CLUSTAL format seed alignment for MF_00823

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ACCA_BACAN      ---------MAELEFEKPVVELRNKIRELKDYTKNS--------QMDFSEEIRILEDKLE
ACCA_BACCZ      ---------MAELEFEKPVVELRNKIRELKDYTKNS--------QMDFSEEIRILEDKLE
ACCA_BACHK      ---------MAELEFEKPVVELRNKIRELKDYTKNS--------QMDFSEEIRILEDKLE
ACCA_BACCR      ---------MAELEFEKPVVELRNKIRELKDYTKNS--------QMDFSEEIRILEEKLE
ACCA_BACLD      --------MAGELEFEKPVVELREKISELKKFTQDS--------DMDLSSEITKLEARLE
ACCA_BACSU      --------MAPRLEFEKPVIELQTKIAELKKFTQDS--------DMDLSAEIERLEDRLA
ACCA_GEOKA      --------MVAELEFEKPLVELRRKIQELKEFMKTA--------DVDLSAEIEKLEARLA
ACCA_BACHD      --------MSTELDFEKPIRDLKGKIEELRTFTEEK--------EIDLSDEIEKLEKRLH
ACCA_OCEIH      --------MTPILDFEKPIVNLKEKIVELKSFTENS--------EIDLTKEIETLEERLA
ACCA_LISMO      --------MANEMEFEKPILELKSKIADLKEYNETS--------DVDLTNEIEKLEKRLA
ACCA_LISMF      --------MANEMEFEKPILELKSKIADLKEYNETS--------DVDLTNEIEKLEKRLA
ACCA_LISIN      --------MANEMEFEKPILELKSKIADLKEYNETS--------DVDLTNEIEKLEKRLA
ACCA_BACSK      --------MSSEQEFEKPVIELRQKIADLRAFAMER--------DMDLSTEIKKMEARLS
ACCA_STAAC      -----------MLDFEKPLFEIRNKIESLKESQDKN--------DVDLQEEIDMLEASLE
ACCA_STAAS      -----------MLDFEKPLFEIRNKIESLKESQDKN--------DVDLQEEIDMLEASLE
ACCA_STAAW      -----------MLDFEKPLFEIRNKIESLKESQDKN--------DVDLQEEIDMLEASLE
ACCA_STAAR      -----------MLDFEKPLFEIRNKIESLKESQDKN--------DVDLQEEIDMLEASLE
ACCA_STAAM      -----------MLDFEKPLFEIRNKIESLKESQDKN--------DVDLQEEIDMLEASLE
ACCA_STAAN      -----------MLDFEKPLFEIRNKIESLKESQDKN--------DVDLQEEIDMLEASLE
ACCA_STAHJ      -----------MLDFEKPLFEIKNKIESLKQSQEKN--------DVDLQDEIDLLEASLE
ACCA_STAES      -----------MLDFEKPLFEIRNKIDSLKESQEKN--------EVDLQDEIDMLEASLK
ACCA_STAEQ      -----------MLDFEKPLFEIRNKIDSLKESQEKN--------EVDLQDEIDMLEASLK
ACCA_STAS1      -----------MLDFEKPLFEIKNKIESLKESQEKN--------DVDLQEEIDMLEASLA
ACCA_CLOAB      ------------------------------------------------------------
ACCA_CLOPE      ------------------------------------------------------------
ACCA_STRPN      ------------------------------------------------------------
ACCA_STRR6      ------------------------------------------------------------
ACCA_STRT2      ------------------------------------------------------------
ACCA_STRT1      ------------------------------------------------------------
ACCA_ENTFA      ------------------------------------------------------------
ACCA_CARHZ      -------MANFLFEFEKPLVELENKISDLKKFAEEK--------NIDVSRELELLSAKAQ
ACCA_TREDE      -------MSN---------KDQTNLLNNLKDIAQKA--------GLDISEELAKINAKLE
ACCA_CHLMU      ---------MELLPHEKQVVEYEKTIADFKEKNKEN--------SLLSSSEIQKLENRLD
ACCA_CHLTR      ---------MELLPHEKQVVEYEKTIAEFKEKNKEN--------SLLSSSEIQKLDKRLD
ACCA_CHLAB      ---------MELLPHEKQVVEYEKTIAEFKEKNKKN--------SLLSSSEIQKLERRLD
ACCA_CHLCV      ---------MELLPHEKQVVEYEKTIAEFKEKNKKN--------SLLSSSEIQKLERRLD
ACCA_CHLPN      ---------MELLPHEKQVVEYEKAIAEFKEKNKKN--------SLLSSSEIQKLEKRLD
ACCA_PARUW      ---------MDILPHEKQIHEYIKTIEHLKKQSQDN--------PIFDV-EIQKLEQKLD
ACCA_FUSNN      ------------MQFEFQIEELEHKIEELKKFAEEK--------EVDLSDEIAKLKDQRD
ACCA_NOSS1      -MATT-ERKPLLLDFEKPLAELANRIDQIRQLAEEN--------GVDVSGEIRKLETRAM
ACCA_SYNY3      -MSKS-ERRVFLLDFEKPLYELEEKINQIRELAEEK--------NVDVSEQLSQLESRAE
ACCA_SYNP6      -MAAPVTKKPILLEFEKPLVELEERITQIRTLAADN--------QVDVSGQIQQLEARAI
ACCA_SYNE7      -MAAPVTKKPILLEFEKPLVELEERITQIRTLAADN--------QVDVSGQIQQLEARAI
ACCA_THEEB      -MAN--ERRTLLLEFEKPLVELEAQIQQVRDKSSEF--------GVDVSEQIRELEERAK
ACCA_PROMA      ------MARRYLLEFEKPLVELEKQIEQIRELARDS--------EVDVSQQLLQLETLAA
ACCA_PROMT      ------MARRFLLEFEKPLVELENQIDQIRELARDS--------EVDVSQQLLQLETLAA
ACCA_PROMM      ------MARRYLFEFEKPLVELEQQIEQIRELARDS--------EVDVSQQLLQLETLAA
ACCA_SYNPX      ------MPRRPLLEFEKPLVELEQQIEQIRQLARDS--------EVDVSQQLHQLESLAA
ACCA_PROMP      ------MPRRYLLDFEKPLVELEKQIEQIRELARDS--------EVDVSQQLLQLETLAT
ACCA_GLOVI      MTQSRSATPGPSLDFERELMELETRLDDIRRFAEEN--------NVDVSTQLAEIEARAA
ACCA_ANTSP      --MIT--RKTLSLNFLKPVLELEYQIDQLSKMTYKN--------KSLNIHDLTALKKQLI
ACCA_GRATL      --MTI--RKALSLDFLKPILELEYQIQQLSKISTYQ--------QVVLDQELVSFKEQLS
ACCA_PORPU      --MITSNRKPTVPDFMRPVAELESQVAELKRLAPKN--------DKVIENKINRFQDKLT
ACCA_CYACA      --MKMLDKTLPLEELESSLTKTESKAYYLSKLVYRH--------DKVVNNKAHILQRKLL
ACCA_THET2      --------------MKSPFWSWNGRIAELKETAKAT--------GVDLEAEIRLLEERLA
ACCA_THET8      ----------MPLEFEKPILELERRIAELKETAKAT--------GVDLEAEIRLLEERLA
ACCA_DEIRA      ----------MTSTPADALRELEARVRDLEATAERT--------GQNLDAALAPLRTQLE
ACCA_GEOSL      ------MAAQYYMEFEKPVVELEKKVQELAELAGT---------NAELAGEVTKLEKKVD
ACCA_PELCD      --------MQFYLDFEKPLVELEQKLSELRDYSTD---------EVDFSGEIQRLEKKAE
ACCA_CHLTE      ------MAAKVVLDFEKPLYELEEKLNEMRVYLKSGEVDSMSEGRAGLKREIESLEAKVE
ACCA_AROAE      ---MKT----TFLDFEQPVADLEAKIEKLRFVQDD--------SAVDISEEIARLEAKSQ
ACCA_DECAR      ---MKT----SFLDFEQSIADLEAKIEELRFVQDD--------SAVDISEEIGRLEKKSG
ACCA_BORBR      ---MRN----TFLEFEQPLAELENKIEQLRYVQAD--------SAVDISDEIGRLQQKSQ
ACCA_BORPA      ---MRN----TFLEFEQPLAELENKIEQLRYVQAD--------SAVDISDEIGRLQQKSQ
ACCA_BORPE      ---MRN----TFLEFEQPLAELENKIEQLRYVQAD--------SAVDISDEIGRLQQKSQ
ACCA_BURMA      ---MKT----TFLDFEQPIAELEAKIEELRFVQDD--------SAVDISEEIERLSKKSQ
ACCA_BURPS      ---MKT----TFLDFEQPIAELEAKIEELRFVQDD--------SAVDISEEIERLSKKSQ
ACCA_CUPPJ      ---MKT----TFLDFEQPIAELEAKIEELRFVQDD--------SAVDISEEISRLAGKSQ
ACCA_RALSO      ---MKT----TFLEFEQPIAELEAKIEELRFVQDD--------SAVDISEEISRLAAKSQ
ACCA_NEIMA      ---MKP----VFLDFEQPIAELTNKIDELRFVQDE--------SAVDISDEIHRLQKKSN
ACCA_NEIMB      ---MKP----VFLDFEQPIAELTNKIDELRFVQDE--------SAVDISDEIHRLQKKSN
ACCA_NEIG1      ---MKP----VFLDFEQPIAELTNKIDELRFVQDE--------SAVDISDEIHRLQKKSN
ACCA_CHRVO      ---MKP----TFLDFEQPIAELENKIEELRFVQDD--------SVLDISEEIARLQKKSL
ACCA_NITEU      ---MKI----VFLDFEKGIEEFEAKIEQLRFAQDN--------SALDISAEIARLQTKSL
ACCA_THIDA      ---MKT----TFLDFEQPIAELEAKIEELRFVQDD--------SALDISEEIRRLQKKSQ
ACCA_BLOFL      ---MDL----NCLDFEQPILKIESKIHSLMKLIHHD-----KKLAINIYEKINHLKQKSV
ACCA_BLOPB      ---MGL----NVLDFEKPILDLEEKINSLTSIVHSD-----KKSKKNVNAEINRLRSKSI
ACCA_WIGBR      ---MNL----TFLDFEQPIADLESKINSLVELSQRD-----K--TLNINKEINCLRKKSE
ACCA_IDILO      ---MSL----NFLDFEQPIAELEAQIEELKSVGNR------GQLDLNLEEEVQRLTTKSQ
ACCA_PSEHT      ---MSL----NYLDFELPIAELEVKIEELQNVSRA------GELDLELEEEVSKLKEKSD
ACCA_COLP3      ---MSL----NFLDFEQPIAELDAKIEELQLVNNG------QELDLDIEDQISQLREKNK
ACCA_ECOLI      ---MSL----NFLDFEQPIAELEAKIDSLTAVSRQD-----EKLDINIDEEVHRLREKSV
ACCA_ECO57      ---MSL----NFLDFEQPIAELEAKIDSLTAVSRQD-----EKLDINIDEEVHRLREKSV
ACCA_SHIFL      ---MSL----NFLDFEQPIAELEAKIDSLTAVSRQD-----EKLDINIDEEVHRLREKSV
ACCA_SHIDS      ---MSL----NFLDFEQPIAELEAKIDSLTAVSRQD-----EKLDINIDEEVHRLREKSV
ACCA_SHIBS      ---MSL----NFLDFEQPIAELEAKIDSLTAVSRQD-----EKLDINIDEEVHRLREKSV
ACCA_SHISS      ---MSL----NFLDFEQPIAELEAKIDSLTAVSRQD-----EKLDINIDEEVHRLREKSV
ACCA_ECOL6      ---MSL----NFLDFEQPIAELEAKIDSLTAVSRQD-----EKLDINIDEEVHRLREKSV
ACCA_SALTI      ---MSL----NFLDFEQPIAELEAKIDSLTAVSRQD-----EKLDINIDEEVHRLREKSV
ACCA_SALTY      ---MSL----NFLDFEQPIAELEAKIDSLTAVSRQD-----EKLDINIDEEVHRLREKSV
