLTMDERTKSRLKVCL
UREE_PROMH       -----------MKKFTQIIDQQKALELTSTEKP-------KLTLCLTMDERTKSRLKVAL
UREE_ALCBS       -----------MIELTKKITDTVALEKIDPARL--------KTLSLPLDARIKSRQKVQL
UREE_SACD2       -----------MLEIYEVIPAQEMQNKQ-----------TQLTVELRFDERQKSRHKTQT
UREE_MARMS       -----------MLDIYERLGTHCHDP-------------VYTTVTLTHEQRDRGRLKLVG
UREE_PSYIN       -----------MLQVFERL-DHTHDE-------------ISDSITLDQDTRKKSRIKSVT
UREE_HAHCH       -----------MIRITERYIETEQTPV------------IAGVISLTYDERKRGRLRAKT
UREE_MARHV       -----------MLELTKRITHVDASE-------------IHDNLVLPYELRIRGRLRATT
UREE_PSET1       -----------MFELTKRIDSNTQDA-------------VFDTLTLPYELRIRGRLKAVT
UREE_METFK       -----------MLGISKKIETA-SQ--------------VDDQLVLPFDRRQKSRLRVEL
UREE_AZOSB       -----------MLLIESFYEGV-RA--------------ATDQLELDFGYRTKSRLRAKL
UREE_JANMA       -----------MLTLNTKLEKA-DQ--------------IDGELILPYDQREKSRLRATM
UREE_NITMU       -----------MLTLNTRINSA-DK--------------VSAQLVLPYESRENSRLRTAL
UREE_PSEAB       -----------MLVIHQRLPARSPR--------------WDEELHLTYEARSKSRLRCFA
UREE_PSEAE       -----------MLVIHQRLPARSPR--------------WDEELHLTYEARSKSRLRCFA
UREE_PSEA7       -----------MLVIHQRLPARSPR--------------WDEELHLTYEARSKSRLRCFA
UREE_PSEPF       -----------MLVIHRRIDPQ-PV--------------WAAELHLTFEARSKSRLRCFS
UREE_PSEF5       -----------MLVIHRRTTPQ-AT--------------WSAELHLTYEARSKSRLRCFS
UREE_PSE14       -----------MLVIHNRIEPQ-AE--------------WAAELHLNFEARSKSRLRCFS
UREE2_PSEU2      -----------MLVIHDRIEPQ-AE--------------WAAELHLNFEARSKSRLRCFS
UREE2_PSESM      -----------MLVIHNRIEPQ-AE--------------WAAELHLNFEARSKSRLRCFS
UREE_PSEMY       -----------MLVIHTRIAPQ-AA--------------ADAELELTFEARRKSRLRCFT
UREE_NITOC       -----------MLCFERRLPSD-TP--------------ADLEMAFTFEQRERSRLRFPL
UREE_DECAR       -----------MLILNQRTQQL-----------------ATDSVALAYDERKRSRLKVTL
UREE_NOSS1       -----------MLTLTQLVTP----------NPDVA---ITLTLFLTAEERCRSRHRFET
UREE_TRIV2       -----------MLTLTQLVTP----------NPNLA---VTLTLPLTAEERCRSRHRFEI
UREE_THEEB       -----------MFTLTQLCPT----------PLENA---RQLHLSLTAEERCRRRLHCHS
UREE_MICAN       -----------MLTFTERLPPRHTASS----PPPET---VLFSLLLTAEERTRSRYRLDS
UREE_SYNPX       ------MTQAVLVLDQRLAA------------RADQ---ADLLLPLTADERSVVRGRRRT
UREE_SYNS3       ------MDVGLTVLDHRLLSEEPW-------PNGSL---AVMELPLSADQRTVLRGRRRT
UREE_SYNPV       -MSDNVSDHKPIVLEHRQVGEAVG-------DFPPD---RRLQLPLTAEERTVLRGRRCS
UREE_PROMS       ------MRMNKQIVVTDWIKEKP----------KLG---LFLKLTLSSDERRILRGKRLT
UREE_PROM0       ------MRMNKQIVVTDWIKEKP----------KLG---SFLKLTLSSDERRILRGKRLT
UREE_PROM9       ------MRMNKQIVVTDWIKEKP----------RLG---SFLKLTLTSDERKILRGKRLT
UREE_PROM2       ------MRMNKQIVVTDWIKEKP----------RLG---TFLKLTLNSDERRILRGKRLT
UREE_PROMP       ------MSNKKEIVVTDWIKQNC----------HEG---NFLNLTLSSDQRRVFRGKRKS
UREE_PROS9       ------MSNKKEIVVTDWIKQNC----------HEG---NFLNLTLSSDQRRVFRGKRKS
UREE_ACIAD       -----------MKIYTQRLDEIA----------SDQ---TFETLELTFDTRQKSRFRATL
UREE1_PSEU2      -----------MLILDRILGQA-SDPALADRLHDLSHAGQVETLSLSGSDIQRHRLRLAS
UREE1_PSESM      -----------MLILDRILGQA-SDPALADRLHDLSHAGQVETLSLSGSDIQRHRLRLAS
UREE_YERPA       -----------MILIEHILGNVKKDPVWREKLKDAT----FDLLILDQREAQKSRCRKSS
UREE_YERPP       -----------MILIEHILGNVKKDPVWREKLKDAT----FDLLILDQREAQKSRCRKSS
UREE_YERPE       -----------MILIEHILGNVKKDPVWREKLKDAT----FDLLILDQREAQKSRCRKSS
UREE_YERPN       -----------MILIEHILGNVKKDPVWREKLKDAT----FDLLILDQREAQKSRCRKSS
UREE_YERP3       -----------MILIEHILGNVKKDPVWREKLKDAT----FDLLILDQREAQKSRCRKSS
UREE_YERPS       -----------MILIEHILGNVKKDPVWREKLKDAT----FDLLILDQREAQKSRCRKSS
UREE_YERE8       -----------MILIEHILGNVKKDPVWQEKLKDAT----FDLLVLDQREAQKSRCRKLS
UREE_YEREN       -----------MILIEHILGNVKKDPVWQEKLKDAT----FDLLVLDQREAQKSRCRKLS
UREE_YERFR       -----------MILIEHILGNVKKDPVWQAKLKDAT----FDLLVLDQREAQKSRCRKLS
UREE_YERKR       -----------MILIEHILGNVKKDPIWQEKLKDAT----FDLLVLDQREAQKSRCRKLS
UREE_YERRO       -----------MILIEHILGNVKKDPVWQAKLKNAT----FDLLVLDQREAQKSRCRKSS
UREE_YERIN       -----------MILIEHILGNVKKDPVWQAKLKNAT----VDLLVLDQREAQKSRCRKST
UREE_YERAL       -----------MILIEHVLGNVKKDPVWQEKLKHAT----LDLLVLDQREAQKSRCRKST
UREE_YERMO       -----------MILIEHILGNVKKDPVWQAKLKDAT----FDLLILDQREAQKSRCRKSS
UREE_YERBE       -----------MILIEHILGNVKKDPVWRERLKGAT----FDFLVLDQREAQKSRCRKSS
UREE_EDWIC       -----------MIVISHVLGNVKTDPVWAEKLKAYE----LDYLTLEHGDMYKNSCRKMT
UREE_PAEAT       ------------MIIEKILGNLHQQP-------DAYASHHKEKVVLPSTLLVKRIQRVTT
UREE_ARTS2       ------------MIIEKILGNLHELPASE---AGAFAGLHQEKVVLPSAQLVKRIQRVTT
UREE_ACTNA       ------------MIIESISGNIHDLPG------EDLEDVHVESVVLPLADLTKRIQRVRS
UREE_COREF       ------------MIITEIIGNIHEQP--------ELRTHHAETITLVDDALTKRIQRLVS
UREE_CORGL       ------------MIITAIDTNIYDQP-------EFVEGRDVIGVRFEDLVLDKRIQRVAL
UREE_CORGB       ------------MIITAIDTNIYDQP-------EFVEGRDVIGVRFEDLVLDKRIQRVAL
UREE_STAAT       ------------MIVEEIQGNIANLSN------SEKQK-HVEKVYLENSDLVKRIQRVVT
UREE_STAA8       ------------MIVEEIQGNIANLSN------SEKQK-HVEKVYLENSDLVKRIQRVVT
UREE_STAA9       ------------MIVEEIQGNIANLSN------SEKQK-HVEKVYLENSDLVKRIQRVVT
UREE_STAAM       ------------MIVEEIQGNIANLSN------SEKQK-HVEKVYLENSDLVKRIQRVVT
UREE_STAAB       ------------MIVEEIQGNIANLSN------SEKQK-HVEKVYLENSDLVKRIQRVVT
UREE_STAA1       ------------MIVEEIQGNIANLSN------SEKQK-HVEKVYLENSDLVKRIQRVVT
UREE_STAAN       ------------MIVEEIQGNIANLSN------SEKQK-HVEKVYLENSDLVKRIQRVVT
UREE_STAAE       ------------MIVEEIQGNIANLSN------SEKQK-HVEKVYLENSDLVKRIQRVVT
UREE_STAAC       ------------MIVEEIQGNIANLSN------SEKQK-HVEKVYLENSDLVKRIQRVVT
UREE_STAA2       ------------MIVEEIQGNIANLSN------SEKQK-HVEKVYLENSDLVKRIQRVVT
UREE_STAAS       ------------MIVEEIQGNIANLSN------SEKQK-HVEKVYLENSDLVKRIQRVVT
UREE_STAAW       ------------MIVEEIQGNIANLSN------SEKQK-HVEKVYLENSDLVKRIQRVVT
UREE_STAA3       ------------MIVEEIQGNIANLSN------SEKQK-HVEKVYLENSDLVKRIQRVVT
UREE_STAAR       ------------MIVEEIQGNIANLSN------SEKQK-HVEKVYLENSDLVKRIQRVVT
UREE_STAES       ------------MIIEEIQGNIANLSQ------DEKQK-HVEKVYLENSDLVKRIQRVKT
UREE_STAEQ       ------------MIIEEIQGNIANLSQ------DEKQK-HVEKVYLENSDLVKRIQRVKT
UREE_STAS1       ------------MIIEEIVGNIANFSD------SEKGK-HMEKVYLENSDLVKRIQRVTT
UREE_LACP7       ------------MIIEQVVGNIDNISD------EILNKLHLENVFVESSNLVKKVQRVVT
UREE_GEOKA       ------------MIIETIIGNIQTL---------PSLPPHIERVYMASDDLVKRIQRVVT
UREE_BACSB       ------------MMVEKVVGNITTL---------EKRVPHIERVYMRSDDLVKRVKRVVT
UREE_BACC1       ------------MIIEKINNNVCNMDD------FSNTKKHLDKILISSELLLKRVQKLYS
UREE_UREP2       -----------MTVFKEILDNIANIKN------VESYQ--IENIHLTSDDVLKRVIIISS
UREE_UREPA       -----------MTVFKEILDNIANIKN------VESYQ--IENIHLTSDDVLKRVIIISS
UREE_UREUR       -----------MTVFKEILGNITDIEN------VESYQ--IENIHLTSDDVLKRVIIISS
UREE_STRT2       ------------MIFTKVDALVKDI---------DVDKYHIETVILSSDDLNKKIIRVKS
UREE_STRT1       ------------MIFTKVDALVKDI---------DVDKYHIETVILSSDDLNKKIIRVKS
UREE_STRTD       ------------MIFTKVDALVKDI---------DVDKYHIETVILSSDDLNKKIIRVKS
UREE_STRE5       ------------MIFTKVDALVKDI---------DVDKYHIETVILSSDDLNKKIIRVKS
UREE_STRVE       ------------MIFTKVDALVKDI---------DVDKYHIETVILSSDDLNKKIIRVKS
UREE_LIMFE       ------------MVLTEVYRNVDDIP--------NIGSYHIETAMVKSDDLMKNILRVKT
UREE_SPOPA       ------------MLITKIVGHIDDYE---------SSDKKVDWLEVEWEDLNKRILRKET