ACCA_SALCH      ---MSL----NFLDFEQPIAELEAKIDSLTAVSRQD-----EKLDINIDEEVHRLREKSV
ACCA_SALPA      ---MSL----NFLDFEQPIAELEAKIDSLTAVSRQD-----EKLDINIDEEVHRLREKSV
ACCA_PECAS      ---MSL----NFLDFEQPIAELEAKIDSLTAVSRQD-----EKLDINLDEEVQRLREKSV
ACCA_YERPE      ---MSL----NFLDFEQPIAELEAKIDSLTAVSRQD-----EKLDINLDEEVQRLREKSV
ACCA_YERPS      ---MSL----NFLDFEQPIAELEAKIDSLTAVSRQD-----EKLDINLDEEVQRLREKSV
ACCA_PHOLL      ---MSL----NFLEFEQPIAELEAKIDSLTAVSRQG-----EKLDINLDEEVQRLREKSL
ACCA_VIBVU      ---MSL----NFLEFEKPIAELEAKIEALRDVSRHG-----GDSAIDLDKEIEQLEKKSL
ACCA_VIBVY      ---MSL----NFLEFEKPIAELEAKIEALRDVSRHG-----GDSAIDLDKEIEQLEKKSL
ACCA_VIBPA      ---MSL----NFLEFEKPIAELEAKIEALRDVSRHG-----GDSAIDLDKEIEQLEKKSL
ACCA_VIBCH      ---MSL----NFLDFEKPIVELETKIQALRDVSRHS-----TSASVDLDKELEQLEKKSL
ACCA_ALIF1      ---MSL----NFLEFEKPIAELEAKVEALREISRRG-----GENALDLEKEIKQLEDKCL
ACCA_PHOPR      ---MSL----NFLEFEQPIAELEAKIEALRDVSRRD-----ESASVDLDKEIEQLEKKSL
ACCA_HAEIN      ---MNQ----EYLDFELPIAELEAKIEALRA--ASD-----DK--VDLTDEIKRLQKKSN
ACCA_HAEI8      ---MNQ----EYLDFELPIAELEAKIEALRA--ASD-----DK--VDLTDEIKRLQKKSN
ACCA_HAEDU      ---MSQ----EYLDFELPIAELEAKIESLRSVCAQD-----GK--IDLEDEINRLQHKSQ
ACCA_MANSM      ---MSQQNQTEYLDFELPIAELEAKIESLRSVTDQD-----SK--IDLDDEIKRLQKKTA
ACCA_PASMU      ---MAQ----EYLDFELPIAELEAKIESLRSVASQD-----DE--INLDDEIARLQKKSA
ACCA_PSE14      ---MNP----NFLDFEQPIADLQAKIEELRLVGND--------NSLNIGDEISRLQDKSK
ACCA_PSEU2      ---MNP----NFLDFEQPIADLQAKIEELRLVGND--------NSLNIGDEISRLQDKSK
ACCA_PSESM      ---MNP----NFLDFEQPIADLQAKIEELRLVGND--------NSLNIGDEISRLQDKSK
ACCA_PSEF5      ---MNP----NFLDFEQPIADLQAKIEELRLVGND--------NSLNIGDEISRLQDKSN
ACCA_PSEPK      ---MNP----NFLDFEQPIADLQAKIEGLRLVGND--------NSLNISDEIARLQDKSN
ACCA_PSEAE      ---MNP----NFLDFEQPIADLQAKIEELRLVGND--------NALNISDEISRLQDKSK
ACCA_COXBU      ---MNL----DYLDFEQPIAELQAKIDELRRVGTS--------QEINLTEEVNKLEEKNA
ACCA_METCA      ---MDL----KFLDFEQPIAELEAKIEELRHVGFD--------NEINISEEISKLEEKSR
ACCA_LEGPL      ---MTR----QFLEFEQPIEELNQKIEALRMVGSD--------NEVNLSEEIARLEAKCS
ACCA_LEGPA      ---MTR----QFLEFEQPIEELNQKIEALRMVGSD--------NEVNLSEEIARLEAKCS
ACCA_LEGPH      ---MTR----QFLEFEQPIEELNQKIEALRMVGSD--------NEVNLSEEIARLEAKCS
ACCA_XANAC      ---MNP----NYLDFEQPIADLEAKIQELRKASTG--------PAVNVETEVRALRDKLR
ACCA_XANC5      ---MNP----NYLDFEQPIADLEAKIQELRKASTG--------PAVNVETEVRALRDKLR
ACCA_XANCP      ---MNP----NYLDFEQPIADLEAKIQELRKASTG--------PAVNVDAEVRALRDKLR
ACCA_XANC8      ---MNP----NYLDFEQPIADLEAKIQELRKASTG--------PAVNVDAEVRALRDKLR
ACCA_XANOR      ---MNP----NYLDFEQPIADLEAKIQELRKASTG--------PAVNVETEVRALRDKLR
ACCA_XYLFA      ---MNP----NYLDFEQPIADLEAKIQELHTASMG--------PSINVDTEVRALENKLR
ACCA_XYLFT      ---MNP----NYLDFEQPIADLEAKIQDLRTASAG--------PSVNVDIEVRALENKLR
ACCA_CAMJE      ---MAS-----YLDFEKNIQQIDEDIINAQIKGDT----------EAVSILKKNLEKE--
ACCA_CAMJR      ---MAS-----YLDFEKNIQQIDEDIINAQIKGDT----------EAVSILKKNLEKE--
ACCA_HELHP      ---MAT-----YLDFEQKIKNLQDDIESAIISGDN----------DAISILEKELEKE--
ACCA_WOLSU      ---MAT-----YLDFEQKIKNIQDEIESSIVKGDS----------HAKEILERELKKE--
ACCA_HELPY      ---MAV-----YLDFENHIKEIQNEIELALIRGDE----------DAKEILEKRLDKE--
ACCA_HELPJ      ---MAI-----YLDFENHIKEIQNEIELALIRGDE----------DAKEILEKRLDKE--
ACCA_FRATT      ----MN-----YLDFESKIKEIEDKITSLSHVFED----------EKTEVEIKKLSKKRL
ACCA_RHOBA      -------MAGPGLEFENEIADLEEQIASLERNTDRS---------EEIDSAIRSLRLARV
ACCA_AQUAE      ----MILFKVMHLEFEKELLEIKEKIDRLLGLYRLG--------KEEVLSELDELRKKFK
ACCA_AGRFC      --------MHNYLDFEKPISDLEGKIIELKKLADEDE------SIDTSEE-INRLESRVN
ACCA_RHIME      --------MHNYLDFEKPISDLEGKILELKKLASEDE------SVNTSDE-IARLEGRVR
ACCA_BRUME      --------MYNYLDFEKPVADLEGQILELKKLAQEQG------SVEMGDE-ISRLEKRSA
ACCA_BRUSU      --------MYNYLDFEKPVADLEGQILELKKLAQEQG------SVEMGDE-ISRLEKRSA
ACCA_BRUAB      --------MYNYLDFEKPVADLEGQILELKKLAQEQG------SVEMGDE-ISRLEKRSA
ACCA_RHILO      --------MYNYLDFEKPVQDLELKILELKKLAENGE------AVDVADE-ITRLEKRSR
ACCA_NITWN      ----MPDPMRSYLDFEKPVAELDSKIDELRALAASG--------SDISEE-ISSIEEKAA
ACCA_RHOPA      ----MSGPMRSYLDFEKPVAELDSKIDELRTLAASG--------SDIHEE-IEKIEEKAQ
ACCA_ZYMMO      --------MVSYLDFEKPVAELQTRIAELRKATSDE--------MDLDRE-ISDLEVKVQ
ACCA_CAUVC      -------MAAHYLDFERPIADLESKIEELSRLSETAG------PGAFDTE-IQALRDRAQ
ACCA_RHOS4      ---------MNYLEFEKPLSEIEGKAEELRALARGNR------EMDVEKE-ASALDKKAE
ACCA_RUEPO      --------MTQYLDFEKPLAEIEGKAEELRALARANE------EMDVAEE-AAALDAKAA
ACCA_PELUB      --------MKNYLNFETDIKNLEIEIDKLKDPYNQDG------LSEVDTKKISESQKEID
                                                                            

ACCA_BACAN      NLEEDIYGNMKVWDRVQIARHAERPTTLDYIEHLFTDFFECHGDRLFGDDAAIVGGIAKY
ACCA_BACCZ      NLEEDIYGNMKVWDRVQIARHAERPTTLDYIEHLFTDFFECHGDRLFGDDAAIVGGIAKY
ACCA_BACHK      NLEEDIYGNMKVWDRVQIARHAERPTTLDYIEHLFTDFFECHGDRLFGDDAAIVGGIAKY
ACCA_BACCR      NLEEDIYGNLKVWDRVQIARHAERPTTLDYIEHLFTDFFECHGDRLFGDDAAIVGGIAKY
ACCA_BACLD      RLEEDIYTNLKAWDRVQIARHPNRPTTLDYIEHLFTDFFECHGDRYFGDDEAIVGGIAKF
ACCA_BACSU      KLQDDIYKNLKPWDRVQIARLADRPTTLDYIEHLFTDFFECHGDRAYGDDEAIVGGIAKF
ACCA_GEOKA      KLENEIYANLTPWDRVQIARHPQRPTTLDYIERLFTNFLECHGDRCFGDDEAIVGGIAKY
ACCA_BACHD      ALEENIYGNLKPWQRVQIARHGERPTTLDYIEQLFSDFLEMHGDRLYGDDEAIVAGIAKY
ACCA_OCEIH      RLEEDIYGNLKPWNRVQMARHPDRPTTMDYIERIFTDFIEFHGDRFYGEDEAIISGIGYY
ACCA_LISMO      KLESSIYSNMTAWDKFQVARHPERPTTLDYISLLFEDFMELHGDRTFGDDAAIVGGIATF
ACCA_LISMF      KLESSIYSNMTAWDKFQVARHPERPTTLDYISLLFEDFMELHGDRAFGDDAAIVGGIATF
ACCA_LISIN      KLEASIYSNMTAWDKFQVARHPERPTTLDYISLLFEDFMELHGDRTFGDDAAIVGGIATF
ACCA_BACSK      ELEEEVYANLQPWERVQIARDHERPTTLDYVDVLFEDFLEMHGDRLFGDDKAIVGGIATY
ACCA_STAAC      RETKKIYTNLKPWDRVQIARLQERPTTLDYIPYIFDSFMELHGDRNFRDDPAMIGGIGFL
ACCA_STAAS      RETKKIYTNLKPWDRVQIARLQERPTTLDYIPYIFDSFMELHGDRNFRDDPAMIGGIGFL
ACCA_STAAW      RETKKIYTNLKPWDRVQIARLQERPTTLDYIPYIFDSFMELHGDRNFRDDPAMIGGIGFL
ACCA_STAAR      RETKKIYTNLKPWDRVQIARLQERPTTLDYIPYIFDSFMELHGDRNFRDDPAMIGGIGFL
ACCA_STAAM      RETKKIYTNLKPWDRVQIARLQERPTTLDYIPYIFDSFMELHGDRNFRDDPAMIGGIGFL
ACCA_STAAN      RETKKIYTNLKPWDRVQIARLQERPTTLDYIPYIFDSFMELHGDRNFRDDPAMIGGIGFL
ACCA_STAHJ      RETKKIYTNLKPWDRVQIARLQERPTTLDYIPYIFDSFIELHGDRNFRDDPAMIGGIGYL
ACCA_STAES      RETTKVYTNLKPWDRVQIARLPERPTTLDYIPYIFDSFIELHGDRSFRDDPAMIGGIGYL
ACCA_STAEQ      RETTKVYTNLKPWDRVQIARLPERPTTLDYIPYIFDSFIELHGDRSFRDDPAMIGGIGYL
ACCA_STAS1      RETEKVYTNLKPWDRVQLARLQERPTSLDYIPHIFDSFIELHGDRNYRDDPAMIGGIGYL
ACCA_CLOAB      ---MENSQELTPWQRLTIARMLERPTSLEYIDLIFDSFMEFHGDRAFGDDAAIVGGVAEF
ACCA_CLOPE      -MSRELIRTADAWNKVKIARDPNRPNAKFYINEIFDEFIELHGDRNFGDDKAIIGGIALL
ACCA_STRPN      ---------MNIAKIVREAREQSRLTTLDFATGIFDEFIQLHGDRSFRDDGAVVGGIGWL
ACCA_STRR6      ---------MNIAKIVREAREQSRLTTLDFATGIFDEFIQLHGDRSFRDDGAVVGGIGWL
ACCA_STRT2      --------MSDVARILKEARDQGRLTALDFAKEIFDDFIELHGDRNFRDDGAVIGGIGRL
ACCA_STRT1      --------MSDVARILKEARDQGRLTALDFAKEIFDDFIELHGDRNFRDDGAVIGGIGRL
ACCA_ENTFA      ------MEKKTANDVVTLARAQDRLTTLEYIEAIFEDFLEFHGDRYFADDLAVVGGVATL
ACCA_CARHZ      QLAKEIYQNLTPWQRVLLARHPERPNTRDYINYLCDDFIELKGDRRFGDDPAMIGGIGII
ACCA_TREDE      SST----ALSKTWERVELARHSDRPRTLDYINLIFDNFTELHGDRFFGDDPAMIGGIGFI
ACCA_CHLMU      RLKEKIYSNLTPWERVQICRHPSRPRTINYIEGMCEEFVELCGDRTFRDDPAVVGGFAKI
ACCA_CHLTR      RLKEKIYSDLTPWERVQICRHPSRPRTVNYIEGMCEEFVELCGDRTFRDDPAVVGGFAKI
ACCA_CHLAB      KLKEKIYADLTPWERVQICRHPSRPRSVNYIEGMCEEFVELCGDRTFRDDPAVVGGLAKI
ACCA_CHLCV      KLKEKIYSDLTPWERVQICRHPSRPRSVNYIEGMCEEFVELCGDRTFRDDPAVVGGLAKI
ACCA_CHLPN      KLKEKIYSDLTPWERVQICRHPSRPRTVNYIEGMCEEFVELCGDRTFRDDPAVVGGFVKI
ACCA_PARUW      SLKQHVYSELTPWQRIMICRHPSRPHAVDFIRHLSESFVELAGDRSYREDHAIVGGLAKI
ACCA_FUSNN      IALKVLYDDLTDYQRVMVSRHPERPYTLDYINYITTDFIELHGDRLFRDDPAIVGGLCKI
ACCA_NOSS1      QLREEIFSTLSPSQRLQVARHPRRPSTLDYIQAISDEWMELHGDRCGGDDPALIGGVARL
ACCA_SYNY3      QLRQEIFSNLNPSQRLQLARHPRRPSTLDYIQAIADDWFEMHGDRGGYDDPALVGGVARL
ACCA_SYNP6      QLRREIFSNLSPAQRIQVARHPRRPSTLDYIQAISDEWIELHGDRNGSDDLALVGGVGAL
ACCA_SYNE7      QLRREIFSNLSPAQRIQVARHPRRPSTLDYIQAISDEWIELHGDRNGSDDLALVGGVGAL
ACCA_THEEB      QLRYEIFSKLTPGQTLQVARHPRRPSTLDYIQAISEEWIELHGDRRGSDDPAIVGGIGRL
ACCA_PROMA      RRREEIFSALTPAEKIQVARHPQRPSTLDFIQMFCEDWIELHGDRNCSDDSALIGGIARI
ACCA_PROMT      RRREEIFNALTPAQKIQVARHPQRPSTLDYIQMFCDDWVELHGDRNGTDDQALIGGLARI
ACCA_PROMM      RRREEIFQALTPAEKIQVARHPHRPSTLDFIQMFCDDWVELHGDRRGSDDQALVGGVGRI
ACCA_SYNPX      RRRQEIFQGLTPAQKIQVARHPHRPSTLDFIQMFCDDWIELHGDRRGNDDQALVGGVGRL
ACCA_PROMP      RRREEIFRSLTPAQKIQVARHPQRPSTLDFIQMFCDDWIELHGDRNGGDDMALIGGLGSV
ACCA_GLOVI      ELRRDLYANLPPKDILQLARNPKRPSTLDYIQLLCEDWVELHGDRLFGDDLALVGGLARL
ACCA_ANTSP      KIKIEIFQSLTPLQRLHLVRQVDRPTTLDYIGHILDDWIELHGDRGGTDDPALIGGLGKI
ACCA_GRATL      ILKYEVFQSLTPLQRLHLVRQADRPTTLDYIPYIMSEWLELHGDRGGKDDPALVGGIGKL
ACCA_PORPU      KLQKEIFSSLTPLQRLNLVRQSERPTTLDYIPNILDEWIELHGDRGGADDPALVGGIGKI
ACCA_CYACA      NLKKQLFYGLTSYQKLCVARHKRRPTTLDYIEYLLDSWIELHGDRRGSDDPAIITGIGRI
ACCA_THET2      RLRKETYENLTPWQRVQLARAPGRPTTLDVLEKAFQDFIELHGDRAFADDPAIVGGLAYL
ACCA_THET8      RLRKETYENLTPWQRVQLARASGRPTTLDVLEKAFQDFIELHGDRAFADDPAIVGGLAYL
ACCA_DEIRA      TLRREHAAGLSRWDRVQLARTPGRPTALDYVDRLCSDWTELHGDRRFGDDPALIGGPARW
ACCA_GEOSL      RMREVIFSNLSRWQTVQVARHIERPFTLDYLNLIFTDFTELHGDRLFGDDHAIVAGLAKL
ACCA_PELCD      KLRREIFSNLNRWQVTQLARHVNRPFTLDFVEHVFTDWFEVHGDRNFRDDPALVCGFARL
ACCA_CHLTE      SLRKTIYKNLTRWQKVQLARHPERPYTLDYIYMMMKDFVELSGDRNFGDDKAIIGGFARL
ACCA_AROAE      TLSKNLYAKLTPWQIAQVSRHPQRPYTLDYARHIFTDFVELHGDRTYADDKAIVGGLARF
ACCA_DECAR      QLTKDIYAKLTPWQISQVARHPQRPYTLDYLSLIFTDFEELHGDRAFADDHAIVGGLARF
ACCA_BORBR      NLAKEIYGKLTPWQTALVARHPQRPYTLDYVREIFTDFHELHGDRMYADDQSIVGGLARF
ACCA_BORPA      NLAKEIYGKLTPWQTALVARHPQRPYTLDYVREIFTDFHELHGDRMYADDQSIVGGLARF
ACCA_BORPE      NLAKEIYGKLTPWQTALVARHPQRPYTLDYVREIFTDFHELHGDRMYADDQSIVGGLARF
ACCA_BURMA      QLTKDLYANLTPWQVSQIARHPQRPYTLDYVSELFTDFHELHGDRAFADDQSIVGGLARF
ACCA_BURPS      QLTKDLYANLTPWQVSQIARHPQRPYTLDYVSELFTDFHELHGDRAFADDQSIVGGLARF
ACCA_CUPPJ      QLTKDIYANLTPWQVAQIARHPQRPYTLDYVREIFTDFHELHGDRTFADDLSIVGGLARF
ACCA_RALSO      QLTKDLYATLSPWQVAQIARHPQRPYTLDYVREIFTDFHELHGDRTFADDLSIVGGLARF
ACCA_NEIMA      DLTKSIFSKLTPAQISQVSRHPQRPYTLDYIEALFTDFEELHGDRHFADDYAIVGGLARF
ACCA_NEIMB      DLTKSIFSKLTPAQISQVSRHPQRPYTLDYIEALFTDFEELHGDRHFADDYAIVGGLARF
ACCA_NEIG1      DLTKSIFSKLTPAQISQVSRHPQRPYTLDYIDALFTDFEELHGDRHFADDHAIVGGLARF
ACCA_CHRVO      ELTKTLYAKLTPSQIAMVARHPQRPYTLDYIQAIFTDFEELHGDRAFADDAAIVGGLARF
ACCA_NITEU      GLTKSVYAKLTPWQISQVARHPQRPYTLDYVQHLFTDFEELHGDRNFADDQAIVGGLARF
ACCA_THIDA      ALTKDIYAKLNAWQVSQVARHPQRPYTLDYIQGLFTDFVELHGDRAYADDAAIVGGMARF
ACCA_BLOFL      ELTQKIFSNLSAWQIAQLARHPYRPYTLDYIAYIFDDFDELSGDRVYGDDKAIVGGIGRL
ACCA_BLOPB      ELTQKIFSNLNAWQVAQLARHPRRPYTLDYIERIFNDFDELSGDRVYADDKAIVGGIARL
ACCA_WIGBR      DLTKKIFSNLNAWQITKIARHPMRPYALDYIKNIFTDFDELSGDRLYGDDKSIIGGIARL
ACCA_IDILO      ELTEKIFSDLGAWQVAQLARHPLRPYTLDYIRMIFTEFDEMAGDRSFANDEAIVGGIARL
ACCA_PSEHT      RLKEKIFSELGAWQVSQLARHPLRPYTRDYIERIFTEFDEFAGDRTFANDPAILGGIARL
ACCA_COLP3      EQTKKIFSNLDAWQTARVARHPQRPYSLDYIPRIFTEFDELAGDRAYANDNAIVGGTARL
ACCA_ECOLI      ELTRKIFADLGAWQIAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGGIARL
ACCA_ECO57      ELTRKIFADLGAWQIAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGGIARL
ACCA_SHIFL      ELTRKIFADLGAWQIAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGGIARL
ACCA_SHIDS      ELTRKIFADLGAWQIAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGGIARL
ACCA_SHIBS      ELTRKIFADLGAWQIAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGGIARL
ACCA_SHISS      ELTRKIFADLGAWQIAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGGIARL
ACCA_ECOL6      ELTRKIFADLGAWQIAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGGIARL
ACCA_SALTI      ELTRKIFADLGAWQVAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGGIARL
ACCA_SALTY      ELTRKIFADLGAWQVAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGGIARL
ACCA_SALCH      ELTRKIFADLGAWQVAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGGIARL
ACCA_SALPA      ELTRKIFADLGAWQVAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGGIARL
ACCA_PECAS      ELTRKIFADLGAWQVAQLARHPQRPYTLDYIKHIFTDFDELAGDRAYADDKAIVGGIARL
ACCA_YERPE      ELTRKIFSDLGAWQIAQLARHPRRPYTLDYIANIFTDFEELAGDRAYADDKAIVGGIARL
ACCA_YERPS      ELTRKIFSDLGAWQIAQLARHPRRPYTLDYIANIFTDFEELAGDRAYADDKAIVGGIARL
ACCA_PHOLL      ELTRKIFSDLGAWQIAQLARHPRRPYTLDYIQHIFTDFEELAGDRAYADDKAIVGGLARI
ACCA_VIBVU      ELKKKIFSDLGAWETAQLARHPQRPYTLDYVKHVFEEFDELAGDRAYADDKAIVAGIARL
ACCA_VIBVY      ELKKKIFSDLGAWETAQLARHPQRPYTLDYVKHVFEEFDELAGDRAYADDKAIVAGIARL
ACCA_VIBPA      ELKKKIFSDLGAWETAQLARHPLRPYTLDYVQHVFEEFDELAGDRAFADDKAIVGGIARL
ACCA_VIBCH      ELKKKIFSDLGAWQVAQLARHPQRPYTLDYLKHIFTEFDELAGDRAYADDKAIVGGIARL
ACCA_ALIF1      ELKKKTFSDLGAWEVAQLARHPERPYVLDYIEHMFTEFDELAGDRAFADDKALVGGIARL
ACCA_PHOPR      ELTKKIFSNLGAWQVAQLARHPERPYVFDYIEHIFTEFDALAGDRAFADDKALVGGIARL
ACCA_HAEIN      ELTKKTFANLDAWQVSRMARHPNRPYTLDYIEHIFTEFEELAGDRAFADDKAIVGGLARL
ACCA_HAEI8      ELTKKTFANLDAWQVSRMARHPNRPYTLDYIEHIFTEFEELAGDRAFADDKAIVGGLARL
ACCA_HAEDU      ELTKKTFANLDAWQVSRMARHPNRPYTLDYIEHIFTEFDELAGDRAFADDKAIVGGIARL
ACCA_MANSM      ELTKKTFADLDAWQVSRMARHPNRPYTLDYISRIFTEFEELAGDRAFADDKAIVGGLARL
ACCA_PASMU      ELTKKTFANLDAWQVSKMARHPNRPYTLDYIERIFTEFEELAGDRAFADDKAIVGGLARL
ACCA_PSE14      TLTESIFGNLTSWQIARMARHPRRPYTLDYIENIFTEFDELHGDRHFSDDAAIVGGIARL
ACCA_PSEU2      TLTESIFGNLTSWQIARMARHPRRPYTLDYIENIFTEFDELHGDRHFSDDAAIVGGIARL
ACCA_PSESM      TLTESIFGNLTSWQIARMARHPRRPYTLDYIENIFTEFDELHGDRHFSDDAAIVGGIARL
ACCA_PSEF5      TLTEDIFGKLTSWQIARLARHPRRPYTLDYIQHIFTEFDELHGDRHFSDDAAIVGGVARL
ACCA_PSEPK      TLTESIFGNLTSWQIARLARHPRRPYTLDYLEHIFTEFEELHGDRHFSDDAAIVGGTARL
ACCA_PSEAE      ALTENIFGNLSSWQIAQLARHPKRPYTLDYIGYLFSDFEELHGDRHFADDPAIVGGVARL
ACCA_COXBU      QLTRQIFSNLTAQQIVQLARHPLRPYTLDYIQRIFTDFNELHGDRHYSQASAIIGGLARL
ACCA_METCA      KLTESVFSSLSAWQISQISRHPQRPHSRDYIDLIFQEFHELHGDRAFADDPAIIGGLARL
ACCA_LEGPL      ELTENIFSRLEPWQIAQMARHPLRPQTTDYIERIFTDFQELHGDRSYSSAPAIIGGMARL
ACCA_LEGPA      ELTENIFSRLEPWQIAQMARHPLRPQTTDYIERIFTDFQELHGDRSYSSAPAIIGGMARL
ACCA_LEGPH      ELTENIFSRLEPWQIAQMARHPLRPQTTDYIERIFTDFQELHGDRSYSSAPAIIGGMARL
ACCA_XANAC      VRTAQIFRDLSAWQVSQLARHPQRPYTLDYINTICDEFHELAGDRAYADDKAIVGGLGRI
ACCA_XANC5      VRTAQIFRDLSAWQVSQLARHPQRPYTLDYIDTICDEFQELAGDRAYADDKAIVGGLGRI
ACCA_XANCP      VRTAQIFRDLSAWQVSQLARHPQRPYTLDYINTMCDEFQELAGDRAYADDKAIVGGLGRI
ACCA_XANC8      VRTAQIFRDLSAWQVSQLARHPQRPYTLDYINTMCDEFQELAGDRAYADDKAIVGGLGRI