UREE_BACHD       ------------MYVHSVIGNIEAK----------TPTKTIEWIELDWDELNKRILRKTT
UREE_HAEIN       ----MKIINPILPIIENILGNLTALQA-----EGKITTQPIERVALQWYESERNILRKTT
UREE_HAEI8       ----MKIINPILPIIENILGNLTALQA-----EGKITTQPIERVALQWYESERNILRKTT
UREE_HAEIE       ----MKIINPILPIIENILGNLTALQA-----EGKITTQPIERVALQWYESERNILRKTT
UREE_HAEIG       ----MKIINPILPIIENILGNLTALQA-----EGKITTQPIERIALQWYESERNILRKTT
UREE_ACTPL       ----MQILNPILPVMEDILGNLAELKA-----SGKITNQQIDTVELQWYESERNILRKTS
UREE_FLAJ1       ------------MIINEIEGSLREFD---------ITNRVVDYLEIEWFESTKRIQRKKS
UREE_HUNT2       ------------MIVERVLYNIKDID---------LEKLEVDFVDIEWYEVQKKILRKLS
UREE_HELPJ       ------------MIIERLVGNLRDLN---------PLDFNVDHVDLEWFETRKKIARFKT
UREE_HELPH       ------------MIIERLVGNLRDLN---------PLDFNVDHVDLEWFETRKKIARFKT
UREE_HELPY       ------------MIIERLVGNLRDLN---------PLDFSVDHVDLEWFETRKKIARFKT
UREE_HELAH       ------------MIIERLTGNLRDLN---------PLDFKVDYVDLEWFETRKKIARFKT
UREE_HELBI       ------------MLAESVLGNLKEGG---------SSK-ELDFIDLEWFDAQKRMGRFTS
UREE_HELHP       ------------MRVEHIIGNIKDID---------ATHLDIDEVQIAWYDTKKKIARLNS
UREE_DEIRA       -----------MTRLTGLRRPLLPIAGAKQAPEQAIDG-PQVEVPLTAVDRRRVRRRLHA
UREE_NATPD       -----------MRHVDGVVGNRYDDPDLDEQLHAHEDAGRLERVVLEAGQRKRSRLRVET
                                                                             

UREE_BORPE       DEGRGELGMAIERG-QTLRDGDVLVAEDGT-YVVVRAALE------DVARVTA----ATP
UREE_BORBR       DEGRGELGMAIERG-QTLRDGDVLVAEDGT-YVVVRAALE------DVARVTA----ATP
UREE_BORPA       DEGRGELGMAIERG-QTLRDGDVLVAEDGT-YVVVRAALE------DVARVTA----ATP
UREE_BRASO       TRGLE-FLLDLEHA-TALRGGDALVLEDGR-LIEVVAAAE------PLLEIRA----GDP
UREE_BRASB       TRGLA-FVLDLAHA-TALRGGDALVLEDGR-LVEVVAAAE------PLLEIRA----SDP
UREE_RHOP2       TRGLS-FLLDLEHA-TALRGGDALVLDDGR-LIEVVAAPE------PLLEIRG----RDP
UREE_RHOPB       TRGLQ-FLLDLEHA-VALRGGDALVLEDGR-LVEVVAAAE------PLIEIRG----SDP
UREE_CHESB       DNGIE-FLLDLPEA-RLLNHGDGLLLEDGR-VIEVRALPE------PLYEVRG----RDS
UREE_AZOC5       DGGLE-FLLDLDRA-AVLDHGDALELEDGR-LVQVKAADE------QLVEITT----FNP
UREE1_BRUA2      ENGEK-ILADFAEP-VVLEHGDRLVLDDGR-EIEIRAASE------ELYEIRG----RDP
UREE_BRUAB       ENGEK-ILADFAEP-VVLEHGDRLVLDDGR-EIEIRAASE------ELYEIRG----RDP
UREE_BRUME       ENGEK-ILADFAEP-VVLEHGDRLVLDDGR-EIEIRAASE------ELYEIRG----RDP
UREE1_BRUSU      ENGEK-ILADFAEP-VVLEHGDRLVLDDGR-EIEIRAASE------ELYEIRG----RDP
UREE_RHILO       TDGSK-VLVDLPEP-VALNDGDRLVLEDGR-HVEIIAAPE------EVYDIRA----RDG
UREE_AGRFC       QNDEM-VMLDLKEA-VLFAHGDLLVVENGD-LIEVRAADE------KLFEIKA----KDR
UREE_RHILV       ENGEM-VMLDLKDP-VLFANGDLLVRDDGE-LIEILAADE------KLFEIRG----RDR
UREE_RHIME       ENDDV-VMLDLKEP-VMLADGDLLVLEGGG-HIEVKAAAE------ALYDIRA----RNP
UREE_RUEST       ESGER-LLVDLSHT-TSLDHDGVLLLEGGG-EIRVVAAPE------PLLEVTA----DH-
UREE_RUEPO       VQDKA-FLVDLAHT-TSLEHGDAFQLEDGR-LIECIAADE------DLLEVTG----PD-
UREE_RHOCA       ASGAE-FLVDLPEV-TNLRGGEAFALEDGR-LIEVRCGLE------PVLVVTG----D--
UREE_RHOS4       EAGDG-FLVDLAET-TSLDEGCAFELADGR-LVEVRAAEE------EVVAVTG----P--
UREE_CUPNH       DNGDE-AALFLARG-TVLRGGDLLVAEDGS-FVEVQAAAE------AVLEVRA----EDP
UREE_CUPPJ       DNGDE-AALFLPRG-TVLRGGDLLIAEDGS-FVEVQAAAE------RVLEVRA----ADQ
UREE_RALSO       DDGRE-VAVVLPRG-TVMRGGDVLVAEDGT-LVEVQAAPE------QVLRVTS----DSR
UREE_BURCA       DTGED-VAVLLPRG-TVLRDGDVLVADDGA-LVRIAAAPE------TVLLVRA----ADP
UREE_BURCH       DTGED-VAVLLPRG-TVLRDGDVLVADDGA-LVRIAAAPE------TVLLVRA----ADP
UREE_BURCM       DTGED-VAVVLPRG-TVLRDGDVLVADDGA-LVRIAAAPE------TVLLVRA----GDP
UREE_BURVG       DTGED-VAVLLPRG-TVLRDGDVLVADDGA-LVRIVAAPE------TVLLVRA----HDP
UREE_BURL3       DTGED-VAVLLPRG-TILRDGDVLVADDGA-LVRIAAAPE------TVLRVRA----ADP
UREE_BURP6       DTGED-VALVLPRG-TVLRDGDVLVADDGA-LVRVAAAHE------AVLLVRA----PDA
UREE_BURPS       DTGED-VALVLPRG-TVLRDGDVLVADDGA-LVRVAAAHE------AVLLVRA----PDA
UREE_BURP0       DTGED-VALVLPRG-TVLRDGDVLVADDGA-LVRVAAAHE------AVLLVRA----PDA
UREE_BURM9       DTGED-VALVLPRG-TVLRDGDVLVADDGA-LVRVAAAHE------AVLLVRA----PDA
UREE_BURMS       DTGED-VALVLPRG-TVLRDGDVLVADDGA-LVRVAAAHE------AVLLVRA----PDA
UREE_BURM7       DTGED-VALVLPRG-TVLRDGDVLVADDGA-LVRVAAAHE------AVLLVRA----PDA
UREE_BURP1       DTGED-VALVLPRG-TVLRDGDVLVADDGA-LVRVAAAHE------AVLLVRA----PDA
UREE_BURMA       DTGED-VALVLPRG-TVLRDGDVLVADDGA-LVRVAAAHE------AVLLVRA----PDA
UREE_BURTA       DTGEE-VALVLPRG-TVLRDGDVLVADDGA-LVRVAAAHE------AVLLVRA----PDA
UREE_PARXL       DSGEE-VALLLPRG-TVLRDGDVLVADDGG-LVRVIAAPE------AVLYVRA----KDA
UREE_POLNA       SLGRQ-LGVFLPRG-TLVRGGDVLIAEDGS-MVRVIAAPQ------PVLRITACASHGSA
UREE_POLSJ       SLGRT-LGVFLPRG-TLVRGGDVLVAEDGS-MIKVIASPQ------PVLRITACSAHGSP
UREE_RHOFT       SAGRQ-LGVFLPRG-TVVRGGDVLVAEDGS-LVKVDAAPQ------PVLRITPCSSHGTA
UREE_VEREI       SAGRA-LGIFLPRG-TRLRGGDMLVAEDGS-LVRVLATPQ------PVLLISACPKHGSP
UREE_ACIAC       STGRE-LGVFLPRG-TVVRGGDVLVAEDGS-MVRVVAAPQ------AVLRITHCTQHGSP
UREE_METPP       SQGRA-LGVFLPRG-SVVRGGDVLVAEDGS-LVRVIAAPQ------SVLVVRHCSEHGSA
UREE_PSEP1       DDGRE-AGLMLERG-HLLRGGELLADAEGTQLIRVLAAPE------AVSTVRC----ADP
UREE_PSEPK       DDGRE-AGLMLERG-HLLRGGELLADAEGTQLIRVLAAPE------AVSTVRC----ADP
UREE_PSEPG       DDGRE-AGLMLERG-HLLRGGELLADADGTHLIRVLAAPE------AVSTVRC----ADP
UREE_PSEE4       DDGRE-AGLMLERG-HLLRGGELLADADGRQVVRVLAAPE------AVSTVRC----ADP
UREE_KLEAE       NDGRD-AGLLLPRG-LLLRGGDVLSNEEGTEFVQVIAADE------EVSVVRC----DDP
UREE_KLEP7       NDGRE-AGLLLPRG-LLLRGGDVLSNEEGTEFVQVIAADE------GVSVVRC----DDP
UREE_ECO57       NDGRQ-AGLLLPRG-LLLRDGDILSNENGDEFIKVIAADE------AVSVVRC----ADP
UREE_CITK8       GDGRE-AGLLLPRG-LLLRGGDRLSTEDGAEVVEIIAANE------AVSVVRC----ADP
UREE_ENT38       NDGRE-AGLMLPRG-LLLRGGDLLSTDDGNEIIEVIAAPE------SVSVVRC----ADP
UREE_ALKEH       DDGRE-VGVMLSRG-EILRDGQCLQAGDGT-VVRVHAAAE------AVSTVRG----DDG
UREE_ALIF1       SDGSE-AGLFLPRG-TVLKEHDIVESDDGV-QAMITAAEE------TVSTVYS----DDL
UREE_VIBPH       NNGDE-AGLFLPRG-TVLKEGDLLQAETGE-IALVEAAEE------VVSTAFT----DDL
UREE_PROMH       SDGQE-AGLFLPRG-TVLKEGDILLSEEGD-VVTIEAAKE------QVSTVYS----DDP
UREE_ALCBS       TSGEG-VGLFLERG-TLLRGGDVLTNADGV-LVKVLAANE------TVSTIVC----SDA
UREE_SACD2       TCGKD-LGWFIERG-YVLAHGEGLQSKCGE-IITVVAAKE------SVSEVTA----ENT
UREE_MARMS       ENNEE-VRVFLERG-KPLLVGEFLKSECGK-IVQVAGAVE------DVAHASC----EDW
UREE_PSYIN       DKGAN-IGIFVERG-HPLLVGEILKTECGL-LIEVKGKAE------DVSTAVA----NDW
UREE_HAHCH       QSGED-VGLFLERG-KTLLDGDLLMAENGD-IYTISAAPE------TVATAQA----NDP
UREE_MARHV       ETNLD-VGLFLDRG-PVLRDGDLLEAKSGE-IIRIRAAEE------PVVTARV----ETG
UREE_PSET1       DNGHD-VGLFLDRG-PVLRNGDLLRASSGE-VFSISAADE------PVTTAYI----ENG
UREE_METFK       ASGTE-AALLLERG-TVLRGGDLLQAEDG-RVVQVVAADE------PVLRVTA----ATP
UREE_AZOSB       ASGDE-VGLFLPRG-TILRGGQKLQARDG-RVVEVVAAPE------DLLEVRC----ADP
UREE_JANMA       VSGED-VAVFTVRG-TILRDGDILRGDDG-RIVKITAAKE------PTYRVEA----LSP
UREE_NITMU       SSGEE-VAIFIPRG-TVLRHNDLLMGDDG-RVVQIVAARE------STYRITC----ANP
UREE_PSEAB       ASGEE-VGLFLERGQPPLADGDCLEARDG-RLVRVVARPE------RLLHVTC----ASP
UREE_PSEAE       ASGEE-VGLFLERGQPPLADGDCLEARDG-RLVRVVARSE------RLLHVTC----ASP
UREE_PSEA7       ASGEE-VGLFLERGLPPLADGDCLEARDG-RVVRVFARAE------ELLHVTC----ASP
UREE_PSEPF       AEGED-VGLFLERGQPPLYDGECLQAEDG-RIVRVCARPE------QLLHVTC----ANA
UREE_PSEF5       AAGED-VGLFLERGQPPLHDGEFLEAEDG-RIVKVCARPE------ALLHVTC----RNA