ACCA_XANOR      VRTAQIFRDLSAWQVSQLARHPQRPYTLDYINTICDEFQELAGDRAYADDKAIVGGLGRI
ACCA_XYLFA      LRTAQIFRNLSAWQISQLARHPRRPYTLDYISVVCDEFQELAGDRALADDKAIVGGLARI
ACCA_XYLFT      LRTAQIFRNLSAWQISQLARHPRRPYTLDYISIVCDEFQELAGDRTLADDKAIVGGLARI
ACCA_CAMJE      --ISKTYKNLSDFQRLQLARHPDRPYALDYIELILNDAHEIHGDRAFRDDPAIVCFMGYL
ACCA_CAMJR      --ISKTYKNLSDFQRLQLARHPDRPYALDYIELILNDAHEIHGDRAFRDDPAIVCFMGYL
ACCA_HELHP      --VSSVYSNISDYQKLQLARHPDRPYAMDYIESILKNPYEINGDRHFKDDKAIVCFLGKI
ACCA_WOLSU      --VERVYSNLSDYQKLQLARHPDRPYAMDYIKLILKDAYEIHGDRHFSDDGAIVAFLGYI
ACCA_HELPY      --VKSIYSNLTDFQKLQLARHPDRPYAMDYIDLILKDKYEVFGDRHYNDDKAIVCFVGKI
ACCA_HELPJ      --VKSIYSNLTDFQKLQLARHPDRPYAMDYIDLILKDKYEVFGDRHYNDDKAIVCFIGKI
ACCA_FRATT      ELMESTYSKLTDWQVVQLSRHPDRPYFKDLLPLIFTDFQELHGDRTFGDDLAVIGGLAKL
ACCA_RHOBA      AKLKETYSSLDPWQTVQVARHKNRPYTRDYLNLAFDEFVELHGDKHFGDDRAMLSGFAKL
ACCA_AQUAE      EKARKIYRDLSPWERVQVARHPKRPHTSDYIKYLIKDFEEVHGDTCYGDDKAVIAGFGYF
ACCA_AGRFC      DAMQDIYSKLNAWQKTQVARHPQRPHFVDYAKSLFTDFTPLAGDRKFSEDAAIQAGLARF
ACCA_RHIME      DAMVEIYSKLSPWQKTQVARHPSRPHFLDYASRLFTEFTPLAGDRNFANDDAIQAGLARF
ACCA_BRUME      DALKDIYRKLTPWQKAQIARHPDRPHCLEYIDRLFTEFTPLAGDRKFANDEALQAGFGRF
ACCA_BRUSU      DALKDIYRKLTPWQKAQIARHPDRPHCLEYIDRLFTEFTPLAGDRKFANDEALQAGFGRF
ACCA_BRUAB      DALKDIYRKLTPWQKAQIARHPDRPHCLEYIDRLFTEFTPLAGDRKFANDEALQAGFGRF
ACCA_RHILO      DALRDLYKALTPWQKVQVARHSDRPHCVDYIKGLFSDFTPLAGDRNFGEDQAIVGGFARF
ACCA_NITWN      QALKDLYANLTPWQKTQVARHPQRPHFSDFVKGLITEFTPLAGDRKFGEDEALIGGFGRF
ACCA_RHOPA      QALQDLYAALTPWQKTQVARHPQRPHCVDYIEGLIAEFTPLAGDRKFGDDEALVGGFGRF
ACCA_ZYMMO      KLLRDTYAHLTPWQKTQVARHPERPHFHDYISALCEEFIPLAGDRLFGEDEAIIGGLARI
ACCA_CAUVC      ELRKEAYANLDAWQKTMVARHPQRPHLRDYVAGLIDEFVELRGDRKFADDQAIVGGLGRF
ACCA_RHOS4      TLLKDLYKDLTPWRKCQVARHPDRPHCKDYIEGLFTEYTPLAGDRNFADDHAIMGGLARF
ACCA_RUEPO      KLLDELYRDLTPWRKCQVARHPERPHCRDYVDALFTEYTPLAGDRNFADDLAVMGGLARF
ACCA_PELUB      NKLQEIYSNLDPWQTTLVARHEDRPKAKFFIDNLFEDFIPLSGDRYYGEDKSVLAGFAKF
                                   *   *            .     **    .  ::       

ACCA_BACAN      K------GMPVTVIGHQRGKDTKENIRRNFGMPHPEGYRKALRLMKQAEKFNRPIICFID
ACCA_BACCZ      K------GMPVTVIGHQRGKDTKENIRRNFGMPHPEGYRKALRLMKQAEKFNRPIICFID
ACCA_BACHK      K------GMPVTVIGHQRGKDTKENIRRNFGMPHPEGYRKALRLMKQAEKFNRPIICFID
ACCA_BACCR      K------GMPVTVIGHQRGKDTKENIRRNFGMPHPEGYRKALRLMKQAEKFNRPIICFID
ACCA_BACLD      R------GLPVTVIGQQRGKDTKENIRRNFGMPHPEGYRKALRLMKQADKFNRPIICFID
ACCA_BACSU      H------GLPVTVIGHQRGKDTKENLVRNFGMPHPEGYRKALRLMKQADKFNRPIICFID
ACCA_GEOKA      D------GLPVTVIGHQRGKDTKENLRRNFGMPHPEGYRKALRLMKQAEKFSRPIICFID
ACCA_BACHD      K------GQPVTVIGHQRGKDTKENIRRNFGMPHPEGYRKALRLMKQAEKFHRPVICFID
ACCA_OCEIH      K------DSPVTVIGHQRGKDTKENIRRNFGMPHPEGYRKALRHMQQAEKFNRPIITFID
ACCA_LISMO      K------GIPVTVIGHQRGKDTKDNLHRNFGMPHPEGFRKALRLMKQADKFGRPIICFID
ACCA_LISMF      H------GIPVTVIGHQRGKDTKDNLHRNFGMPHPEGFRKALRLMKQADKFGRPIICFID
ACCA_LISIN      K------GTPVTVIGHQRGKDTKDNLHRNFGMPHPEGFRKALRLMKQADKFGRPIICFID
ACCA_BACSK      K------GKPVTVIGHQRGKDTKENIVRYFGSPHPEGYRKALRLMKQAEKFKRPIICFID
ACCA_STAAC      N------GRAVTVIGQQRGKDTKDNIYRNFGMAHPEGYRKALRLMKQAEKFNRPIFTFID
ACCA_STAAS      N------GRAVTVIGQQRGKDTKDNIYRNFGMAHPEGYRKALRLMKQAEKFNRPIFTFID
ACCA_STAAW      N------GRAVTVIGQQRGKDTKDNIYRNFGMAHPEGYRKALRLMKQAEKFNRPIFTFID
ACCA_STAAR      N------GRAVTVIGQQRGKDTKDNIYRNFGMAHPEGYRKALRLMKQAEKFNRPIFTFID
ACCA_STAAM      N------GRAVTVIGQQRGKDTKDNIYRNFGMAHPEGYRKALRLMKQAEKFNRPIFTFID
ACCA_STAAN      N------GRAVTVIGQQRGKDTKDNIYRNFGMAHPEGYRKALRLMKQAEKFNRPIFTFID
ACCA_STAHJ      N------GTPVTVIGQQRGKDTKDNIYRNFGMAHPEGYRKALRLMKQAEKFNRPIFTFID
ACCA_STAES      D------GKSVTVIGQQRGKDTKDNIYRNFGMAHPEGYRKALRLMKQAEKFNRPIFTFID
ACCA_STAEQ      D------GKSVTVIGQQRGKDTKDNIYRNFGMAHPEGYRKALRLMKQAEKFNRPIFTFID
ACCA_STAS1      N------GQAVTVVGQQRGKDTKDNIYRNFGMAHPEGYRKALRLMKQAEKFNRPIFSFID
ACCA_CLOAB      N------GMPVTVIGQQKGRNTNENIKRNFGMPSPEGYRKALRLMKQAEKFNRPLICFVD
ACCA_CLOPE      N------NLSFTVVGICKGENTKENIKRNFGMPHPEGYRKALRLMKQAEKFKRPVICFVD
ACCA_STRPN      G------DQAVTVVGIQKGKSLQDNLKRNFGQPHPEGYRKALRLMKQAEKFGRPVVTFIN
ACCA_STRR6      G------DQAVTVVGIQKGKSLQDNLKRNFGQPHPEGYRKALRLMKQAEKFGRPVVTFIN
ACCA_STRT2      N------GQAVTVVGIQKGKNLQDNLNRNFGQPHPEGYRKALRLMKQAEKFGRSVVTFIN
ACCA_STRT1      N------GQAVTVVGIQKGKNLQDNLNRNFGQPHPEGYRKALRLMKQAEKFGRPVVTFIN
ACCA_ENTFA      Q------GKPVTVVGIQKGRNLPENIERNFGSPNPEGYRKALRLMKQAEKFNRPVITFVN
ACCA_CARHZ      E------NIPVTIVGNLKGKDTKENIMRNFGMAHPEGYRKAIRLFKQAEKFGRPVLTFID
ACCA_TREDE      D------GMPVTVIGTQKGRNLRETIDRNGGMANPEGYRKAMRLAKQAEKFKRPIITFID
ACCA_CHLMU      Q------GQRFMLIGQEKGCDTTSRMHRNFGMLCPEGFRKALRLAKMAEKFGLPIIFLVD
ACCA_CHLTR      Q------GQRFMLIGQEKGCDTKSRMHRNFGMLCPEGFRKALRLAKMAEKFGLPIIFLVD
ACCA_CHLAB      Q------GQRFMLIGQEKGCDTSSRMHRNFGMLCPEGFRKALRLAKMAEKFGLSIVFLVD
ACCA_CHLCV      Q------GQRFMLIGQEKGCDTASRVHRNFGMLCPEGFRKALRLAKMAEKFGLPIVFLVD
ACCA_CHLPN      Q------GQRFVLIGQEKGCDTASRLHRNFGMLCPEGFRKALRLGKLAEKFGLPVVFLVD
ACCA_PARUW      G------GIKCVVIGQEKGFDTESRVYRNFGMLNPEGFRKALRLMQMAEKFQLPIISLLD
ACCA_FUSNN      D------GKNFMIIGHQKGRTMQEKVFRNFGMANPEGYRKALRLYEMAERFKLPILTFID
ACCA_NOSS1      G------GKPVVILGHQKGRDTKDNIARNFGMATPGGYRKAMRLMEHANKFSMPILTFID
ACCA_SYNY3      G------TRPVVIMGHQKGRDTKDNVARNFGMAAPNGYRKALRLMEHADRFGMPIITFID
ACCA_SYNP6      D------GQPVVFLGHQKGRDTKDNVLRNFGMASPGGYRKALRLMEHADRFGMPILTFID
ACCA_SYNE7      D------GQPVVFLGHQKGRDTKDNVLRNFGMASPGGYRKALRLMEHADRFGMPILTFID
ACCA_THEEB      N------DQPVVMLGQQKGRDTKDNVARNFGMASPGGYRKALRLMEHANRFQMPILTFID
ACCA_PROMA      E------DIPVLLIGQQKGRDTKENVARNFGMAKPSGYRKALRLMNHADKFNLPIISFID
ACCA_PROMT      G------EKSVLLIGQQKGRDTKENVARNFGMAKPGGYRKALRLMDHADRFNLPIISFID
ACCA_PROMM      G------KRSVLLIGHQKGRDTKENVARNFGMATPGGYRKALRLMDHADRFRLPILTFID
ACCA_SYNPX      G------DQPVLLIGHQKGRDTKENVARNFGMATPGGYRKAMRLMEHADRFRLPILSFID
ACCA_PROMP      N------NQPVLLLGHQKGRDTKENVVRNFGMAKPGGYRKALRLMQHADRFSLPILTFID
ACCA_GLOVI      G------DHPVVIMGHQKGRDTKDNIQRNFGMPQPEGYRKALRLMDHANHFQLPIIALID
ACCA_ANTSP      N------NRTVVCIGHQRGKDTKDNVLRNFGMASPGGYRKALRLMKHANRFNFPILTFID
ACCA_GRATL      N------NYTVIFVGHQRGKDTKDNVLRNFGMASPGGYRKALRLMQHANQFNFPILTFID
ACCA_PORPU      D------GHSIVFIGHQRGRGTKENVARNFGMPAPGGYRKALRLMKHANRFGMPILTFID
ACCA_CYACA      G------RRSVVVLGQQKGRNTKENVLRNFGMSSPGGYRKALRVMEHANKFKLPILTFID
ACCA_THET2      E------GEKVVVVGHQKGRDTKENLQRNFGMPHPEGYRKAMRLMDLADRFGYPFLTFVD
ACCA_THET8      E------GEKVVVVGHQKGRDTKENLQRNFGMPHPEGYRKAMRLMDLADRFGYPFLTFVD
ACCA_DEIRA      Q------GRPVMLLLQQKGRDTKTKIKRRFGSANPEGYRKAIRLMDLADRFGLPVVSLID
ACCA_GEOSL      D------GEPVVVIGHQKGRDTKEKVYRNFGMPNPEGYRKALRIMELAERFRLPIITFVD
ACCA_PELCD      D------GQPCAVIGHQKGRDTKEKVYRNFGMPNPEGYRKALRVMQMAEQFGLPIFTFVD
ACCA_CHLTE      EDESAGFSQSVMVIGHQKGRDTKSNLYRNFGMAQPEGYRKALRLMKLAEKFRKPVITLID
ACCA_AROAE      N------GQSCVVIGHQKGRDTKEKILRNFGMPRPEGYRKALRLMRLAEKFGLPVFTFVD
ACCA_DECAR      N------GQPVMVIGHQKGRDTKEKIYRNFGMPRPEGYRKALRLMKLAEKFGIPVMTFVD
ACCA_BORBR      N------GSACMVIGHQKGRDTKERAARNFGMPRPEGYRKALRLMRLAEKFRLPIFTFID
ACCA_BORPA      N------GSACMVIGHQKGRDTKERAARNFGMPRPEGYRKALRLMRLAEKFRLPIFTFID
ACCA_BORPE      N------GSACMVIGHQKGRDTKERAARNFGMPRPEGYRKALRLMRLAEKFRLPIFTFID
ACCA_BURMA      N------GHACMVIGHQKGRDTKERAARNFGMPRPEGYRKAERLMRVAEKFGLPIFTFVD
ACCA_BURPS      N------GHACMVIGHQKGRDTKERAARNFGMPRPEGYRKAERLMRVAEKFGLPIFTFVD
ACCA_CUPPJ      N------GQSCMVIGHQKGRDTKERAMRNFGMPKPEGYRKAKRLMELADKFGLPIFTFVD
ACCA_RALSO      N------GQPCMVIGHQKGRDTKERALRNFGMSKPEGYRKAKRLMELADKFGLPIFTFVD
ACCA_NEIMA      N------GQSVMVVGHQKGRDTKEKIRRNFGMPRPEGYRKALRLMKTAEKFGLPVMTFID
ACCA_NEIMB      N------GQSVMVVGHQKGRDTKEKIRRNFGMPRPEGYRKALRLMKTAEKFGLPVMTFID
ACCA_NEIG1      N------GQSVVVVGHQKGRDTKEKIRRNFGMPRPEGYRKALRLMKTAEKFGLPVMTFID
ACCA_CHRVO      N------GQSVMVIGHQKGRDTKEKIRRNFGMPHPEGYRKALRLMKLAEKFGIPVLTFVD
ACCA_NITEU      N------GQTVMIIGHQKGRDTKEKIHRNFGMPKPEGYRKALRLMRLAEKFSIPLITFID
ACCA_THIDA      N------GEPVMVIGHQKGRDTKEKIFRNFGMPRPEGYRKALRLMRLAEKFRLPILTFID
ACCA_BLOFL      N------SRPVMVIGHQKGRDIQEKIRRNFGMSAPEGYRKALRLMKLAERFNLPIFTFID
ACCA_BLOPB      N------SRPVMIIGHQKGRDTKEKIKRNFGMSAPEGYRKALRLMKMAERFKIPLITFID
ACCA_WIGBR      N------SRPVMILGHQKGRETKEKIFRNFGMPTPEGYRKALRLMKIADRFNMPLITLID
ACCA_IDILO      D------GTPVMVIGQQKGRETKEKIRRNFGMPKPEGYRKALRLMQTAERFKMPIVTFID
ACCA_PSEHT      D------GEPVMVIGQQKGRGTAEKIKRNFGMPKPEGYRKALRLMEMAERFKMPIMTFID
ACCA_COLP3      D------GKPVMIIGHQKGRSTAEKVKRNFGMPRPEGYRKALRLMEMAERFNMPIITFID
ACCA_ECOLI      D------GRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMQMAERFKMPIITFID
ACCA_ECO57      D------GRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMQMAERFKMPIITFID
ACCA_SHIFL      D------GRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMQMAERFKMPIITFID
ACCA_SHIDS      D------GRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMQMAERFKMPIITFID
ACCA_SHIBS      D------GRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMQMAERFKMPIITFID
ACCA_SHISS      D------GRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMQMAERFKMPIITFID
ACCA_ECOL6      D------GRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMQMAERFKMPIITFID
ACCA_SALTI      E------GRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMEMAERFNMPIITFID
ACCA_SALTY      E------GRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMEMAERFNMPIITFID
ACCA_SALCH      E------GRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMEMAERFNMPIITFID
ACCA_SALPA      E------GRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMEMAERFNMPIITFID
ACCA_PECAS      D------GRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMEMADRFRMPIITFID
ACCA_YERPE      D------GRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMEMAERFKLPIITFID
ACCA_YERPS      D------GRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMEMAERFKLPIITFID
ACCA_PHOLL      D------GRPVMVIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMEMAERFKLPIITFID
ACCA_VIBVU      E------GRPVMIIGHQKGRETREKVKRNFGMPKPEGYRKALRLMKMAERFQMPIITFID
ACCA_VIBVY      E------GRPVMIIGHQKGRETREKVKRNFGMPKPEGYRKALRLMKMAERFQMPIITFID
ACCA_VIBPA      E------GRPVMIIGHQKGRETKEKVRRNFGMPKPEGYRKALRLMEMAERFNMPIITFID
ACCA_VIBCH      E------GRSVMVIGHQKGRETREKVKRNFGMPKPEGYRKALRLMEMAERFNMPIITFID
ACCA_ALIF1      D------GRPVMVIGHQKGRGTKEKVIRNFGMPKPEGYRKAKRLMQMAERFNMPVITFID
ACCA_PHOPR      D------GRPVMVIGHQKGRGTKEKVFRNFGMPKPEGYRKALRLMKMAERFKMPIITFID
ACCA_HAEIN      D------GRPVMVIGHQKGRSVKEKVQRNFGMPAPEGYRKALRLMEMAERFKLPIITFID
ACCA_HAEI8      D------GRPVMVIGHQKGRSVKEKVQRNFGMPAPEGYRKALRLMEMAERFKLPIITFID
ACCA_HAEDU      D------GRPVMVIGHQKGRVTKEKVKRNFGMPAPEGYRKALRLMEMAERFKMPIITFID
ACCA_MANSM      D------GRPVMVIGHQKGRSVKEKVLRNFGMPAPEGYRKALRLMQMAERFRLPIITFID
ACCA_PASMU      D------GKPVMVIGHQKGRSVKDKVKRNFGMPAPEGYRKALRLMQMAERFNLPIITFID
ACCA_PSE14      D------GQPVMVIGHQKGREVREKVRRNFGMPRPEGYRKACRLMEMAERFKMPILTFID
ACCA_PSEU2      D------NQPVMVIGHQKGREVREKVRRNFGMPRPEGYRKACRLMEMAERFKMPILTFID
ACCA_PSESM      D------NQPVMIIGHQKGREVREKVRRNFGMPRPEGYRKACRLMEMAERFKMPILTFID
ACCA_PSEF5      D------EQPVMIIGHQKGREVREKVRRNFGMPRPEGYRKACRLMEMAERFKMPILTFID
ACCA_PSEPK      D------GKPVMVIGHQKGREVREKVRRNFGMPRPEGYRKACRLMEMAERFKMPILTFID
ACCA_PSEAE      D------GSPVMVIGHQKGREVREKVRRNFGMPRPEGYRKACRLMEMAERFKMPILTFID
ACCA_COXBU      N------GEPVMVIGHQKGRTTQEKIYRNFGMARPEGFRKALRLMKLAERFSIPVITLID
ACCA_METCA      D------GAAVLVIGHQKGRDTKEKIHRNFGMPRPEGYRKALRLMRLAERFRLPIVCLID
ACCA_LEGPL      N------GEPVMVLGHQKGKRTKEKVYRNFGMARPEEYRKALRLMRMAEKFKMPVVTFID
ACCA_LEGPA      N------GEPVMVLGHQKGKRTKEKVYRNFGMARPEEYRKALRLMRMAEKFKMPVVTFID
ACCA_LEGPH      N------GEPVMVLGHQKGKRTKEKVYRNFGMARPEEYRKALRLMRMAEKFKMPVVTFID
ACCA_XANAC      D------GRPVVIIGHQKGRDTKTKVARNFGMPRPEGYRKALRLMKLAERFRLPLLTFID
ACCA_XANC5      D------GRPVVIIGHQKGRDTKTKVARNFGMPRPEGYRKALRLMKLAERFRLPLLTFID
ACCA_XANCP      D------GRPVVIIGHQKGRDTKSKVARNFGMPRPEGYRKALRLMKLAERFRLPLLTFID
ACCA_XANC8      D------GRPVVIIGHQKGRDTKSKVARNFGMPRPEGYRKALRLMKLAERFRLPLLTFID
ACCA_XANOR      D------GRPVVIIGHQKGRDTKTKVARNFGMPRPEGYRKALRLMKLAERFRLPLLTFID
ACCA_XYLFA      G------HRPVMLIGHQKGRDNKERLMRNFGMPKPEGYRKALRLMKLAERFGLPLLTFID
ACCA_XYLFT      G------HRPVMLIGHQKGRDNKERLMRNFGMPKPEGYRKALRLMKLAERFGLPLLTFID
ACCA_CAMJE      G------EKKIIVIGEQKGRGTKDKIARNFGMPHPEGYRKALRVAGLAEKFQIPILFLID
ACCA_CAMJR      G------EKKIIVIGEQKGRGTKDKIARNFGMPHPEGYRKALRVARLAEKFQIPILFLID
ACCA_HELHP      G------EQTTMIIGEEKGRGTKNKLARNFGMPSPEGYRKALRAAKLAEKFHIPILMLVD
ACCA_WOLSU      E------GEKVIVIGEEKGRGTKNKLARNFGMPNPEGYRKALRIAKLAERFEIPLLMLID
ACCA_HELPY      D------NVPVVVIGEEKGRGTKNKLLRNFGMPNPCGYRKALKMAKFAEKFNLPILMLVD
ACCA_HELPJ      D------NVPVVVIGEEKGRGTKNKLLRNFGMPNPCGYRKALKMAKFAEKFNLPILMLVD
ACCA_FRATT      N------NKPVMVIGQEKGRDTKSKIKHNFGMMHPEGYRKALRLMKLAEKFNMPVVTFID
ACCA_RHOBA      D------RFKVMVIGHQKGRTYKERAACHFGCAHPEGYRKAMVKMKMAEKYRLPVICFID
ACCA_AQUAE      R------GKPVAVVGHEKGKDTKEKLERNFGMPHPEGYRKAIKVFKLAERYNIPVITFID
ACCA_AGRFC      N------GQPVAIIGQEKGNDTKSRLKHNFGSARPEGYRKAIRVLELADRFSLPVVTLID
ACCA_RHIME      H------GTPVAVIGQEKGNDTKSRIKHNFGSPRPEGYRKATRIMEMADRFGLPLITLVD
ACCA_BRUME      N------GTPVAIIGQEKGSDTKTRLKHNFGSARPEGYRKAVRIMEMADRFQLPLITFVD
ACCA_BRUSU      N------GTPVAIIGQEKGSDTKTRLKHNFGSARPEGYRKAVRIMEMADRFQLPLITFVD
ACCA_BRUAB      N------GTPVAIIGQEKGSDTKTRLKHNFGSARPEGYRKAVRIMEMADRFQLPLITFVD
ACCA_RHILO      R------GEPVAIIGQEKGSDTTSRLRHNFGSVRPEGYRKAVRLMELADRFKIPLLTLVD
ACCA_NITWN      R------GESICVIGQEKGATTESRLKHNFGMARPEGYRKAVRLMDMADRFDIPVLSLVD
ACCA_RHOPA      R------GEAVCVIGQEKGSTTETRLRHNFGMARPEGYRKAVRLMEMADRFDLPVLSLVD
ACCA_ZYMMO      D------GQRVMIIGQEKGNDTASRLKHNFGMARPEGYRKAIRLMKLADRFGLPVITLVD
ACCA_CAUVC      R------GQPVVVMGHEKGHDTTTRLKHNFGMARPEGYRKAVRLMDMAERFNLPVITFVD
ACCA_RHOS4      N------DNPVVVIGQEKGHDTKTRIERNFGMARPEGYRKAIRLMEMAHRFRLPVITLVD
ACCA_RUEPO      N------DRPVMVIGHEKGSDTKSRIAHNFGMARPEGYRKAVRLIEMAGRFGLPVVTLVD
ACCA_PELUB      D------EKSVLVIGQEKGDSLESRIERNFGMMRPEGYRKTIRLMKLANKFNIPIISFID
                             :   :*           *   *  :**:      * ::  ... :::

ACCA_BACAN      TKGAYPGKAAEERGQSEAIARNLFEMAGLTVPVICIVIGEGGSGGALGLGVGDYIHMLEN
ACCA_BACCZ      TKGAYPGKAAEERGQSEAIARNLFEMAGLTVPVICIVIGEGGSGGALGLGVGDYIHMLEN
ACCA_BACHK      TKGAYPGKAAEERGQSEAIARNLFEMAGLTVPVICIVIGEGGSGGALGLGVGDYIHMLEN
ACCA_BACCR      TKGAYPGKAAEERGQSEAIARNLFEMAGLTVPVICIVIGEGGSGGALGLGVGDYIHMLEN