UREE_PSE14       AENED-VGLFLQRGQSPLRDGEFLKAEDG-RVVRVCARPE------KLMHVTC----SST
UREE2_PSEU2      AENED-VGLFLQRGQSPLRDGEFLQAQDG-RVVRVCARPE------KLMHVTC----SST
UREE2_PSESM      AENED-VGLFLQRGQSPLRDGEFLQAEDG-RIVRVCARPE------KLMHVTC----SST
UREE_PSEMY       TAGEE-VGLFLERGQPALADGEFLQAKDG-RIVRVRAKAE------PLLHVTC----ASP
UREE_NITOC       PDGRE-AAFLIERG-APLVEGERLGTAEG-LVLAIQAKPE------LLMEVRT----SDP
UREE_DECAR       ASGAE-AGIFLERG-DHLHGGDKLAAEDGSAVVEILAAPE------KLIEAIA----DSP
UREE_NOSS1       EDGQV-VFLRLPRG-TLLQDGDILQDETNGNLIRIAAKPE------PVLTAVA----QTQ
UREE_TRIV2       EDGQV-VFLRLPRG-TVLQDGDILQDETNGNLIRIVAKPE------PVLTAVA----QTQ
UREE_THEEB       DEGES-LYLKLPRG-ITLQPGDRLRDEDATVIVTVHAKPE------PTLKVMA----STP
UREE_MICAN       PEGFS-LCFRLPRG-TILQDRDFLRGE-NGEIIQIIAKPE------PVITITA----PST
UREE_SYNPX       DCGRE-VLLQLPRD-GALQPGDQLSDAAGTARVEVTAATE------ALLRVRA----TSA
UREE_SYNS3       ACGRD-VLLQLPRE-RALMPGDRLTDAHEQVHVLVTAALE------ELLRVEA----ATP
UREE_SYNPV       DCGLS-LLLQLPRE-GPLQPGDRLLDRSRSWEVVVIAAPE------PLLRVQA----DSV
UREE_PROMS       DCDQE-IILQLPRN-GKLNDGDILSTNESNFYVEIIAKTE------DLIEISS----NSK
UREE_PROM0       DCDQE-IILQLPRE-GKLNDGDILSTNKSNFYVEIVAKKE------NLIEISS----NSK
UREE_PROM9       DCDQE-IILQLPRN-GKLNDGDILSTNESNFYVEIIAKTE------DLIEISS----NSK
UREE_PROM2       DCDQE-IILQLPRG-GKLNDGDILSTNDSNFYVEIIAKTE------SLIEISS----KSK
UREE_PROMP       DCNQE-LQLQLPRE-GKLNDGDILLTNQKKLFVQIIAQKE------NLIKITA----KTS
UREE_PROS9       DCNQE-LQLQLPRE-GKLNDGDILLTNQKKLFVQIIAQKE------NLIKITA----KTS
UREE_ACIAD       TNGTD-IGADLPRT-GILRSGS-FIATNEGDILRIDAKPE------QLMQVTA----KTD
UREE1_PSEU2      DRGTD-CAIRLERH-QQLRNGSVLMLDSQR----AIVVQMQDQQYLDLQPRDA-------
UREE1_PSESM      DRGTD-CAIRLERH-QQLRNGSVLMLDSQR----AIVVQMQDQHYLDLLPRDS-------
UREE_YERPA       TQGLD-LGISLDRN-VVLADGDVLAWDEETNVAVVVQINLRDVMVIDLSELKSRSPDELI
UREE_YERPP       TQGLD-LGISLDRN-VVLADGDVLAWDEETNVAVVVQINLRDVMVIDLSELKSRSPDELI
UREE_YERPE       TQGLD-LGISLDRN-VVLADGDVLAWDEETNVAVVVQINLRDVMVIDLSELKSRSPDELI
UREE_YERPN       TQGLD-LGISLDRN-VVLADGDVLAWDEETNVAVVVQINLRDVMVIDLSELKSRSPDELI
UREE_YERP3       TQGLD-LGISLDRN-VVLADGDVLAWDEETNVAVVVQINLRDVMVIDLSELKSRSPDELI
UREE_YERPS       TQGLD-LGISLDRN-VVLADGDVLAWDEETNVAVVVQINLRDVMVIDLSELKSRSPDELI
UREE_YERE8       TQGLD-LGISLDRH-VVLADGDVLAWDEKTNVAVVVQINLRDVMVIDLSELKSRSPDELI
UREE_YEREN       TQGLD-LGISLDRH-VVLADGDVLAWDEKTNVAVVVQINLRDVMVIDLSELKSRSPDELI
UREE_YERFR       TQGLD-LGISLDRH-VVLADGDVLAWDEKTNVAVVVQINLRDVMVIDLSELKSRSPDELI
UREE_YERKR       TQGLD-LGISLDRH-VVLADGDVLAWDEKNRVAVVVQINLRDVMVIDLSELKSRSPDELI
UREE_YERRO       TQGLD-LGISLDRH-VVLADGDVLAWDEKTNVAVVVQINLRDVMVIDLSELKTRSPDELI
UREE_YERIN       LQGLD-LGISLDRH-VVLADGDVLTWDEESNVAVVVQIHLRDVMVIDLSELKNRSADELI
UREE_YERAL       THGLD-LGISLDRN-VVLADGDVLAWDEETNVAVVVQINLRDVMVIDLSELKSRSPDELI
UREE_YERMO       TQGLD-LGISLDRH-VVLADGDVLAWDEENNVAVVVQINLRDVMVIDLSELKSRSPDELI
UREE_YERBE       TQGLD-LGISLDRN-VVLADGDVLSWDEKTNVAVIVQINLRDVMVIDLRELKKRSADELI
UREE_EDWIC       EQGKD-LGISLERN-SLLADGDVLLCDDKHAYAIIVKLILRDVMIIDLTDLLNFSHEMML
UREE_PAEAT       DHGKELGIRLPA-GTGDLRDGDILAIDQHNIIVVSVLPTD-------VLVIKA----RTI
UREE_ARTS2       DHGKELGIRLPA-GSGDLRDGDILHVAETNMIVISVLPTD-------VLVVAP----RSI
UREE_ACTNA       DHGTELGIRLAP-GAPDLREGDILLRNERGIVVVRLEPTD-------VLVIAP----VTV
UREE_COREF       DHGSELGLRLPS-GHPPLRDGDVLHSDGENSILIAVAPTD-------VLMIRP----GTL
UREE_CORGL       PGGEELGLRLNH-GHPILREGDVLKADDKTVFVVEIIPTD-------VLVITP----SDI
UREE_CORGB       SGGEELGLRLNH-GHPILREGDVLKADDKTVFVVEIIPTD-------VLVITP----SDI
UREE_STAAT       DHGTEIGIRLKQ-PI-DLQYGDILYADDHNMIIVDVNSED-------LLVIQP----RTL
UREE_STAA8       DHGTEIGIRLKQ-PI-DLQYGDILYADDHNMIIVDVNSED-------LLVIQP----RTL
UREE_STAA9       DHGTEIGIRLKQ-PI-DLQYGDILYADDHNMIIVDVNSED-------LLVIQP----RTL
UREE_STAAM       DHGTEIGIRLKQ-PI-DLQYGDILYADDHNMIIVDVNSED-------LLVIQP----RTL
UREE_STAAB       DHGTEIGIRLKQ-PI-DLQYGDILYADDHNMIIVDVNSED-------LLVIQP----RTL
UREE_STAA1       DHGTEIGIRLKQ-PI-DLQYGDILYADDHNMIIVDVNSED-------LLVIQP----RTL
UREE_STAAN       DHGTEIGIRLKQ-PI-DLQYGDILYADDHNMIIVDVNSED-------LLVIQP----RTL
UREE_STAAE       DHGTEIGIRLKQ-PI-DLQYGDILYADDHNMIIVDVNSED-------LLVIQP----RTL
UREE_STAAC       DHGTEIGIRLKQ-PI-DLQYGDILYADDHNMIIVDVNSED-------LLVIQP----RTL
UREE_STAA2       DHGTEIGIRLKQ-PI-DLQYGDILYADDHNMIIVDVNSED-------LLVIQP----RTL
UREE_STAAS       DHGTEIGIRLKQ-PI-DLQYGDILYADDHNMIIVDVNSED-------LLVIQP----RTL
UREE_STAAW       DHGTEIGIRLKQ-PI-DLQYGDILYADDHNMIIVDVNSED-------LLVIQP----RTL
UREE_STAA3       DHGTEIGIRLKQ-PI-DLQYGDILYADDHNMIIVDVNSED-------LLVIQP----RTL
UREE_STAAR       DHGTEIGIRLKQ-PI-DLQYGDILYADDHNMIVVDVNSED-------LLVIQP----RTL
UREE_STAES       DHGNEIGIRLKQ-PI-DLQYGDILYQDDTNMIIVDVNSED-------LLVIKP----RNL
UREE_STAEQ       DHGNEIGIRLKQ-PI-DLQYGDILYQDDTNMIIVDVNSED-------LLVIKP----RNL
UREE_STAS1       DHGNEIGIRLKQ-PI-DLQYGDILYKDDKNMIVVDVNSED-------LLVIKP----RTL
UREE_LACP7       DHGREIGICLNG-QK-DLSPGDILYMDERDIIVLNVIPDD-------LLVIRP----SSL
UREE_GEOKA       DHGRELGIRLKE-AK-ELADGDVLWMDDHNAIVVSVLPED-------LLVIKP----VSL
UREE_BACSB       DHGKEIGIRLKE-HQ-ELQDGDILYMDDHNMIVISVLEDD-------VLTIKP----TSM
UREE_BACC1       ESGFEIGVSLGS-GE-TLKNGDILYEDENRIVYIEVLPEE-------VIVITP----TSI
UREE_UREP2       DQNVEYGIRLEE-DK-KLMDGDILYKDDYKLVVIRLELSD-------VLIITA----HTI
UREE_UREPA       DQNVEYGIRLEE-DK-KLMDGDILYKDDYKLVVIRLELSD-------VLIITA----HTI
UREE_UREUR       DQNVEYGIRLEE-DK-KLRDGDILYKDDYKLVVIRLELSD-------VLIITA----RTI
UREE_STRT2       DHGNEFGIRLD--KGQKLQNGSAFFIDDHHVLAIGVESQD-------LIVISP----KDM
UREE_STRT1       DHGNEFGIRLD--KGQKLQNGSAFFIDDHHVLAIGVESQD-------LIVISP----KDM
UREE_STRTD       DHGNEFGIRLD--KGQKLQNGSAFFIDDHHVLAIGVESQD-------LIVISP----KDM
UREE_STRE5       DHGNEFGIRLD--KGQKLQNGSAFFIDDHHVLAIGVESQD-------LIVISP----KDM
UREE_STRVE       DHGNEFGIRLD--KGQKLQNGSAFFIDDHHVLVIGVESQD-------LIVISP----KDM
UREE_LIMFE       DHGNEYGIRLDN-EDQILENGSAFKLGDKQLLVLSVIADE-------MIEITP----RDI
UREE_SPOPA       ENGTDIAIKLE--NSGTLRYGDVLYESDDTLIAIRTKLEK-------VYVIKP----QTM
UREE_BACHD       DHGREVAIVME--EQG-LTFGDILYEGEDVAIAVRTKLEP-------AFVIRP----KTM
UREE_HAEIN       NTGREVAFRLLKE-GQRLKHDDVVFISDELVIAIEILPSD-------VIVLSP----KTL
UREE_HAEI8       NTGREVAFRLLKE-GQRLKHDDVVFISDELVIAIEILPSD-------VIVLSP----KTL
UREE_HAEIE       NTGREVAFRLLKE-GQRLKHDDVVFISDELVIAIEILPSD-------VIVLSP----KTL
UREE_HAEIG       NTGREVAFRLLKE-GQRLKHDDVVFISDELVIAIEILPSE-------VIVLSP----KTL
UREE_ACTPL       KSGREVAFRLLKE-GQRLKHDDVVFVSESLVIAIEILPSE-------VIVLSP----KTL
UREE_FLAJ1       KNGQEVAIKFLKE-GQRLKHEDVIYADDQKIIVVDIIPCD-------AIVVKP----KSL
UREE_HUNT2       SNGIEVGIRNSN--GEALKEGDVLWQEGNKVLVVRIPYCD-------CIVLKP----QNM
UREE_HELPJ       RQGKDIAIRLKDAPKLGLSQGDILFKEEKEIIAVNILDSE-------VIHIQA----KSV
UREE_HELPH       RQGKDIAIRLKDAPKLGLSQGDILFKEEKEIIAVNILDSE-------VIHIQA----KSV
UREE_HELPY       RQGKDIAIRLKDAPKLGLSQGDILFKEEKEIIAVNILDSE-------VIHIQA----KSV
UREE_HELAH       RQGKDIAIRLKDAPKLGLSQGDILFKEEKEIIAINILDSE-------VIHIQA----KSV
UREE_HELBI       QKGAELVLKLKNPPKMGLCDGDILFEDATSLIAINIIPTP-------TLHVYA----DST
UREE_HELHP       QNGQVIAMKLAQAPKYGLNNGDILFLDEHKIIIISILPTW-------VLCMKP----THW
UREE_DEIRA       PDGAE-LQLAFPTG-TVLSPGTVLGTRGGVSYVVSAAPED-------VAVVVP----RTL
UREE_NATPD       DAGTDLGIVVDQPE---LRAGDVLFLDDDAAAVVEFESRT------AFVVDLPSPGPETV
                   .              .     .                                    