ACCA_BACLD      TKGAYPGKAAEERGQSEAIAKNLFEMAGLSVPVISIVIGEGGSGGALALGVANRLLMLEN
ACCA_BACSU      TKGAYPGRAAEERGQSEAIAKNLFEMAGLRVPVICIVIGEGGSGGALGLGVGNHLHMLEN
ACCA_GEOKA      TKGAYPGKAAEERGQSEAIARNLFEMAGLTVPVVCIVIGEGGSGGALALGVGNHIHMLEN
ACCA_BACHD      TKGAYPGKAAEERGQSEAIARNLLEMAGLKVPIVCIVIGEGGSGGALALGVGDRIHMLEN
ACCA_OCEIH      TKGAYPGKAAEERGQSEAIAKNLMEMAGLQVPIICIVIGEGGSGGALGLGVGNHIHMLEN
ACCA_LISMO      TKGAYPGRAAEERGQSEAIARNLYEMSDMKVPIISIVIGEGGSGGALALGVGNQIFMLEN
ACCA_LISMF      TKGAYPGRAAEERGQSEAIARNLYEMSDMKVPIISIVIGEGGSGGALALGVGNQIFMLEN
ACCA_LISIN      TKGAYPGRAAEERGQSEAIARNLYEMSDMKVPIISIVIGEGGSGGALALGLGNQIFMLEN
ACCA_BACSK      TKGAYPGKAAEERGQSEAIARNLLEMAGLKVPTISIVIGEGGSGGALALGVADEIHMLEN
ACCA_STAAC      TKGAYPGKAAEERGQSESIATNLIEMASLKVPVIAIVIGEGGSGGALGIGIANKVLMLEN
ACCA_STAAS      TKGAYPGKAAEERGQSESIATNLIEMASLKVPVIAIVIGEGGSGGALGIGIANKVLMLEN
ACCA_STAAW      TKGAYPGKAAEERGQSESIATNLIEMASLKVPVIAIVIGEGGSGGALGIGIANKVLMLEN
ACCA_STAAR      TKGAYPGKAAEERGQSESIATNLIEMASLKVPVIAIVIGEGGSGGALGIGIANKVLMLEN
ACCA_STAAM      TKGAYPGKAAEERGQSESIATNLIEMASLKVPVIAIVIGEGGSGGALGIGIANKVLMLEN
ACCA_STAAN      TKGAYPGKAAEERGQSESIATNLIEMASLKVPVIAIVIGEGGSGGALGIGIANKVLMLEN
ACCA_STAHJ      TKGAYPGKAAEERGQSESIARNLVEMASLKVPVIAIVIGEGGSGGALGIGIANRIMMLEN
ACCA_STAES      TKGAYPGKAAEERGQSESIAKNLMEMASLTVPVIAVVIGEGGSGGALGIGISNRVLMLEN
ACCA_STAEQ      TKGAYPGKAAEERGQSESIAKNLMEMASLTVPVIAVVIGEGGSGGALGIGISNRVLMLEN
ACCA_STAS1      TKGAYPGKAAEERGQSESIARNLVEMASLTVPVISIVIGEGGSGGALGLGITNRILMLEN
ACCA_CLOAB      TSGAYCGVEAEQRGQGEAIAKNLISMANLKIPVISVVIGEGGSGGALAMAVADEVWMLEN
ACCA_CLOPE      TPGAFCGIGAEERGQGQAIAQNLVELMGLKVPLISIVIGEGGSGGALALAVADKVFMLEH
ACCA_STRPN      TAGAYPGVGAEERGQGEAIARNLMEMSDLKVPIIAIIIGEGGSGGALALAVADRVWMLEN
ACCA_STRR6      TAGAYPGVGAEERGQGEAIARNLMEMSDLKVPIIAIIIGEGGSGGALALAVADRVWMLEN
ACCA_STRT2      TAGAYPGVGAEERGQGEAIARNLMEMSDLKVPIIAIIIGEGGSGGALALAVADKVWMLEN
ACCA_STRT1      TAGAYPGVGAEERGQGEAIARNLMEMSDLKVPIIAIIIGEGGSGGALALAVADKVWMLEN
ACCA_ENTFA      TAGAYCGIGAEERGEGEAIAQNLLEMSDLKVPIISVIIGEGGSGGALALAVADEVWMLEH
ACCA_CARHZ      TPGAFCGIGAEERGQFQAIAEAIATLISLKTPVLAVITGEGGSGGALALAAGDKLLMLEN
ACCA_TREDE      TQGAYPGLGAEERGIGEAIAFNLREFSRLKTPIICIIIGEGGSGGALGIGVGDKIYMLEN
ACCA_CHLMU      TPGAFPGLTAEERGQGWAIATNLFELARLATPIIVVVIGEGCSGGALGMAIGDVVAMLEH
ACCA_CHLTR      TPGAFPGLTAEERGQGWAIATNLFELARLATPIIVIVIGEGCSGGALGMAIGDVVAMLEH
ACCA_CHLAB      TPGAFPGLTAEERGQGWAIANNLFQLARLKTPIIVLVIGEGCSGGALGMAIGDVIAMLEH
ACCA_CHLCV      TPGAFPGLTAEERGQGWAIANNLFQLARLKTPIIVLVIGEGCSGGALGMAIGDVIAMLEH
ACCA_CHLPN      TPGAYPGLTAEERGQGWAIAKNLFELSRLATPVIIVVIGEGCSGGALGMAVGDSVAMLEH
ACCA_PARUW      TPGAYPGLEAEERGQGWAIARNLREMMRINTPIIITIIGEGCSGGALGMGIGDVIGMLEH
ACCA_FUSNN      TPGAYPGLEAEKHGQGEAIARNLMEMSGIKTPIVSIVIGEGGSGGALGLGVADKVFMLEN
ACCA_NOSS1      TPGALPTVVAERQGAGEAIAYNLREMFSLDVPIICTVIGEGGSGGALGIGVGDRLLMFEH
ACCA_SYNY3      TPGAWAGIDAEKLGQGEAIAVNLREMFRLDVPILCTVIGEGGSGGALGIGVGDRVLMLEN
ACCA_SYNP6      TPGAYAGVSAEELGQGEAIAVNLREMFRFSVPILCTVIGEGGSGGALGIGVGDRLLMFEH
ACCA_SYNE7      TPGAYAGVSAEELGQGEAIAVNLREMFRFSVPILCTVIGEGGSGGALGIGVGDRLLMFEH
ACCA_THEEB      TPAAWAGVDAEKFGQGEAIAYNLREMFRFEVPIICTVIGEGGSGGALAIGVGDRLLMFEH
ACCA_PROMA      TPGAYAGLLAEEQGQGEAIAVNLREMFRIKVPIIATVIGEGGSGGALGIGVADRLLMFEH
ACCA_PROMT      TPGAYAGLIAEEQGQGEAIAVNLREMFRLKVPIIATVIGEGGSGGALGIGVADRLLMFEH
ACCA_PROMM      TPGAYAGLLAEEQGQGEAIAVNLREMFRLRVPVIATVIGEGGSGGALGIGVADRLLMFEH
ACCA_SYNPX      TPGAYAGLQAEEQGQGEAIAVNLREMFRLRVPVIATVIGEGGSGGALGIGVADRLLMFEH
ACCA_PROMP      TPGAYAGLSAEEQGQGEAIARNLREMFGFKVPIIATIIGEGGSGGALGIGVADRLLMFEH
ACCA_GLOVI      TPGAHAGVDAEQRGQGEAIARNLQHMFSYEVPILCAVIGEGGSGGALAIGVGNRMLMFEY
ACCA_ANTSP      TPGAWAGVDAERLGQGEAIAVNLREMFSFNVPIICTIIGEGGSGGALGIGVGDKVLMLED
ACCA_GRATL      TPGAWAGIDAETLGQGEAIAVNLREMFSFDVPIICTILGEGGSGGALGIGIGDKILMLEY
ACCA_PORPU      TPGAWAGLKAEELGQGEAIAVNLREMFSFEVPIICTIIGEGGSGGALGIGIGDSIIMLEY
ACCA_CYACA      TPGALAGVSAEKSGQAEAIATNLKKMFSFEVPIISTIIGEGGSGGALGICIGNYVMMFEN
ACCA_THET2      TPGAYPGVSAEERGQAWVIAQSIQRMSRLRVPAVTVILGEGGSGGALAIAVANRVLILEN
ACCA_THET8      TPGAYPGVSAEERGQAWVIAQSIQRMSRLRVPAVTVILGEGGSGGALAIAVANRVLILEN
ACCA_DEIRA      TQGAYPGLEAEERGQGWAIAESIQRMVRLRVPAVCAVIGEGGSGGALAIGVGNRVLIQEN
ACCA_GEOSL      TPGAFPGIGAEERGQAEAIARNLREMAALTVPIIVVVTGEGGSGGALAIAVGDRVLMLQY
ACCA_PELCD      TPGAFPGIGAEERGQAEAIARNLREMAALKVPVIVTVTGEGGSGGALAVAVGNRVLMMEN
ACCA_CHLTE      TPGAFPGIEAEERGQAEAIARNLYEMAALKVPVICVIIGEGASGGAIGIGVGDRILMAEN
ACCA_AROAE      TPGAYPGIDAEERGQSEAIGRNLYVMAELKVPIITTIIGEGGSGGALAIAVGDQVMMLQY
ACCA_DECAR      TPGAYPGIDAEERGQSEAIGRNLYVMAELKVPVIVTIIGEGGSGGALAIAVGDTLQMLQY
ACCA_BORBR      TPGAYPGIGAEERGQSEAIGRNLYAMAELKVPVICTVIGEGGSGGALAIAVGNAVLMLQY
ACCA_BORPA      TPGAYPGIGAEERGQSEAIGRNLYAMAELKVPVICTVIGEGGSGGALAIAVGNAVLMLQY
ACCA_BORPE      TPGAYPGIGAEERGQSEAIGRNLYAMAELKVPVICTVIGEGGSGGALAIAVGNAVLMLQY
ACCA_BURMA      TPGAYPGVGAEERGQSEAIGHNLYVMAELKTPIIATVIGEGGSGGALAIAVADTVMMLQF
ACCA_BURPS      TPGAYPGVGAEERGQSEAIGHNLYVMAELKTPIIATVIGEGGSGGALAIAVADTVMMLQF
ACCA_CUPPJ      TPGAFPGIDAEERGQSEAIGHNLYVMAGLKVPLIATIIGEGGSGGALAIAVGDVVQMLQF
ACCA_RALSO      TPGAFPGIEAEERGQSEAIGHNLFVMAGLKVPLIATIIGEGGSGGALAIAVGDSVIMLQF
ACCA_NEIMA      TPGAYPGIGAEERGQSEAIGKNLYELTRLRVPVLCTVIGEGGSGGALAVAVGDYVNMLQY
ACCA_NEIMB      TPGAYPGIGAEERGQSEAIGKNLYELTRLRVPVLCTVIGEGGSGGALAVALGDYVNMLQY
ACCA_NEIG1      TPGAYPGIGAEERGQSEAIGKNLYELTRLRVPVLCTVIGEGGSGGALAVAVGDYVNMLQY
ACCA_CHRVO      TTGAWPGIGAEERGQSEAIGRNLYEMTNLRVPIVVTVIGEGGSGGALAIAVGDHVNMLQY
ACCA_NITEU      TPGAYPGIDAEERGQSEAIGKNLYVMAGLRIPIICVIIGEGGSGGALAIAVGDTSLMLQY
ACCA_THIDA      TPGAYPGIGAEERGQSEAIARNLYVMAELQTPIVCTIVGEGGSGGALAIGVGDRTLILQY
ACCA_BLOFL      TPGAYPGIGAEKRGQSIAIAKNLRAMTTLNIPIICTVIGEGGSGGALAISVGDKINMLQY
ACCA_BLOPB      TPGAYPGVGAEKRGQSAAIAKNLRTMSILKIPIICTVIGEGGSGGALAISVGDKVNMLEY
ACCA_WIGBR      TPGAYPGIEAEERGQASAIATNLREMSMLKIPIICTVIGEGGSGGALAIGVGDKINMMQY
ACCA_IDILO      TPGAYPGIGAEERGQSEAIARNLKVMARLTVPIVCTVIGEGGSGGALAIGVGDRVNMLQY
ACCA_PSEHT      TPGAYPGVGAEERGQSEAIARNLKVMASLKVPTICTVIGEGGSGGALAIGVGDRVNMLQY
ACCA_COLP3      TPGAYPGVGAEERGQSEAIARNLKVMARLSVPIICTVIGEGGSGGALAIGVGDRVNMLQY
ACCA_ECOLI      TPGAYPGVGAEERGQSEAIARNLREMSRLGVPVVCTVIGEGGSGGALAIGVGDKVNMLQY
ACCA_ECO57      TPGAYPGVGAEERGQSEAIARNLREMSRLGVPVVCTVIGEGGSGGALAIGVGDKVNMLQY
ACCA_SHIFL      TPGAYPGVGAEERGQSEAIARNLREMSRLGVPVVCTVIGEGGSGGALAIGVGDKVNMLQY
ACCA_SHIDS      TPGAYPGVGAEERGQSEAIARNLREMSRLGVPVVCTVIGEGGSGGALAIGVGDKVNMLQY
ACCA_SHIBS      TPGAYPGVGAEERGQSEAIARNLREMSRLGVPVVCTVIGEGGSGGALAIGVGDKVNMLQY
ACCA_SHISS      TPGAYPGVGAEERGQSEAIARNLREMSRLGVPVVCTVIGEGGSGGALAIGVGDKVNMLQY
ACCA_ECOL6      TPGAYPGVGAEERGQSEAIARNLREMSRLSVPTICTVIGEGGSGGALAIGVGDKVNMLQY
ACCA_SALTI      TPGAYPGVGAEERGQSEAIARNLREMSRLNVPVICTVIGEGGSGGALAIGVGDKVNMLQY
ACCA_SALTY      TPGAYPGVGAEERGQSEAIARNLREMSRLNVPVICTVIGEGGSGGALAIGVGDKVNMLQY
ACCA_SALCH      TPGAYPGVGAEERGQSEAIARNLREMSRLNVPVICTVIGEGGSGGALAIGVGDKVNMLQY
ACCA_SALPA      TPGAYPGVGAEERGQSEAIARNLREMSRLNVPVICTVIGEGGSGGALAIGVGDKVNMLQY
ACCA_PECAS      TPGAYPGVGAEERGQSEAIARNLREMSTLRVPIICTVIGEGGSGGALAIGVGDKVNMLQY
ACCA_YERPE      TPGAYPGVGAEERGQSEAIARNLREMSRLNVPIVCTVIGEGGSGGALAIGVGDKVNMLQY
ACCA_YERPS      TPGAYPGVGAEERGQSEAIARNLREMSRLNVPIVCTVIGEGGSGGALAIGVGDKVNMLQY