UREE_BORPE       WQLARAAYHLGNRHVLLEIAE------------RHLQFEYDAVLIDMLAQLGG-------
UREE_BORBR       WQLARAAYHLGNRHVLLEIAE------------RHLQFEYDAVLIDMLAQLGG-------
UREE_BORPA       WQLARAAYHLGNRHVLLEIAE------------QHLQFEYDAVLIDMLAQLGG-------
UREE_BRASO       HHLVRLAWHLGNRHLPTQIMA------------KSLRIRRDHVIEAMVKGLG--------
UREE_BRASB       HHLVRLAWHLGNRHLPTQIMA------------KSLRIRRDHVIEAMVKGLG--------
UREE_RHOP2       QHLVRLAWHLGNRHLPTQIMA------------KALRIRRDHVIADMVRGLG--------
UREE_RHOPB       KELVRIAWHLGNRHLPTQIMA------------KGLRIRRDHVIEEMVQGLG--------
UREE_CHESB       RHLLALAWQIGNRHLPAEIAE------------DRILIRRDHVIRDMLEGLG--------
UREE_AZOC5       VRLMRAAWHIGNRHIPAEITE------------EAIYIVQDPVLEAMLRGLG--------
UREE1_BRUA2      RHIAELAWHIGNRHLAAQIET------------DHIFILRDHVIRVMLEGLG--------
UREE_BRUAB       RHIAELAWHIGNRHLAAQIET------------DHIFILRDHVIRVMLEGLG--------
UREE_BRUME       RHIAELAWHIGNRHLAAQIET------------DHIFILRDHVIRVMLEGLG--------
UREE1_BRUSU      RHIAELAWHIGNRHLAAQIET------------DRIFILRDHVIRVMLEGLG--------
UREE_RHILO       VHLTELAWHIGNRHLAAGIEA------------DRIVILRDHVIKAMLEGLG--------
UREE_AGRFC       LHLIELAWHLGNRHLAAQIEE------------ERILILRDHVIRAMLEGLG--------
UREE_RHILV       THLVELAWHLGNRHLAAQIEE------------DRIVILRDHVIRTMLQGLG--------
UREE_RHIME       LHLMELAWHLGNRHLPAAVEE------------GRILIARDPVIRAMLEGLG--------
UREE_RUEST       --LPRMAWHIGNRHTPCQIEA------------SRLLIQRDHVIRAMLEQLG--------
UREE_RUEPO       --LTRLAWHIGNRHTPCQIEE------------NRLLIQRDHVIQDMLSQIG--------
UREE_RHOCA       --LTRLAWHVGNRHTPCQIEP------------DRLLIRDDHVLETMLRGLG--------
UREE_RHOS4       --ILRAAWHIGNRHTPCQIEA------------DRLVIRRDHVLEEMLRGLG--------
UREE_CUPNH       HALMRAAYHLGNRHTPVEIGR------------DYLRLEYDAVLADMLQRLG--------
UREE_CUPPJ       HGLMRAAYHLGNRHTPVEVGR------------DYLRLEFDPVLADMLARLR--------
UREE_RALSO       LALMRAAYHLGNRHTPVQVVA------------DALQLEADPVLEDMLVRLG--------
UREE_BURCA       LTLMRAAYHLGNRHTPVEIGD------------GYLKLEADPVLADMLRRLG--------
UREE_BURCH       LTLMRAAYHLGNRHTPVEIGD------------GYLKLEADPVLADMLRRLG--------
UREE_BURCM       LTLMRAAYHLGNRHTPVEIGD------------GYLKLEADPVLADMLRRLG--------
UREE_BURVG       LTLMRAAYHLGNRHTPVEIGD------------GYLKLEADPVLADMLRRLG--------
UREE_BURL3       LTLMRAAYHLGNRHTPVEIGD------------GYLKLEADPVLADMLRRLG--------
UREE_BURP6       LTLTRAAYHLGNRHTPVEVGA------------GCLKLEYDPVLADMLTRLG--------
UREE_BURPS       LTLTRAAYHLGNRHTPVEVGA------------GCLKLEYDPVLADMLTRLG--------
UREE_BURP0       LTLTRAAYHLGNRHTPVEVGA------------GCLKLEYDPVLADMLTRLG--------
UREE_BURM9       LTLTRAAYHLGNRHTPVEVGA------------GCLKLEYDPALADMLTRLG--------
UREE_BURMS       LTLTRAAYHLGNRHTPVEVGA------------GCLKLEYDPALADMLTRLG--------
UREE_BURM7       LTLTRAAYHLGNRHTPVEVGA------------GCLKLEYDPALADMLTRLG--------
UREE_BURP1       LTLTRAAYHLGNRHTPVEVGA------------GCLKLEYDPVLADMLTRLG--------
UREE_BURMA       LTLTRAAYHLGNRHTPVEVGA------------GCLKLEYDPALADMLTRLG--------
UREE_BURTA       LTLTRAAYHLGNRHTPVEVGA------------GCLKLEYDPVLADMLTRLG--------
UREE_PARXL       LTLTRAAYHLGNRHTPVEVGA------------DYLKLEFDPVLADMLKRIG--------
UREE_POLNA       FDLTRAAYHLGNRHVPIELKP------------DHLKIEPDHVLADMLRAMH--------
UREE_POLSJ       FDLTRAAYHLGNRHVPIELKP------------DHLKIEPDHVLADMLRAMH--------
UREE_RHOFT       FDLTRAAYHLGNRHVPIELKP------------DHLKIEPDHVLADMLRAMH--------
UREE_VEREI       FDLTRAAYHLGNRHVPIELQP------------DHLKIEPDPVLADMLRALH--------
UREE_ACIAC       FDLTRAAYHLGNRHVPIELRP------------DHLQIEPDHVLADMLRAMH--------
UREE_METPP       FDLLRAAYHLGNRHVPLELQP------------DRLQLEPDHVLADMLRAMH--------
UREE_PSEP1       HLLARAAYHLGNRHVPLQIEP------------GLLRFQHDHVLDDMLRGLG--------
UREE_PSEPK       HLLARAAYHLGNRHVPLQIEP------------GLLRFQHDHVLDDMLRGLG--------
UREE_PSEPG       HLLARAAYHLGNRHVPLQIEP------------GLLRFQHDHVLDDMLRGLG--------
UREE_PSEE4       HLLARAAYHLGNRHVPLQIEP------------GLLRYQHDHVLDDMVRGLG--------
UREE_KLEAE       FMLAKACYHLGNRHVPLQIMP------------GELRYHHDHVLDDMLRQFG--------
UREE_KLEP7       FMLAKACYHLGNRHVPLQIMP------------GELRYHHDHVLDDMLRQFG--------
UREE_ECO57       FMLAKACWHLGNRHVPLQIMP------------GELRYHHDHVLDDMLRQFG--------
UREE_CITK8       FLLAKACYHLGNRHVPLQILP------------DELRYHHDHVLDDMLRQFS--------
UREE_ENT38       YLLARACYHLGNRHVPLQIMP------------GELRYHHDHVLDDMLRQFD--------
UREE_ALKEH       LALARACYHLGNRHVPLQIGA------------GFARYLHDHVLDDMLRGLG--------
UREE_ALIF1       LLLAKACYHLGNRHVPLQVEA------------GWCRYLHDHVLDDMVQRLG--------
UREE_VIBPH       LLLAKACYHLGNRHVPLQVEL------------GWCRYLHDHVLDDMVKGLG--------
UREE_PROMH       LLLARVCYHLGNRHVPLQIEA------------GWCRYFHDHVLDDMARGLG--------
UREE_ALCBS       LMLTKVAYHLGNRHVPLQIET------------GFVRYQHDHVLDDMVRQLPGADTC---
UREE_SACD2       HQLMRAAYHLGNRHVPLQVDP------------TKLAYLHDHVLDDMVRGLG--------
UREE_MARMS       EAFSKACYHLGNRHTKIQIGE------------RWLRIKPDHVLEDMLHMLG--------
UREE_PSYIN       LNFSKVCYHLGNRHTTLQIGE------------LWVRFKPDHVLEQLAENYG--------
UREE_HAHCH       RQFAQICYHLGNRHTPLQIGE------------LWVRFQPDHVLEDLCRLYG--------
UREE_MARHV       LPLARLCYHLGNRHVSLQIGSGGAIG--EDDRMGWVRFPPDHVLEELAERLG--------
UREE_PSET1       LPLARLCYHLGNRHVSLAIGV-------DADGRHWIRFPPDHVLEELAILLG--------
UREE_METFK       RELARAAYHLGNRHVPLEV------------GDGWLRLEQDHVLQEMLLGLG--------
UREE_AZOSB       LELARAAYHLGNRHVAVEL------------GDGWLRIQADHVLEGMLIGLG--------
UREE_JANMA       HQLLRCAFHLGNRHTQAQI------------GNGFLRIRKDAVLKEMLEGLG--------
UREE_NITMU       HDLLRCAFHLGNRHTQTQV------------GEGFLRIARDNVLKEMLEGLG--------
UREE_PSEAB       LELTRAAYHLGNRHVALQV------------GDGWLRLLDDYVLKAMLEQLG--------
UREE_PSEAE       LELTRAAYHLGNRHVALQV------------GDGWLRLLDDYVLKAMLEQLG--------
UREE_PSEA7       LELTRAAYHLGNRHVALQV------------GEGWLRLLDDYVLKAMLEQLG--------
UREE_PSEPF       FELTRAAYHLGNRHVALQV------------GDGWLRLLDDYVLKAMLEQLG--------
UREE_PSEF5       FELTRAAYHLGNRHVALQV------------GDGWLRLLDDYVLKAMLEQLG--------
UREE_PSE14       FELTRAAYHLGNRHVALQV------------GDGWLRLLDDYVLKAMLDQLG--------
UREE2_PSEU2      FELTRAAYHLGNRHVALQV------------GDGWLRLLDDYVLKAMLDQLG--------
UREE2_PSESM      FELTRAAYHLGNRHVALQV------------GDGWLRLLDDYVLKAMLDQLG--------
UREE_PSEMY       FELMRAAYHLGNRHVALQL------------GDGWLRLPDDYVLKAMLEQLG--------
UREE_NITOC       LTLVRAAYHLGNRHVRLEI------------GAHWLRLPPDYVLRDMLMRLG--------
UREE_DECAR       LLFARAAYHLGNRHVPVQILP--------TENGGKLRFQTDHVLAEMVRGLG--------
UREE_NOSS1       LLLMRAAYHLGNRHVPVEITP------------TYLRLSPDTVLRTMLEHMG--------
UREE_TRIV2       LLLMRAAYHLGNRHVPVEITP------------TYLRLSPDTVLRTMLEHMG--------
UREE_THEEB       LDLLRAAYHLGNRHVPLEIHT------------DYLRLGADSVVQTMLEQRG--------
UREE_MICAN       DLLLKAAYHLGNRHVALEINP------------DYLRLAPDSVLQAMLEGLG--------
UREE_SYNPX       LALMQAAYHLGNRHVALELHE------------QDLYLLEDAVLATMLESRG--------
UREE_SYNS3       LALLEAAYHLGNRHVALELHE------------DELLLLNDSVLETMLKGRG--------
UREE_SYNPV       LELLQAAYHLGNRHVALELHD------------GELLLLKDSVLEAMLRSRG--------
UREE_PROMS       IELIKTAYHLGNRHVEVEIEE------------GILLTKSDYVIKNMLLNFK--------
UREE_PROM0       IELIKTAYHLGNRHVELEIEE------------GILLTKSDYVIKNMLLNFK--------
UREE_PROM9       NELIKTAYHLGNRHVEVEIEE------------DILLTKSDYVIENMLKNFK--------
UREE_PROM2       LELIKTAYHLGNRHVEVEIEK------------DILLTKGDYLIENMLKNFN--------
UREE_PROMP       IELIKVAYHLGNRHVEIEINE------------NILFTKSDYIIEELLRNFD--------
UREE_PROS9       IELIKVAYHLGNRHVEIEINE------------NILFTKSDYIIEELLRNFD--------
UREE_ACIAD       FELLKAAYHLGNRHVPLMLTP------------YALYFEPDHVLAEMVEGLG--------
UREE1_PSEU2      AAALELGYFAGNMHWAVRFAG---------DTLQILLNGPE-------------------
UREE1_PSESM      AAALELGYFAGNMHWAVRFAG---------DTLQIPLNGPE-------------------
UREE_YERPA       KTCFELGHALGNQHWKAVTKH---------NEVYVPLTVATTMMDSVMRTHGFQHLPFRF
UREE_YERPP       KTCFELGHALGNQHWKAVTKH---------NEVYVPLTVATTMMDSVMRTHGFQHLPFRF
UREE_YERPE       KTCFELGHALGNQHWKAVTKH---------NEVYVPLTVATTMMDSVMRTHGFQHLPFRF
UREE_YERPN       KTCFELGHALGNQHWKAVTKH---------NEVYVPLTVATTMMDSVMRTHGFQHLPFRF
UREE_YERP3       KTCFELGHALGNQHWKAVTKH---------NEVYVPLTVATTMMDSVMRTHGFQHLPFRF
UREE_YERPS       KTCFELGHALGNQHWKAVTKH---------NEVYVPLTVATTMMDSVMRTHGFQHLPFRF
UREE_YERE8       KTCFELGHALGNQHWKAVTKN---------NEVYVPLTVATTMMDSVMRTHGFQHLPFRF
UREE_YEREN       KTCFELGHALGNQHWKAVTKN---------NEVYVPLTVATTMMDSVMRTHGFQHLPFRF
UREE_YERFR       KTCFELGHALGNQHWKAVTKN---------NEVYVPLTVATTMMDSVMRTHGFQHLPFRF
UREE_YERKR       KTCFELGHALGNQHWKAVTKH---------NEVYVPLTVATTMMDSVMRTHGFQHLPFRF
UREE_YERRO       KTCFELGHALGNQHWKAVTKN---------NEVYVPLTVATTMMDSVMRTHGFQHLPFRF
UREE_YERIN       KTCFELGHALGNQHWKAVTKN---------NEVYVPLTVATTMMDSVMRTHGFQHLPFRF
UREE_YERAL       KTCFELGHALGNQHWKAVTKN---------NEVYVPLTVATTMMDSVMRTHGFQHLPFRF
UREE_YERMO       KTCFELGHALGNQHWKAVTKH---------NEVYVPLTVATSMMDSVMRTHGFQHLPFRF
UREE_YERBE       KTCFELGHALGNQHWKAVTKN---------NEVYVPLTVATTMMDSVMRTHGFQHLPFRF
UREE_EDWIC       KISFELGHALGNQHWKSIIHE---------SQVFVPLSVSHKVMESVIQTHRFTGIHYRF
UREE_PAEAT       HEMGVVAHSLGNRHLQAQFFDGSS-----EYGAEVMVCQYDHTVEDYLKSVGVPYD----
UREE_ARTS2       HEMGVVAHSLGNRHLQAQFFDAGS-----EYAADVMVCQYDHTVEDYLKHVGVPYE----
UREE_ACTNA       REMGVVAHNLGNRHLPAQFFGPAEPFPGLEGHDGVMVIQYDHTAEHYLEHLGVRHA----
UREE_COREF       RDMAFVAHSLGNRHLPAQF------------DGDVMIVRYDNTVVDFLEHYGVRYE----
UREE_CORGL       HQMGFVAHSLGNRHLPAQFSKPGE-----LTEKAAMIVQYDHTVVSFLDEHGIEYQ----
UREE_CORGB       HQMGFVAHSLGNRHLPAQFSKPGE-----LTEKAAMIVQYDHTVVSFLDDHDIEYQ----
UREE_STAAT       QEMGDIAHQLGNRHLPAQFT------------ETEMLVQYDYLVEDLLKSLGIPYV----
UREE_STAA8       QEMGDIAHQLGNRHLPAQFT------------ETEMLVQYDYLVEDLLKSLGIPYV----
UREE_STAA9       QEMGDIAHQLGNRHLPAQFT------------ETEMLVQYDYLVEDLLKSLGIPYV----
UREE_STAAM       QEMGDIAHQLGNRHLPAQFT------------ETEMLVQYDYLVEDLLKSLGIPYV----
UREE_STAAB       QEMGDIAHQLGNRHLPAQFT------------ETEMLVQYDYLVEDLLKSLGIPYV----
UREE_STAA1       QEMGDIAHQLGNRHLPAQFT------------ETEMLVQYDYLVEDLLKSLGIPYV----
UREE_STAAN       QEMGDIAHQLGNRHLPAQFT------------ETEMLVQYDYLVEDLLKSLGIPYV----
UREE_STAAE       QEMGDIAHQLGNRHLPAQFT------------ETEMLVQYDYLVEDLLKSLGIPYV----
UREE_STAAC       QEMGDIAHQLGNRHLPAQFT------------ETEMLVQYDYLVEDLLKSLGIPYV----
UREE_STAA2       QEMGDIAHQLGNRHLPAQFT------------ETEMLVQYDYLVEDLLKSLGIPYV----
UREE_STAAS       QEMGDIAHQLGNRHLPAQFT------------ETEMLVQYDYLVEDLLKSLGIPYV----
UREE_STAAW       QEMGDIAHQLGNRHLPAQFT------------ETEMLVQYDYLVEDLLKSLGIPYV----
UREE_STAA3       QEMGDIAHQLGNRHLPAQFT------------ETEMLVQYDYLVEDLLKSLGIPYV----
UREE_STAAR       QEMGDIAHQLGNRHLPAQFT------------ETEMLVQYDYLVEDLLKSLGIPYV----
UREE_STAES       KEMGDIAHQLGNRHLPAQFT------------ETEMLIQYDYLVEDLLKELGIPYS----
UREE_STAEQ       KEMGDIAHQLGNRHLPAQFT------------ETEMLIQYDYLVEDLLKELGIPYS----
UREE_STAS1       QEMGDIAHQLGNRHLPAQFT------------ETEMLVQYDYLVESLLKDLGIPYE----
UREE_LACP7       RQMGDIAHKIGNRHIPAQFD------------EIEMLVQYDYLVEELLKQLEVPYT----
UREE_GEOKA       KQMGEIAHQIGNRHLPAQFE------------EGEMLVQYDYLVEELLQQLAIPYK----
UREE_BACSB       QQMGEIAHQLGNRHLPAQFE------------GNEMIVQYDYLVEELLQKLSIPFT----
UREE_BACC1       KEMGIIAHNLGNRHLPAQFD------------EGCMILANDYLVEDLLKKEGVPYQ----
UREE_UREP2       GEMAKIAHNLGNRHMPAQFT------------ETQMIVPYDYLVEEYLQDNKALYE----
UREE_UREPA       GEMAKIAHNLGNRHMPAQFT------------ETQMIVPYDYLVEEYLQDNKALYE----
UREE_UREUR       GEMAQIAHNLGNRHMPAQFT------------ETQMIVPYDYLVEQYLQDNKALYE----
UREE_STRT2       DEMGITAHILGNTHKPIEVK------------DAKIYLEVDPVVEQVLTQKEIAYT----
UREE_STRT1       DEMGITAHILGNTHKPIEVK------------DAKIYLEVDPVVEQVLTQKEIAYT----
UREE_STRTD       DEMGITAHILGNTHKPIEVK------------DAKIYLEVDPVVEQVLTQKEIAYT----
UREE_STRE5       DEMGITAHILGNTHKPIEVK------------DAKIYLEVDPVVEQVLTQKEIAYT----
UREE_STRVE       DEMGITAHILGNTHKPIEVK------------DAKIYLEVDPVVEQVLTQKEIAYT----
UREE_LIMFE       NEMGLVAHFLGNLHKPVQIK------------DGKISLLLDKVVIKMLDKHDINYE----
UREE_SPOPA       QEMGKMAFEIGNRHTMCIIE------------DDEILVRYDKTLEKLIDEVGVSYE----
UREE_BACHD       KEMGKTAFELGNRHTPCLVE------------NDEIYVRYDSTLAALFNEIGVNYE----
UREE_HAEIN       PEMARACYEIGNKHSPLFLDGD------------EVTLPYDKPMFEWLQAAGFHPQ----
UREE_HAEI8       PEMARACYEIGNKHSPLFLDGD------------EVTLPYDKPMFEWLQAAGFHPQ----
UREE_HAEIE       PEMARACYEIGNKHSPLFLDGD------------EVILPYDKPMFEWLQAAGFHPQ----
UREE_HAEIG       PEMARACYEIGNKHSPLFLDGD------------EVTLPYDKPMFEWLQAAGFHPQ----
UREE_ACTPL       PEMARACYEIGNKHSPLFLDGD------------EVTLPYDKPMFEWLQAAGFGPQ----
UREE_FLAJ1       LEMGNVCYEIGNKHLPMFIQND------------EVLLPFEEPIFKWLSASGYHTE----
UREE_HUNT2       YEMGKTCYEMGNRHAPLFIDGD------------ELMTPYDEPLMQALIKCGLSPY----
UREE_HELPJ       AEVAKICYEIGNRHAALYYGESQF----------EFKTPFEKPTLALLEKLGVQNR----
UREE_HELPH       AEVAKICYEIGNRHAALYYGESQF----------EFKTPFEKPTLALLEKLGVQNR----
UREE_HELPY       AEVAKICYEIGNRHAALYYGESQF----------EFKTPFEKPTLALLEKLGVQNR----
UREE_HELAH       AEVAKICYEIGNRHATLYYGESQF----------EFKTPFEKPTLALLEKLGVQNR----
UREE_HELBI       AQVARLCYEVGNRHASLYYGDSPL----------SFKTPFERPLQVLFDKLALRYE----
UREE_HELHP       HTMARLCYEIGNLHIPLFYNKDTM----------KLQAPFEQPLQRILEKQSIAFE----
UREE_DEIRA       AEAAHTAHAVGNLHRDFVEDA------------GAFLTPWDAPIELLLTRLG--------
UREE_NATPD       AAAVELGHRVGNQHWDIAIEGG----------TVYVPVEADRRIIEDVLGEHIPDSG---
                           ** *                                              

UREE_BORPE       ---VTATRLRAVFEPDVGAYGGG---------HRHGHDESFGDDYALAQAAYH-------
UREE_BORBR       ---VTATRLRAVFEPDVGAYGGG---------HRHGHDESFGDDYALAQAAYH-------
UREE_BORPA       ---VTAMRLRAVFEPDVGAYGGG---------HRHGHDESFGDDYALAQAAYH-------
UREE_BRASO       ---ARVIEIEAPFDPEGGAYA----------EPSHAHGDHDHDHHGHDHHGHDHTSHDHA
UREE_BRASB       ---ARVIEIEAPFDPEGGAYA----------EPSHAQGHDEHDHH----HGHDHH-HDHG
UREE_RHOP2       ---GKAVEIEAPFDPEGGAYAPAHEGAAHHDHGGHEHRHHDHGHHDHADHEHDHK-HDHG
UREE_RHOPB       ---AKTVEIEAPFDPEGGAYAPPAE--PSHDHAGHDHAHDSHAHHDH-DHGKHAQ-HDHG
UREE_CHESB       ---AMVTDITAPFSPEGGAYQ--------------AHSHDGHSHH---------------
UREE_AZOC5       ---AAVKPVVRPFKPERGAYE-----------AAEAHGHGQAHAHDHHDHDHHDHGHDHA
UREE1_BRUA2      ---ATVTDVVAIFSPLRGAY-----------SGGHQHHHGHDHDHGH-------------
UREE_BRUAB       ---ATVTDVVAIFSPLRGAY-----------SGGHQHHHGHDHDHGH-------------
UREE_BRUME       ---ATVTDVVAIFSPLRGAY-----------SGGHQHHHGHDHDHGH-------------
UREE1_BRUSU      ---ATVTDVVAIFSPLRGAY-----------SGGHQHHHG--------------------
UREE_RHILO       ---ATVREVSEPFKPVRGAY-----------SGGHDHGHAHAHSHAEAHSHAHGE-----
UREE_AGRFC       ---ATVRDVEEPFQPARGAYH---------AHGGHSHDHGQGHHH---------------
UREE_RHILV       ---AVVLEIDEPFQPARGAYH---------SQGGHSHGHDHDHNHDHGDDHGHDH-----
UREE_RHIME       ---ATVDEVNEPFHPLHGAYH---------QHG-HGDHYRHG------------------
UREE_RUEST       ---AQLREVEEPFTPEGGAYG-----------HGRTHAHEHGHTNHH-------------
UREE_RUEPO       ---ATLREVVEPFTPEGGAYG-----------HGRTHGHAH-------------------
UREE_RHOCA       ---ARVERRMEPFRPESGAYG-----------SGRTMGHDHGPFHVH-------------
UREE_RHOS4       ---LTLEPRTEPFRPEGGAYG-----------HGRTLGHDHGPAQGH-------------
UREE_CUPNH       ---VRAERAELPFEPEAGAYGGG---------HKHGHDATFAEDYAAAQAVFHEHHGH--
UREE_CUPPJ       ---VQAVQIDAPFEPEAGAYGGG---------HKHGHDATFAEDYAAAQAVFHEHHGHDH
UREE_RALSO       ---VTVTHVQAPFEPEAGAYGGG---------HRHGHDATFEEDYAAAQALYREHHGHSH
UREE_BURCA       ---TQVDETHAPFQPEAGAYGGG---------HKHGHDATFAEDYALAQQVFGEHHGHAH
UREE_BURCH       ---TQVDETHAPFQPEAGAYGGG---------HKHGHDATFAEDYALAQQVFGEHHGHAH
UREE_BURCM       ---TQVEPTSAPFQPEAGAYGGG---------HKHGHDATFAEDYALAQQVFGEHHGHSH
UREE_BURVG       ---TQVDETQAPFQPEAGAYGGG---------HKHGHDATFAEDYALAQQVFGEHHGHAH
UREE_BURL3       ---TQVEETLAPFQPEAGAYGGG---------HKHGHDATFAEDYALAQQVFGEHHGHAH
UREE_BURP6       ---ATVERASAPFQPEAGAYGGG---------HRHGHDATFAEDYALAQQVFDEHHGHSH
UREE_BURPS       ---ATVERASAPFQPEAGAYGGG---------HRHGHDATFAEDYALAQQVFDEHHGHSH
UREE_BURP0       ---ATVERASAPFQPEAGAYGGG---------HRHGHDATFAEDYALAQQVFDEHHGHSH
UREE_BURM9       ---ATVERASAPFQPEAGAYGGG---------HRHGHDATFAEDYALAQQVFDEHHGHSH
UREE_BURMS       ---ATVERASAPFQPEAGAYGGG---------HRHGHDATFAEDYALAQQVFDEHHGHSH
UREE_BURM7       ---ATVERASAPFQPEAGAYGGG---------HRHGHDATFAEDYALAQQVFDEHHGHSH
UREE_BURP1       ---ATVERASAPFQPEAGAYGGG---------HRHGHDATFAEDYALAQQVFDEHHGHSH
UREE_BURMA       ---ATVERASAPFQPEAGAYGGG---------HRHGHDATFAEDYALAQQVFDEHHGHSH
UREE_BURTA       ---ATIERANAPFQPEAGAYGGG---------HRHGHDATFAEDYALAQQVFDEHHGRSH
UREE_PARXL       ---ATVDQVSMPFQPESGAYGGG---------HKHGHDETFAEDYALAQQVFGEHHGHEH
UREE_POLNA       ---LTVQEVSEAFEPEGGAY------------SAGGHGH---------------THAPAA
UREE_POLSJ       ---LIVHEVEEAFEPEGGAY------------SAGGHGHGHDHGSHEHSAHDHGKHDHAP
UREE_RHOFT       ---LTVLAVNEPFEPENGAY------------ATGGHAH---------------DHDGEP
UREE_VEREI       ---LIVQADNLPFEPEGGAY------------AAGQGGG---------------------
UREE_ACIAC       ---LIVTEQQAPFEPEGGAY------------AAGGHGH---------------GHDHPH
UREE_METPP       ---LIVSEAQAPFEPESGAYGEA---------AAHGHGHAGHDHAHDHDHGPAQASTPAP
UREE_PSEP1       ---LTVEAEQAPFEPEAGAYQS----------APHGHSHS-HA-----------------
UREE_PSEPK       ---LTVEAEQAPFEPEAGAYQS----------APHGHSHS-HA-----------------
UREE_PSEPG       ---LTVEAEQAPFEPEAGAYQS----------APHGHS---HA-----------------
UREE_PSEE4       ---LNVDAERAPFEPESGAYQS----------APHGHG----------------------
UREE_KLEAE       ---LTVTFGQLPFEPEAGAYAS----------ESHGHH----------------------
UREE_KLEP7       ---LTVTFGQLPFEPEAGAYAS----------ESHGHH----------------------
UREE_ECO57       ---LDVDFAHLPFEPEAGAYAS----------KSHAHN----------------------
UREE_CITK8       ---LEVTFAHLPFEPEAGAYAS----------ESHGHH----------------------
UREE_ENT38       ---LDVTFAHLPFEPEAGAYTS----------DAHSHS----------------------
UREE_ALKEH       ---LEVVSEQAPFEPEPGAYGGG---------HGHTHS----------------------
UREE_ALIF1       ---LNVKVEQAKYQPEPGAY------------GGSSAG----------------------
UREE_VIBPH       ---LGVRVERAKYQPEPGAY------------GGSISG----------------------
UREE_PROMH       ---ATVVVGLEKYQPEPGAY------------GGSSGG----------------------
UREE_ALCBS       ---VDVQVEQAPFEPEAGAYQQG---------GGHSHG----------------------