ACCA_PHOLL      TPGAYPGVGAEERGQSEAIARNLREMSRLSVPVICTVIGEGGSGGALAIGVGDKVNMLQY
ACCA_VIBVU      TAGAYPGVGAEERGQSEAIATNLKEMAGLTVPVICNVVGEGGSGGALAIGVGDYVNMLQY
ACCA_VIBVY      TAGAYPGVGAEERGQSEAIATNLKEMAGLTVPVICNVVGEGGSGGALAIGVGDYVNMLQY
ACCA_VIBPA      TAGAYPGVGAEERGQSEAIAKNLKVMSGLKVPVICNVVGEGGSGGALAIGVGDYVNMLQY
ACCA_VIBCH      TAGAYPGVGAEERGQSEAIAKNLKVMSGLKVPVICNVVGEGGSGGALAIGVGDYVNMLQY
ACCA_ALIF1      TAGAYPGVGAEERGQSEAIAMNLKIMSELSVPVICNVVGEGGSGGALAIGVGDYVNMLQY
ACCA_PHOPR      TAGAYPGVGAEERGQSEAIATNLKAMAGLTVPVICNVVGEGGSGGALAIGVGDYVNMLQY
ACCA_HAEIN      TPGAYPGIGAEERGQAEAIARNLREMAQLTVPVICTVIGEGGSGGALAIGVGDKVNMLQY
ACCA_HAEI8      TPGAYPGIGAEERGQAEAIARNLREMAQLTVPVICTVIGEGGSGGALAIGVGDKVNMLQY
ACCA_HAEDU      TPGAYPGIGAEERGQAEAIARNLREMSQLSVPIICTVIGEGGSGGALAIGVGDKVNMLQY
ACCA_MANSM      TPGAYPGVGAEERGQSEAIARNLREMSTLTVPVICTVIGEGGSGGALAIGVGDKVNMLQY
ACCA_PASMU      TPGAYPGVGAEERGQSEAIARNLREMSTLKVPVICTVIGEGGSGGALAIGVGDKVNMLQY
ACCA_PSE14      TPGAYPGIDAEERNQSEAIAWNLRVMARLKTPIIATVIGEGGSGGALAIGVCDQLNMLQY
ACCA_PSEU2      TPGAYPGIDAEERNQSEAIAWNLRVMARLKTPIIATVIGEGGSGGALAIGVCDQLNMLQY
ACCA_PSESM      TPGAYPGIDAEERNQSEAIAWNLRVMARLKTPIIATVIGEGGSGGALAIGVCDQLNMLQY
ACCA_PSEF5      TPGAYPGIDAEERNQSEAIAWNLRVMARLKTPIIATVIGEGGSGGALAIGVCDQLNMLQY
ACCA_PSEPK      TPGAYPGIDAEERNQSEAIAWNLRVMARLKTPIIATVIGEGGSGGALAIGVCDQLNMLQY
ACCA_PSEAE      TPGAYPGIDAEERGQSEAIAWNLRVMARLKTPIIATVIGEGGSGGALAIGVCDQLNMLQY
ACCA_COXBU      TPGAYPGIGAEERNQSEAIARNLFEMAQLKIPIICTIIGEGCSGGALAIGVGDRTLMLQY
ACCA_METCA      TPGAYPGINAEERGQSEAIARNLFEMAQLQTPIVCVVIGEGGSGGALAIGVGDRLLMLQY
ACCA_LEGPL      TAGAYPGIGAEERNQSEAIARNLFAMSRIKTPIVCIVTGEAGSGGALAIGVGDKIIMLQF
ACCA_LEGPA      TAGAYPGIGAEERNQSEAIARNLFAMSRIKTPIVCIVTGEAGSGGALAIGVGDKIIMLQF
ACCA_LEGPH      TAGAYPGIGAEERNQSEAIARNLFAMSRIKTPIVCIVTGEAGSGGALAIGVGDKIIMLQF
ACCA_XANAC      TPGAYPGIGAEERGQSEAIARNLLEMAELKIPVICTVIGEGGSGGALAIGVGDRTLMLEY
ACCA_XANC5      TPGAYPGIGAEERGQSEAIARNLLEMAELKIPVICTVIGEGGSGGALAIGVGDRTLMLEY
ACCA_XANCP      TPGAYPGIGAEERGQSEAIARNLMEMAELKVPVICTVIGEGGSGGALAIGVGDRTLMLEY
ACCA_XANC8      TPGAYPGIGAEERGQSEAIARNLMEMAELKVPVICTVIGEGGSGGALAIGVGDRTLMLEY
ACCA_XANOR      TPGAYPGIGAEERGQSEAIARNLLEMAELKIPVICTVIGEGGSGGALAIGVGDRTLMLEY
ACCA_XYLFA      TMGAWPGIDAEERNQSEAIATNLIEMAELKIPVICTVIGEGGSGGALAIGIGDRTLMLEY
ACCA_XYLFT      TMGAWPGIDAEERNQSEAIATNLIEMAELKIPVICTVIGEGGSGGALAIGIGDRTLMLEY
ACCA_CAMJE      TPGAYPGIGAEERGQSEAIARNLYELSDLKIPTIAIVIGEGGSGGALAIGVADKLAMMKN
ACCA_CAMJR      TPGAYPGIGAEERGQSEAIARNLYELSDLKIPTIAIVIGEGGSGGALAIGVADKLVMMKN
ACCA_HELHP      TQGAYPGLGAEERGQSEAIARNLQEFAKLKTPTIAVVIGEGGSGGALAIAVADKLAMMQY
ACCA_WOLSU      TPGAYPGIGAEERGQSEAIAKNLQEFSQLKIPTVSVVIGEGGSGGALAIGVADRLAMMRY
ACCA_HELPY      TAGAYPGIGAEERGQSEAIAKNLQEFASLKVPTISVIIGEGGSGGALAIAVADKLAMMEY
ACCA_HELPJ      TAGAYPGIGAEERGQSEAIAKNLQEFASLKVPTISIIIGEGGSGGALAIAVADKLAMMEY
ACCA_FRATT      TPGAYPGIKAEERGQSEAIARNLLEMSALKVPVVCIVIGEGCSGGALGIGVGDRLLMLQY
ACCA_RHOBA      TPGAYPGIGAEERGQAQVIAESMFMMSDLKTPVICVVIGEGGSGGALGIGVGDRVAVLQH
ACCA_AQUAE      TPGAFPGIGAEERGQSRAIAESMLTMAFLKVPSVAVVIGEGGSGGALAFGVANRVCILEN
ACCA_AGRFC      TAGAYPGVGAEERGQAEAIARSTEMCLNVKVPIVSVVIGEGGSGGAIAIATGNRVYMLEH
ACCA_RHIME      TAGAYPGVNAEERGQAEAIARSTEMCLNVKVPIVTVVIGEGGSGGAIAIATGNRVYMLEH
ACCA_BRUME      TAGAYPGVSAEERGQAEAIARSTAECLKLRVPVISIIIGEGGSGGAIAIAVANRVYMLEH
ACCA_BRUSU      TAGAYPGVSAEERGQAEAIARSTAECLKLRVPVISIIIGEGGSGGAIAIAVANRVYMLEH
ACCA_BRUAB      TAGAYPGVSAEERGQAEAIARSTAECLKLRVPVISIIIGEGGSGGAIAIAVANRVYMLEH
ACCA_RHILO      TAGAYPGVGAEERGQAEAIARSTSACLALKVPSISVVIGEGGSGGAIAIATANRVYMLEH
ACCA_NITWN      SAGAYPGIGAEERGQAEAIARSTDACLSLGVANIAVIIGEGGSGGAIAIATANRVLMLEH
ACCA_RHOPA      TAGAYPGIGAEERGQAEAIARSTDACLQLGVPNVALVIGEGGSGGAIAIATANKVLMLEH
ACCA_ZYMMO      TSGAFPGIDAEERGQAEAIARSTETCLSLGVPLISVIVGEGGSGGAIAIAAANRLLMFEH
ACCA_CAUVC      TAGAYPGLGAEERGQAEAIARSTERCLTLGVPMVATIVGEGGSGGAIALAGANRVLILEH
ACCA_RHOS4      TPGAYPGKGAEERGQAEAIARATQKCLEIGVPLVAVVIGEGGSGGAVALATANRIAMLEH
ACCA_RUEPO      TAGAYPGKGAEERGQSEAIARSTEMCLRAGVPLVSVIIGEGGSGGAVAFATANRVAMLEH
ACCA_PELUB      TPGAYPGVGAEERGQAEAIAKSIECCMSLNVPTLAIVIGEGGSGGAIALASSNKVIMLEN
                : .*     **  .    *.           . :  : **. ****:..   :   : . 

ACCA_BACAN      STYSVITPEGAAAILWKDAGKAKEAAEAMRITAADLKELG-VIDEIIPEAKGGAHRNVLK
ACCA_BACCZ      STYSVITPEGAAAILWKDAGKAKEAAEAMRITAADLKELG-VIDEIIPEAKGGAHRNVLK
ACCA_BACHK      STYSVITPEGAAAILWKDAGKAKEAAEAMRITAADLKELG-VIDEIIPEAKGGAHRNVLK
ACCA_BACCR      STYSVITPEGAAAILWKDAGKAKEAAEAMKITAADLKELG-VIDEIIPEARGGAHRNILK
ACCA_BACLD      STYSVISPEGAAAILWKDSGLAKKAAETMKITAPDLKELD-IIDHVIKEVRGGAHRDVEQ
ACCA_BACSU      STYSVISPEGAAALLWKDSSLAKKAAETMKITAPDLKELG-IIDHMIKEVKGGAHHDVKL
ACCA_GEOKA      STYSVISPEGAAAILWKDASLAQRAAETMKITAHDLKALG-VIDEIIPEVKGGAHRNADE
ACCA_BACHD      STYSVISPEGAAALLWKDASQAQRAAETMKITAPDLKELQ-IIDDIIPEVRGGAHRNVAE
ACCA_OCEIH      STYSVISPEGAAAILWKDSTQAKKAAETMKITAPDLKELG-IIDQVISEPRGGAHRDVDS
ACCA_LISMO      AVFSVISPEGAAAILWKDASLAKKAAESMRITAGDLFELG-ITDGIIPEVKGGAHRDLTA
ACCA_LISMF      AVFSVISPEGAAAILWKDASQAKKAAESMRITAGDLFELG-ITDGIIPEVKGGAHRDLNA
ACCA_LISIN      AVFSVISPEGAAAILWKDASLAKKAAESMRITAGDLYELG-ITDGIIPEVKGGAHRDLAA
ACCA_BACSK      ATYSVISPEGAAAILWKDAGKAKKAAESMRITAPDLYELG-IIDSIIPEPRGGAQRNLHQ
ACCA_STAAC      STYSVISPEGAAALLWKDSNLAKIAAETMKITAHDIKQLG-IIDDVISEPLGGAHKDIEQ
ACCA_STAAS      STYSVISPEGAAALLWKDSNLAKIAAETMKITAHDIKQLG-IIDDVISEPLGGAHKDIEQ
ACCA_STAAW      STYSVISPEGAAALLWKDSNLAKIAAETMKITAHDIKQLG-IIDDVISEPLGGAHKDIEQ
ACCA_STAAR      STYSVISPEGAAALLWKDSNLAKIAAETMKITAHDIKQLG-IIDDVISEPLGGAHKDIEQ
ACCA_STAAM      STYSVISPEGAAALLWKDSNLAKIAAETMKITAHDIKQLG-IIDDVISEPLGGAHKDVEQ
ACCA_STAAN      STYSVISPEGAAALLWKDSNLAKIAAETMKITAHDIKQLG-IIDDVISEPLGGAHKDVEQ
ACCA_STAHJ      STYSVISPEGAAALLWKDSSLAKMAAETMKITAKDLHHLN-VIDSVIDEPLGGAHNNIEQ
ACCA_STAES      STYSVISPEGAAALLWKDSNLAQIAAETMKITALDLLDLG-IIDEVINEPLGGAQKDEEV
ACCA_STAEQ      STYSVISPEGAAALLWKDSNLAQIAAETMKITAHDLLDLG-IIDEVINEPLGGAQKDEEA
ACCA_STAS1      STYSVISPEGASALLWKDSNLAKIAAETMKITAEDLYELN-IADEVIKEPLGGAHHDVET
ACCA_CLOAB      SVYSLLSPEGFASILWKDSSRAKEAAEVMKITADDLKGYG-IIDKVIKEPDGGAQNDITM
ACCA_CLOPE      SIYSVLSPEGFASILWKDSSRAEEAASVMKITAQDLKSFN-IIDKIIKEPRGGAHKNPIK
ACCA_STRPN      SIYAILSPEGFASILWKDGTRAMEAAELMKITSHELLEMD-VVDKVISEIG----LSSKE
ACCA_STRR6      SIYAILSPEGFASILWKDGTRAMEAAELMKITSHELLEMD-VVDKVISEVG----LSSKE
ACCA_STRT2      TIYSILSPEGFATILWKDGSRSEEAAELMKITSGELLNMG-IVDKVIPERG----YFTSE
ACCA_STRT1      TIYSILSPEGFATILWKDGSRSEEAAELMKITSGELLNMG-IVDKVIPERG----YFTSE
ACCA_ENTFA      TIYAVLSPEGFASILWKDGSRAKEAAELMKITATELKELA-IVDKVIPEVMNGQPLEQAK
ACCA_CARHZ      AVFSVIAPESFAAILWKDSSRAQEASELLKLTSEHLLEFG-LIDGIIPEPLGGAHRNPAE
ACCA_TREDE      AIFSVISPEGCASILLRDSSRAKDAAAMLKITSQEVLDLK-VINGIIPEPEKGAHTDPKK
ACCA_CHLMU      SYYSVISPEGCASILWKDPKKNSDAAAMLKMHGEDLKGFA-IVDAVIKEPIGGAHHNPVA
ACCA_CHLTR      SYYSVISPEGCASILWKDPKKNSDAAAMLKMHGEDLKGFA-IVDAVIKEPIGGAHHNPAA
ACCA_CHLAB      SYYSVISPEGCASILWKDPKKNSEAAAMLKMHGEDLKQFA-IVDVVIKEPVGGAHHNPAA
ACCA_CHLCV      SYYSVISPEGCASILWKDPKKNSEAAAMLKMHGEDLKQFA-IVDVVIKEPVGGAHHDPAA
ACCA_CHLPN      SYYSVISPEGCASILWKDPKKNSEAASMLKMHGENLKQFG-IIDTVIKEPIGGAHHDPAL
ACCA_PARUW      AYYSVISPEGCASILWKDASKNVEAASALKLNAEDLLNLK-IIDSIIKEPLGGAHHDPHI