UREE_SACD2       ---LTVTAAQAPFTPESGAYHGT---------TGHGGGHS-HS-----------------
UREE_MARMS       ---LIVTHEEAVFVPESGAY----------------------------------------
UREE_PSYIN       ---LSVNSIPAVFEPENGAYGVR-------------------------------------
UREE_HAHCH       ---LDVVRESAPFNPENGAYGGH---------SGHSGHSGHSG-----------------
UREE_MARHV       ---ATVVHHTATFDPEPGAYNQA---------G--------QG-----------------
UREE_PSET1       ---AQLTHHQAPFDPESGAYAHA---------G--------RE-----------------
UREE_METFK       ---VQVEGQMAPFEPEAGAYG-----------GGHRHHHDD-------------------
UREE_AZOSB       ---AEVLPLRAPFEPEAGAYA-----------HGHQHPGDG-------------------
UREE_JANMA       ---AKVEEELAAFEPESGAYG-----------GGHHHHGDD-------------------
UREE_NITMU       ---ATVIEEDAQFEPEAGAYGS----------GGHHHHGESSQ-----------------
UREE_PSEAB       ---ATVEAIEAPFQPEHGAYG-----------GGHHHSHHGEA-----------------
UREE_PSEAE       ---ATVEAIEAPFQPEHGAYG-----------GGHHHSHHGEA-----------------
UREE_PSEA7       ---ASVNAIQAPFQPEHGAYG-----------GGHHHSHHGEA-----------------
UREE_PSEPF       ---AQVESIEAPFQPEHGAYG-----------GGHHHSRHGDE-----------------
UREE_PSEF5       ---ASTAPLEAPFQPEHGAYG-----------GGHHHSRHGDE-----------------
UREE_PSE14       ---ATVETIEAPFQPEHGAYG-----------GGHHHSRAGEE-----------------
UREE2_PSEU2      ---ATVETIEAPFQPEHGAYG-----------GGHHHSRAGEE-----------------
UREE2_PSESM      ---ATTEAIEAPFQPEHGAYG-----------GGHHHSRAGEE-----------------
UREE_PSEMY       ---ATVEAVQAPYQPEQGAYG-----------GGHHHSHHGDE-----------------
UREE_NITOC       ---VEVFEVTAPYQPESGAYG-----------GGHHHSHSHHEG----------------
UREE_DECAR       ---CSVSDAEAPFQPESGAYG-----------GGHHHGDESAT-----------------
UREE_NOSS1       ---LEITAEILPFQPELGAY----------------------------------------
UREE_TRIV2       ---LEITAEILPFQPELGAY----------------------------------------
UREE_THEEB       ---LTVTFEVAPFCPERGAY----------------------------------------
UREE_MICAN       ---LAVNEEIAPFNPEIGAY----------------------------------------
UREE_SYNPX       ---LQLSRCQRPFRPEGGAY----------------------------------------
UREE_SYNS3       ---LKLTRCCRSFMPEGGAY----------------------------------------
UREE_SYNPV       ---LRVSACERPFLPEGGAYGG--------------------------------------
UREE_PROMS       ---VNVKNTKKKFFPERGAH----------------------------------------
UREE_PROM0       ---VNIKNTKKKFFPERGAH----------------------------------------
UREE_PROM9       ---VDIVNTQKKFSPEKGAH----------------------------------------
UREE_PROM2       ---VEIVNIQKKFFPERGAH----------------------------------------
UREE_PROMP       ---VVYSKVEKKFFPEIGAF----------------------------------------
UREE_PROS9       ---VVYSKVEKKFFPEIGAF----------------------------------------
UREE_ACIAD       ---LQVKQVEHAFEPESGAY----------------------------------------
UREE1_PSEU2      ---ADYLERLAPMLADGRVQRA--------------------------------------
UREE1_PSESM      ---ADYLERLAPMLADGRVRRA--------------------------------------
UREE_YERPA       VKGAEILPLLTNSEARLLFGGAEDTDTHVHVASPLDEPHGSGLHIHGIHSHE--------
UREE_YERPP       VKGAEILPLLTNSEARLLFGGAEDTDTHVHVASPLDEPHGSGLHIHGIHSHE--------
UREE_YERPE       VKGAEILPLLTNSEARLLFGGAEDTDTHVHVASPLDEPHGSGLHIHGIHSHE--------
UREE_YERPN       VKGAEILPLLTNSEARLLFGGAEDTDTHVHVASPLDEPHGSGLHIHGIHSHE--------
UREE_YERP3       VKGAEILPLLTNSEARLLFGGAEDTDTHVHVASPLDEPHGSGLHIHGIHSHG--------
UREE_YERPS       VKGAEILPLLTNSEARLLFGGAEDTDTHVHVASPLDEPHGSGLHIHGIHSHG--------
UREE_YERE8       VKGAEILPLLSNSEARLLFGGAEDTDTHVHVASPLDEPHGSGLHVHAIHSHG--------
UREE_YEREN       VKGAEILPLLSNSEARLLFGGAEDTDTHVHVASPLDEPHGSGLHVHAIHSHG--------
UREE_YERFR       VKGAEILPLLSNSEARLLFGGAEDTDTHVHVASPLDEPHGSGLHIHGIHSHG--------
UREE_YERKR       VKGAEILPLLSNSEARLLFGGAEDTDTHVHVASPLDEPHGSGLHIHAIHSHG--------
UREE_YERRO       VKGAEILPRLSNSEARLLFGGAEDTDTHVHVASPLDEPHGSGLHIHGIHSHG--------
UREE_YERIN       VKGAEILPLLTNSEARLLFGGAEDTDTHVHVASPLDEPHGSGLHIHSIHSHG--------
UREE_YERAL       VKGGEILPQLSNSEARLLFGGAEDSDTHVHVASPLDEPHGSGLHIHAIHSHG--------
UREE_YERMO       VKGAEILPQLSNSEARLLFGGAEDSDTHVHVDSPLDEPHGSGLHVHAIHSHG--------
UREE_YERBE       AKGAEILPLLSNSEARLLFGGAEESDTHVHVASPLDEPHGSGLHVHAIHSHG--------
UREE_EDWIC       EKGDSILSCLTPSEARLLFGGAEDLGAHVHV----DHSHSHDFMGHSHEHEG--------
UREE_PAEAT       ---RQERVMPVPFRHAEHSH----------------------------------------
UREE_ARTS2       ---RQERVMPVPFRHAEHSH----------------------------------------
UREE_ACTNA       ---RMERSMPVPFRHAEHTH----------------------------------------
UREE_COREF       ---RRSTVMPTPFRHSEHTH----------------------------------------
UREE_CORGL       ---RTELVPPIPFRHSGHTH----------------------------------------
UREE_CORGB       ---RTELVPPIPFRHSGHTH----------------------------------------
UREE_STAAT       ---REDRKVNKAFRHIGHSHD---------------------------------------
UREE_STAA8       ---REDRKVNKAFRHIGHSHD---------------------------------------
UREE_STAA9       ---REDRKVNKAFRHIGHSHD---------------------------------------
UREE_STAAM       ---REDRKVNKAFRHIGHSHD---------------------------------------
UREE_STAAB       ---REDRKVNKAFRHIGHSHD---------------------------------------
UREE_STAA1       ---REDRKVNKAFRHIGHSHD---------------------------------------
UREE_STAAN       ---REDRKVNKAFRHIGHSHD---------------------------------------
UREE_STAAE       ---REDRKVNKAFRHIGHSHD---------------------------------------
UREE_STAAC       ---REDRKVNKAFRHIGHSHD---------------------------------------
UREE_STAA2       ---REDRKVNKAFRHIGHSHD---------------------------------------
UREE_STAAS       ---REDRKVNKAFRHIGHSHD---------------------------------------
UREE_STAAW       ---REDRKVNKAFRHIGHSHD---------------------------------------
UREE_STAA3       ---REDRKVNKAFRHIGHSHD---------------------------------------
UREE_STAAR       ---REDRKVNKAFRHIGHSHD---------------------------------------
UREE_STAES       ---HEDRKVNQAFRHIGHSHD---------------------------------------
UREE_STAEQ       ---HEDRKVNQAFRHIGHSHD---------------------------------------
UREE_STAS1       ---HEDRKVNKAFRHIGHSHD---------------------------------------
UREE_LACP7       ---RENKKVKLAFRHVGHSHG---------------------------------------
UREE_GEOKA       ---REKRKVKQAFRHIGHRHD---------------------------------------
UREE_BACSB       ---RENRKMKQAFRPIGHRHE---------------------------------------
UREE_BACC1       ---KENRVLPKPFKHASHKHI---------------------------------------
UREE_UREP2       ---RKKIKLKEAFKHCSDAK----------------------------------------
UREE_UREPA       ---RKKIKLKEAFKHCSDAK----------------------------------------
UREE_UREUR       ---REKIKLKEAFRHCSDAK----------------------------------------
UREE_STRT2       ---IEEVVLDKPLRHVNLTAHEH-------------------------------------
UREE_STRT1       ---IEEVVLDKPLRHVNLTAHEH-------------------------------------
UREE_STRTD       ---IEEVVLDKPLRHVNLTAHEH-------------------------------------
UREE_STRE5       ---IEEVVLDKPLRHVNLTAHEH-------------------------------------
UREE_STRVE       ---IEEVVLDKPLRHVNLTAHEH-------------------------------------
UREE_LIMFE       ---LKKVQLDQPLEYLDLTK----------------------------------------
UREE_SPOPA       ---QSERRFKEPFKYRGHQH----------------------------------------
UREE_BACHD       ---QTEKRFKQPFKYKGHHHHHD-------------------------------------
UREE_HAEIN       ---KAERRLSQALRANSAQGHGHSH-------SHSHDHHGYHHHGDGHWHKH--------
UREE_HAEI8       ---KAERRLSQALRANSAQGHGHSH-------SHSHDHHGYHHHGDGHWHKH--------
UREE_HAEIE       ---KAERRLSQALRANSAQGHGHSH-------SHSHDHHGYHHHGDGHWHKH--------
UREE_HAEIG       ---KAERRLSQALRANSAQGHGHSH-------SHSHDHHGYHHHGDGNWHKH--------
UREE_ACTPL       ---KAERRLSQALRANSAQGHGHSHGH-----SHSHDHHGYHHHGDGNWHKH--------
UREE_FLAJ1       ---KVFTRLTNIVNS-TVQPHGHSE--------SSSLFFKIMNIAK--------------
UREE_HUNT2       ---KKSCKLTTPLGG---NLHGYSH-------SHSH------------------------
UREE_HELPJ       ---VLSSKLDSKERLTVSMPHS-EPN------FKVSLASDFKVVVK--------------
UREE_HELPH       ---VLSSKLDSKERLTVSMPHS-EPN------FKVSLASDFKVVMK--------------
UREE_HELPY       ---VLSSKLDSKERLTVSMPHS-EPN------FKVSLASDFKVVVK--------------
UREE_HELAH       ---VLSSKLDSKERLTVSMPHN-EPN------FKVSLASDFKVVMK--------------
UREE_HELBI       ---VLKSKLDASQRISVSAPHA-DPLQEGSAPLKFKSALDLQIVIKK-------------
UREE_HELHP       ---KKWCVLDSKDRINITYPIASEPK------LIQSPHFSIKITQKGLN-----------
UREE_DEIRA       ---VPFTRETRPFHGRPSWEHEG-------------------------------------
UREE_NATPD       --TTRYASVDASLFIGENAEPSGVDHSHEATDSGHGYGEDHDHD----------------
                                                                             

UREE_BORPE       ------------------AHEAHPHAHFHAGGHGHVHSGHGHGGKHGEHDAES-------
UREE_BORBR       ------------------AHEAHPHAHSHAGGHGHVHSGHGHGGKHGEHDAES-------
UREE_BORPA       ------------------AHEAHPHAHSHAGGHGHVHSGHGHGGKHGEHDAES-------
UREE_BRASO       HHSH--------------AHHDHDHGHAHDDHVHDEHCGH-DHHHGHSHAHDHK------
UREE_BRASB       GHEH--------------AHHGHDHGHAHDDHVHDEHCGHGHHHHGHAHAHDRK------
UREE_RHOP2       KHDH--------------AGH--DHA--HDHHVHDEHCGH-DHGHGHSHKHDHK------
UREE_RHOPB       KHDH--------------AHH--DHAAHDDHHVHDEHCGH-DH-HGHGHEHK--------
UREE_CHESB       --------------------------------------------QGHTHDHHD-------
UREE_AZOC5       HHDH--------------AHHDHAHDHHGHDHAHDHAHGA-SCGCGHTHHHD--------
UREE1_BRUA2      --------------------HGHDHDHHHPDHE---------------------------
UREE_BRUAB       --------------------HGHDHDHHHPDHE---------------------------
UREE_BRUME       --------------------HGHDHDHHHPDHE---------------------------
UREE1_BRUSU      ----------------------HDHDHHHPDHE---------------------------
UREE_RHILO       -------------------SHSHSHSHSHDDHHHHDHD----------------------
UREE_AGRFC       --------------------------HDHG------------------------------
UREE_RHILV       -------------------SHSHDHDHEHGYEHEHEHRHDRGHDHDHKHD----------
UREE_RHIME       ------------------------------------------------------------
UREE_RUEST       -------------------GQHHDHADHGHSHDHSHDQ----------------------
UREE_RUEPO       ------------------------------------------------------------
UREE_RHOCA       -------------------A----------------------------------------
UREE_RHOS4       -------------------GHDHPHVHVHISHKPDEDETPDADPA---------------
UREE_CUPNH       ---------------SHSHSHDHVHDEK-------------CGHKH--------------
UREE_CUPPJ       DHGHSHSHSHS-HSHSHSHSHDHDHDHDHEHDVKGHVHGPGCGHKH--------------
UREE_RALSO       DRGCDH---------SHSHSHDHDHDHGH-------VHGPGCGHAPHHRHD---------
UREE_BURCA       SH---------------DHDHDHDHDH---------QHGPGCTHGHHGHDHH--------
UREE_BURCH       SH---------------DHDHDHD--H---------QHGPGCTHGHHGHDHH--------
UREE_BURCM       SH---------------DHDHDHD--H---------QHGPGCTHGHRGHDHH--------
UREE_BURVG       PH---------------PHDHDHQ-------------HGPGCAHGRHGHDHH--------
UREE_BURL3       SHSH-----------SHDHDHDHDHDH---------QHGPGCAHGH-GHDHH--------
UREE_BURP6       SH-------------SHDHDHDHDHDH---------QHGPCCSHGH-HHGHR--------
UREE_BURPS       SH-------------DHDHDHDHDHDH---------QHGPCCSHGH-HHGHR--------
UREE_BURP0       SHSH-----------DHDHDHDHDHDH---------QHGPCCSHGH-HHGHR--------
UREE_BURM9       SHSH-----------SHSHDHDHDHDHDHDH---DHQHGPSCSHGH-HHGHR--------
UREE_BURMS       SHSH-----------SHSHDHDH-------------QHGPSCSHGH-HHGHR--------
UREE_BURM7       SHSH-----------DHDHDHDHDHDHDH-------QHGPSCSHGH-HHGHR--------
UREE_BURP1       SRSH-----------DHDHDHDH-------------QHGPSCSHGH-HHGHR--------
UREE_BURMA       SHSH-----------SHDHDHDHDHDH---------QHGPSCSHGH-HHGHR--------
UREE_BURTA       SHSH-----------SHSHDHDHDHDHDHDH---DHQHGPSCSHGH-GHGHR--------
UREE_PARXL       SHDHEHGHSHAAHEHSHGHDHTHGHDHDHG----DHVHDESCGHGHHHHHAHR-------
UREE_POLNA       TPVP---------------AAVPPAAH---------VHGPDCNHGHDHAHAPQAIKPVAI
UREE_POLSJ       AKPA---------------TAATPAAH---------VHGPDCNHGHDHAHEA---KPATI
UREE_RHOFT       -------------------------EH---------VHGPGCQHAH--------------
UREE_VEREI       -------------------------------------HGPHGQHTHPHH-----------
UREE_ACIAC       HDHG---------------HDHAHAHA---------HGTEACDHEHSHDHDCGHHHDHGQ
UREE_METPP       TPRGRPV--------GVAIKAAAPAPH---------VHGPGCGHDHDHGSGHHH------
UREE_PSEP1       ------------------HGHDHPFVR---------LPAHS-------------------
UREE_PSEPK       ------------------HGHDHPFVR---------LPAHS-------------------
UREE_PSEPG       ------------------HGHDHPFVR---------LPAHS-------------------
UREE_PSEE4       --------------------HDHPFVR---------LPAHS-------------------
UREE_KLEAE       --------------------HAHHDHH---------AHSH--------------------
UREE_KLEP7       --------------------HAHHDHH---------AHSH--------------------
UREE_ECO57       --------------------HDQEHSH---------------------------------
UREE_CITK8       --------------------HGHAH-----------------------------------
UREE_ENT38       --------------------HAHSH-----------------------------------
UREE_ALKEH       --------------------HDHSHQH---------DPAGHAHEH---------------
UREE_ALIF1       --------------------SHDGHHH---------------------------------
UREE_VIBPH       --------------------ASHGHHH---------H-----------------------
UREE_PROMH       --------------------HHHHHDH---------HH----------------------
UREE_ALCBS       --------------------HAHSHSH---------EKPHSHTHNH--------------
UREE_SACD2       ------------------HGHSHDHHH---------DHSH--------------------
UREE_MARMS       -------------------SHGHSHH----------------------------------
UREE_PSYIN       -------------------SHGHSHAH---------DS----------------------
UREE_HAHCH       ------------------HHHGHDHSH---------EQSRQDAKELSARYHFHAPDHEHP
UREE_MARHV       ------------------HSHGHSHGH---------SHNHDHEHSHGHKHAH--------
UREE_PSET1       ------------------QSHAHSHEH---------SHADGHTHAH--------------
UREE_METFK       ---------------------DAPSIR---------QPARLRIHE---------------
UREE_AZOSB       ---------------------SGARIH---------MMGGQ-------------------
UREE_JANMA       --------------------GHHPLAP---------IPLRQKIHRPSDKAE---------
UREE_NITMU       ------------------GHAHGPLAP---------IPVHQKIHRPSDIPSR--------
UREE_PSEAB       ------------------EFNYAPRLH---------QFGVRR------------------
UREE_PSEAE       ------------------EFNYAPRLH---------QFGVRR------------------
UREE_PSEA7       ------------------EFNYAPRLH---------QFGVRR------------------
UREE_PSEPF       ------------------DFNYAPKLH---------QFGVRL------------------
UREE_PSEF5       ------------------DFNYPPRLH---------QFGVRP------------------
UREE_PSE14       ------------------DFNYPPRMH---------QFGVRK------------------
UREE2_PSEU2      ------------------DFNYPPRMH---------QFGVRK------------------
UREE2_PSESM      ------------------DFNYPPRMH---------QFGVRK------------------
UREE_PSEMY       ------------------EFNYGPRLH---------QFGVRK------------------
UREE_NITOC       -----------------DEFHSKPRLH---------HFGGSQ------------------
UREE_DECAR       ------------------DLHNPGHGP---------HRSVPKIHEFKPR-----------
UREE_NOSS1       ---------------------GHHHPH---------------------------------
UREE_TRIV2       ---------------------GHNHPH---------------------------------
UREE_THEEB       ---------------------HAH------------------------------------
UREE_MICAN       ---------------------QHYHDL---------EEAKKG------------------
UREE_SYNPX       --------------------AGHQHG----------------------------------
UREE_SYNS3       --------------------IAHQHA----------------------------------
UREE_SYNPV       -----------------SPSHAHRHSH---------VHSHSHETP---------------
UREE_PROMS       ---------------------SHE------------------------------------
UREE_PROM0       ---------------------SHE------------------------------------
UREE_PROM9       ---------------------SHD------------------------------------
UREE_PROM2       ---------------------SHE------------------------------------
UREE_PROMP       ---------------------HHEKKS---------LS----------------------
UREE_PROS9       ---------------------HHEKKS---------LS----------------------
UREE_ACIAD       --------------------AQHNHDH---------RLSPIKSLHHVH------------
UREE1_PSEU2      ------------------------------------------------------------
UREE1_PSESM      ------------------------------------------------------------
UREE_YERPA       --------------------EGHSHGDH--------DHDHSHSHGDHDHDHKH-------
UREE_YERPP       --------------------EGHSHGDH--------DHDHSHSHGDHDHDHKH-------
UREE_YERPE       --------------------EGHSHGDH--------DHDHSHSHGDHDHDHKH-------
UREE_YERPN       --------------------EGHSHGDH--------DHDHSHSHGDHDHDHKH-------
UREE_YERP3       --------------------EGHSHGDH--------DHDHSHSHGDHDHDHKH-------
UREE_YERPS       --------------------EGHSHGDH--------DHDHSHSHGDHDHDHKH-------
UREE_YERE8       --------------------TGHTHSHD---------HDHSHSHGDHDHDHKH-------
UREE_YEREN       --------------------TGHTHSHD---------HDHSHSHGDHDHDHKH-------
UREE_YERFR       --------------------DGHSHSHDSHSHSHDSDHGHSHSHGDHDHDHKH-------
UREE_YERKR       --------------------DGHSHDHD-----------HSHSHGDHDHDHKH-------
UREE_YERRO       --------------------DGHSHSHD----------DHDHDH-NHDHDHKH-------
UREE_YERIN       --------------------DGHSHDHD-------------HSHGDHDSDHKH-------
UREE_YERAL       --------------------DGDSHNHD---------HDHSHSHGDHDHDHKH-------
UREE_YERMO       --------------------DGHSHSHS---------HDHDHDHRHDDHDHKH-------
UREE_YERBE       --------------------HSHSHDHD-----------HDHNH-DHDHKHKQ-------
UREE_EDWIC       --------------------HRHVHNHA----------GNSHDNEHDEHHSRR-------
UREE_PAEAT       ------------------------------------------------------------
UREE_ARTS2       ------------------------------------------------------------
UREE_ACTNA       ------------------------------------------------------------
UREE_COREF       ------------------------------------------------------------
UREE_CORGL       ------------------------------------------------------------
UREE_CORGB       ------------------------------------------------------------
UREE_STAAT       ------------------------------------------------------------
UREE_STAA8       ------------------------------------------------------------
UREE_STAA9       ------------------------------------------------------------
UREE_STAAM       ------------------------------------------------------------
UREE_STAAB       ------------------------------------------------------------
UREE_STAA1       ------------------------------------------------------------
UREE_STAAN       ------------------------------------------------------------
UREE_STAAE       ------------------------------------------------------------
UREE_STAAC       ------------------------------------------------------------
UREE_STAA2       ------------------------------------------------------------
UREE_STAAS       ------------------------------------------------------------
UREE_STAAW       ------------------------------------------------------------
UREE_STAA3       ------------------------------------------------------------
UREE_STAAR       ------------------------------------------------------------
UREE_STAES       ------------------------------------------------------------
UREE_STAEQ       ------------------------------------------------------------
UREE_STAS1       ------------------------------------------------------------
UREE_LACP7       ------------------------------------------------------------
UREE_GEOKA       ------------------------------------------------------------
UREE_BACSB       ------------------------------------------------------------
UREE_BACC1       ------------------------------------------------------------
UREE_UREP2       ------------------------------------------------------------
UREE_UREPA       ------------------------------------------------------------
UREE_UREUR       ------------------------------------------------------------
UREE_STRT2       ------------------------------------------------------------
UREE_STRT1       ------------------------------------------------------------
UREE_STRTD       ------------------------------------------------------------
UREE_STRE5       ------------------------------------------------------------
UREE_STRVE       ------------------------------------------------------------
UREE_LIMFE       ------------------------------------------------------------
UREE_SPOPA       ------------------------------------------------------------
UREE_BACHD       ------------------------------------------------------------
UREE_HAEIN       ------------------------------------------------------------
UREE_HAEI8       ------------------------------------------------------------
UREE_HAEIE       ------------------------------------------------------------
UREE_HAEIG       ------------------------------------------------------------
UREE_ACTPL       ------------------------------------------------------------
UREE_FLAJ1       ------------------------------------------------------------
UREE_HUNT2       ------------------------------------------------------------
UREE_HELPJ       ------------------------------------------------------------
UREE_HELPH       ------------------------------------------------------------
UREE_HELPY       ------------------------------------------------------------
UREE_HELAH       ------------------------------------------------------------
UREE_HELBI       ------------------------------------------------------------
UREE_HELHP       ------------------------------------------------------------
UREE_DEIRA       ------------------------------------------------------------
UREE_NATPD       --------------------HSHDHNHDHDHNHDHDHSHSHDSHE---------------
                                                                             

UREE_BORPE       -------------
UREE_BORBR       -------------
UREE_BORPA       -------------
UREE_BRASO       -------------
UREE_BRASB       -------------
UREE_RHOP2       -------------
UREE_RHOPB       -------------
UREE_CHESB       -------------
UREE_AZOC5       -------------
UREE1_BRUA2      -------------
UREE_BRUAB       -------------
UREE_BRUME       -------------
UREE1_BRUSU      -------------
UREE_RHILO       -------------
UREE_AGRFC       -------------
UREE_RHILV       -------------
UREE_RHIME       -------------
UREE_RUEST       -------------
UREE_RUEPO       -------------
UREE_RHOCA       -------------
UREE_RHOS4       -------------
UREE_CUPNH       -------------
UREE_CUPPJ       -------------
UREE_RALSO       -------------
UREE_BURCA       -------------
UREE_BURCH       -------------
UREE_BURCM       -------------
UREE_BURVG       -------------
UREE_BURL3       -------------
UREE_BURP6       -------------
UREE_BURPS       -------------
UREE_BURP0       -------------
UREE_BURM9       -------------
UREE_BURMS       -------------
UREE_BURM7       -------------
UREE_BURP1       -------------
UREE_BURMA       -------------
UREE_BURTA       -------------
UREE_PARXL       -------------
UREE_POLNA       QIHPRKPHSH---
UREE_POLSJ       QIHKRRPDNL---
UREE_RHOFT       -------------
UREE_VEREI       -------------
UREE_ACIAC       DYGHAHPHSLAR-
UREE_METPP       -------------
UREE_PSEP1       -------------
UREE_PSEPK       -------------
UREE_PSEPG       -------------
UREE_PSEE4       -------------
UREE_KLEAE       -------------
UREE_KLEP7       -------------
UREE_ECO57       -------------
UREE_CITK8       -------------
UREE_ENT38       -------------
UREE_ALKEH       -------------
UREE_ALIF1       -------------
UREE_VIBPH       -------------
UREE_PROMH       -------------
UREE_ALCBS       -------------
UREE_SACD2       -------------
UREE_MARMS       -------------
UREE_PSYIN       -------------
UREE_HAHCH       HGHVHLHAHPHEH
UREE_MARHV       -------------
UREE_PSET1       -------------
UREE_METFK       -------------
UREE_AZOSB       -------------
UREE_JANMA       -------------
UREE_NITMU       -------------
UREE_PSEAB       -------------
UREE_PSEAE       -------------
UREE_PSEA7       -------------
UREE_PSEPF       -------------
UREE_PSEF5       -------------
UREE_PSE14       -------------
UREE2_PSEU2      -------------
UREE2_PSESM      -------------
UREE_PSEMY       -------------
UREE_NITOC       -------------
UREE_DECAR       -------------
UREE_NOSS1       -------------
UREE_TRIV2       -------------
UREE_THEEB       -------------
UREE_MICAN       -------------
UREE_SYNPX       -------------
UREE_SYNS3       -------------
UREE_SYNPV       -------------
UREE_PROMS       -------------
UREE_PROM0       -------------
UREE_PROM9       -------------
UREE_PROM2       -------------
UREE_PROMP       -------------
UREE_PROS9       -------------
UREE_ACIAD       -------------
UREE1_PSEU2      -------------
UREE1_PSESM      -------------
UREE_YERPA       -------------
UREE_YERPP       -------------
UREE_YERPE       -------------
UREE_YERPN       -------------
UREE_YERP3       -------------
UREE_YERPS       -------------
UREE_YERE8       -------------
UREE_YEREN       -------------
UREE_YERFR       -------------
UREE_YERKR       -------------
UREE_YERRO       -------------
UREE_YERIN       -------------
UREE_YERAL       -------------
UREE_YERMO       -------------
UREE_YERBE       -------------
UREE_EDWIC       -------------
UREE_PAEAT       -------------
UREE_ARTS2       -------------
UREE_ACTNA       -------------
UREE_COREF       -------------
UREE_CORGL       -------------
UREE_CORGB       -------------
UREE_STAAT       -------------
UREE_STAA8       -------------
UREE_STAA9       -------------
UREE_STAAM       -------------
UREE_STAAB       -------------
UREE_STAA1       -------------
UREE_STAAN       -------------
UREE_STAAE       -------------
UREE_STAAC       -------------
UREE_STAA2       -------------
UREE_STAAS       -------------
UREE_STAAW       -------------
UREE_STAA3       -------------
UREE_STAAR       -------------
UREE_STAES       -------------
UREE_STAEQ       -------------
UREE_STAS1       -------------
UREE_LACP7       -------------
UREE_GEOKA       -------------
UREE_BACSB       -------------
UREE_BACC1       -------------
UREE_UREP2       -------------
UREE_UREPA       -------------
UREE_UREUR       -------------
UREE_STRT2       -------------
UREE_STRT1       -------------
UREE_STRTD       -------------
UREE_STRE5       -------------
UREE_STRVE       -------------
UREE_LIMFE       -------------
UREE_SPOPA       -------------
UREE_BACHD       -------------
UREE_HAEIN       -------------
UREE_HAEI8       -------------
UREE_HAEIE       -------------
UREE_HAEIG       -------------
UREE_ACTPL       -------------
UREE_FLAJ1       -------------
UREE_HUNT2       -------------
UREE_HELPJ       -------------
UREE_HELPH       -------------
UREE_HELPY       -------------
UREE_HELAH       -------------
UREE_HELBI       -------------
UREE_HELHP       -------------
UREE_DEIRA       -------------
UREE_NATPD       -------------