ACCA_FUSNN      SVYSVISPEGCAAILYKDPNRVEEAANNLKLSSQSLLKIG-LIDGIIDEALGGAHRGPED
ACCA_NOSS1      SVYTVATPEACAAILWKDASKSPQAAVALKIVSHDLKNLG-IIDQILPEPTGGAHSDPLT
ACCA_SYNY3      AVYTVATPEACAAILWKDAKKSDKAAIALKITADDLAKLQ-IIDGIIPEPKGAAHANPLG
ACCA_SYNP6      SVYTVASPEACASILWRDAGKAAQAAEALKITARDLKQLG-ILDEIITEPLGGAHSAPLE
ACCA_SYNE7      SVYTVASPEACASILWRDAGKAAQAAEALKITARDLKQLG-ILDEIITEPLGGAHSAPLE
ACCA_THEEB      AVYSVAPPEACAAILWRDAQKAPQAAEALKITARDLLKLG-IIDEIVPEPVGAAHSNPVE
ACCA_PROMA      SVYTVASPEACASILWRDAAKAPDAAAALKITGSDLLTLG-IVDEVIKEPAGGNNWAPLQ
ACCA_PROMT      SVYTVASPEACASILWRDAGKAPEAASALKITGPDLMKLG-IVDEVLKEPSGGNNWAPLQ
ACCA_PROMM      SVYTVASPEACASILWRDAAKAPEAAAALKITGPDLLNLG-VVDEVLPEPAGGNNWAPLQ
ACCA_SYNPX      SVYTVASPEACASILWRDAAKAPDAATALRITGVDLLELG-VVDEVLEEPSGGNNWAPLE
ACCA_PROMP      SVYTVASPEACASILWRDAAKASEAATALKITGKDLLELG-VIDEVLSEPAGGNNWAPIE
ACCA_GLOVI      AVYSVISPDSCSVILWRDKKHIEQAANALKITARDLKQLG-IVDEIIPEPSGGAHRDPQR
ACCA_ANTSP      AVYTVATPEACAAILWKDSKQSLEAAEALKITSYDLKALG-IIDDIVEEPLGGSQEDSLL
ACCA_GRATL      AVYTVATPEACAAILWKDSKRSLDAAEALKITSADLKVLG-VIDKVVKEPIGGSQSNPSQ
ACCA_PORPU      AVYTVATPEACAAILWKNSKESLAAAEALKITSHDLKVMG-IVDEILTEPIGGAQADHQS
ACCA_CYACA      SIYTVATPEACSSILWKDSTKAADAAEALKVRAEDLLTLK-IIDEIIPEPFGVAHDYPLL
ACCA_THET2      AWYSVISPESCAAILWRDAKEAPKAAEALKLTAKDLLQLK-VVDAIVPEPEGGAHKDPDR
ACCA_THET8      AWYSVISPESCAAILWRDAKEAPKAAEALKLTAKDLLQLK-VVDAIVPEPEGGAHKDPDR
ACCA_DEIRA      AWYSVISPEGAASILWRDAAQAPLAAEALRVTAADLLDMG-IVEEVVPEPPGGAHLDMDA
ACCA_GEOSL      SIYAVISPEGCAAILWSDGTKGEQAAEALKLTAKDLKELE-VIDEIVPEPLGGAHRDHEA
ACCA_PELCD      AVYSVISPEGCAAILWKDGAKGPVAAEALKLTAGDIQNLGCVIDEVIPEPLGGAHSDHKA
ACCA_CHLTE      AWYSVISPESCSSILWRSWNFKEQAAEALKLTADDLLAQG-IIDRIVTEPLGGAHHNPEQ
ACCA_AROAE      ATYSVISPEGCASILWKSAEKASEAAETMGITAARLKSLG-LIDRVVNEPAGGAHRDHRA
ACCA_DECAR      STYSVISPEGCASILWKSSERAPEAAETMGITAQRLKTLG-LVDKIVNEPLGGAHRDHAA
ACCA_BORBR      ATYSVISPEGCASILWRSADKAPEAAEALAITAPRLKDLG-LVDRVVNEPVGGAHRDPRV
ACCA_BORPA      ATYSVISPEGCASILWRSADKAPEAAEALAITAPRLKDLG-LVDRVVNEPVGGAHRDPRV
ACCA_BORPE      ATYSVISPEGCASILWRSADKAPEAAEALAITAPRLKDLG-LVDRVVNEPVGGAHRDPRV
ACCA_BURMA      STYSVISPEGCASILWKSAAKAPEAAEALGLTAHRLKALG-LIDKIVNEPLGGAHRDPKG
ACCA_BURPS      STYSVISPEGCASILWKSAAKAPEAAEALGLTAHRLKALG-LIDKIVNEPLGGAHRDPKG
ACCA_CUPPJ      ATYAVISPEGCASILWKTAEKAPEAAEALGLTAHRLKALG-LIDKIVSEPLGGAHRDVKG
ACCA_RALSO      ATYAVISPEGCASILWKTAEKAPEAAEALGLTAHRLKALG-LIDKIVNEPLGGAHRDPKA
ACCA_NEIMA      STYSVISPEGCASILWKTAEKAADAAQALGITADRLQKLD-LVDTVIKEPLGGAHRDFGQ
ACCA_NEIMB      STYSVISPEGCASILWKTAEKAADAAQALGITADRLQKLD-LVDTVIKEPLGGAHRDFGQ
ACCA_NEIG1      STYSVISPEGCASILWKTAEKAADAAQALGITADRLQKLD-LVDTVIKEPLGGAHRDFGQ
ACCA_CHRVO      ATYSVISPEGCASILWKTAERASDAAEALGITAPRLKTLG-LIDRVVTEPVGGAHRDHAQ
ACCA_NITEU      STYSVISPEGCASILWKSADKASDAAEILGITADRLKEMG-LIDSIIPEPIGGAHRDYPV
ACCA_THIDA      STYSVISPEGCASILWKSADKASVAAETLGITADRLKANG-LVDRIIEEPLGGAQRDWDA
ACCA_BLOFL      SIYSVISPEGCASILWKNVQKAPLAAEVMGITAHRLKQLK-LIDTVIPEPLGGAHRDIVS
ACCA_BLOPB      STYSVISPEGCASILWKNVKKAPIAAEAMGITAYRLKELN-LIDSVISEPLGGAHRDILT
ACCA_WIGBR      SIYSVISPEGCAAILWKNVDKAPIAAEEMGIIATRLKELN-LIDNIIPEPLGGAHRNIKI
ACCA_IDILO      STYSVISPEGCASILWKSASKAPLAAEAMGVTAERSKELG-LVDSVIPEPLGGAHRHQEE
ACCA_PSEHT      STYSVISPEGCASILWKSADKAPLAAEAMGVTAKRVKELD-LINNLVDEPLGGAHRNYDA
ACCA_COLP3      ATYSVISPEGCASILWKTAEKAPTAAAAMGITAQRIKELD-LINSIVEEPLGGAHRDMDV
ACCA_ECOLI      STYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELK-LIDSIIPEPLGGAHRNPEA
ACCA_ECO57      STYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELK-LIDSIIPEPLGGAHRNPEA
ACCA_SHIFL      STYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELK-LIDSIIPEPLGGAHRNPEA
ACCA_SHIDS      STYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELK-LIDSIIPEPLGGAHRNPEA
ACCA_SHIBS      SSYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELK-LIDSIIPEPLGGAHRNPEA
ACCA_SHISS      STYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELK-LIDSIIPEPLGGAHRNPEA
ACCA_ECOL6      STYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELK-LIDSIIPEPLGGAHRNPEA
ACCA_SALTI      STYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELK-LIDSIIPEPLGGAHRNPEA
ACCA_SALTY      STYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELK-LIDSIIPEPLGGAHRNPEA
ACCA_SALCH      STYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELK-LIDSIIPEPLGGAHRNPEA
ACCA_SALPA      STYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELK-LIDSIIPEPLGGAHRNPEA
ACCA_PECAS      STYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELK-LIDTVIPEPLGSAHRNVPV
ACCA_YERPE      STYSVISPEGCASILWKSADKAPLAAEAMGITAHRLKELK-MIDSVIPEPLGGAHRDYAA
ACCA_YERPS      STYSVISPEGCASILWKSADKAPLAAEAMGITAHRLKELK-MIDSVIPEPLGGAHRDYAA
ACCA_PHOLL      STYSVISPEGCASILWKSAEKAPLAAEAMGITAPRLKELE-LVDTVISEPLGGAHRDYEA
ACCA_VIBVU      STYSVISPEGCASILWRDSDKAPQAAEAMGLVASRLKELE-LIDEIIEEPLGGAHRNHVQ
ACCA_VIBVY      STYSVISPEGCASILWRDSDKAPQAAEAMGLVASRLKELE-LIDEIIEEPLGGAHRNHVQ
ACCA_VIBPA      STYSVISPEGCASILWRDSDKAPQAAEAMGLTAPRLKELE-LIDEIIEEPLGGAHRDHVK
ACCA_VIBCH      STYSVISPEGCASILWRDSDKAPQAAEAMGLIAPRLKELE-LIDEIIEEPLGGAHRDHKQ
ACCA_ALIF1      STYSVISPEGCASILWRDSDKAPQAAEAMGLVAPRLKELE-LIDTIIDEPLGGAHRDHKA
ACCA_PHOPR      STYSVISPEGCASILWRDSNKAPQAAEAMGLTAGRLKELE-LIDSIIEEPLGGAHRDLEA
ACCA_HAEIN      STYSVISPEGCASILWKSAEKASTAAEVMGLTASRLKELN-LIDSIVQEPLGGAHRSYLE
ACCA_HAEI8      STYSVISPEGCASILWKSAEKASTAAEVMGLTASRLKELN-LIDSIMQEPLGGAHRNYAK
ACCA_HAEDU      STYSVISPEGCASILWKSAEKASMAAEVMGLTAQRLKELN-LIDGIVDEPLGGAHRDVLK
ACCA_MANSM      STYSVISPEGCASILWKSAEKASTAAEVMGLTASRLKELE-LIDNIVTEPLGGAHRQYDE
ACCA_PASMU      STYSVISPEGCASILWKSAEKASTAAEVMGLTANRLKELN-LIDSIIEEPLGGAHRDFDA
ACCA_PSE14      STYAVISPEGCASILWKTAEKAPDAAEAMGITADRLKGLG-IVDKVIAEPLGGAHRDPVA
ACCA_PSEU2      STYAVISPEGCASILWKTAEKAPDAAEAMGITADRLKGLG-IVDKVIAEPLGGAHRDPVA
ACCA_PSESM      STYAVISPEGCASILWKTAEKAPDAAEAMGITADRLKGLG-IVDKVIAEPLGGAHRDPVA
ACCA_PSEF5      STYAVISPEGCASILWKTSEKAADAAEAMGITAERLKGLG-IVDKVIGEPLGGAHRDPAA
ACCA_PSEPK      STYSVISPEGCASILWKTADKAADAAEAMGITAERLKSLN-IVDKVIQEPLGGAHRDPAK
ACCA_PSEAE      STYSVISPEGCASILWKTAEKAPEAAEAMGITAERLKGLG-IVDKVIDEPLGGAHRDPAS
ACCA_COXBU      AYYSVISPEGCASILWKSAEKAGEAAEALGLTANRLHELG-LIDEIIKEPLGGAHRDTDA
ACCA_METCA      STYSVISPEGCASILWKSADKAELAAEAMGITSERLMELG-LIDSIVPEPLGGAHRDRER
ACCA_LEGPL      SIYSVISPEGCASILWKDASKASEAARAMGITADRIFENE-LVDMVVPEPLGGAHRDVDE
ACCA_LEGPA      SIYSVISPEGCASILWKDASKASEAARAMGITADRIFENE-LVDMVVPEPLGGAHRDVDE
ACCA_LEGPH      SIYSVISPEGCASILWKDASKASEAARAMGITADRIFENE-LVDMVVPEPLGGAHRDVDE
ACCA_XANAC      GTYSVISPEGCASILWKDAAKAKDAAEQLGLTAKRLKGLG-LVDKVIREPTGGAHRNPEQ
ACCA_XANC5      GTYSVISPEGCASILWKDAAKAKDAAEQLGLTAKRLKGLG-LVDKVIREPTGGAHRNPEQ
ACCA_XANCP      GTYSVISPEGCASILWKDAAKAKDAAEQLGLTAKRLKGLG-LVDKVIREPTGGAHRNPEQ
ACCA_XANC8      GTYSVISPEGCASILWKDAAKAKDAAEQLGLTAKRLKGLG-LVDKVIREPTGGAHRNPEQ
ACCA_XANOR      GTYSVISPEGCASILWKDAGKAKDAAEQLGLTARRLKDLS-LVDKVIREPTGGAHRNPQQ
ACCA_XYLFA      STYSVITPEGCASILWKDAAKASDAAEQLNLTARRLKEFG-LIDKVIREPIGGAHRNPQQ
ACCA_XYLFT      STYSVITPEGCASILWKDAAKASDAAEQLNLTARRLKEFG-LIDKVIREPIGGAHRNPQQ
ACCA_CAMJE      SVFSVISPEGCAAILWNDPAKSEAATKAMKVTADDLKSQG-LIDDVIDEPTNGAHRNKEA
ACCA_CAMJR      SVFSVISPEGCAAILWNDPAKSEAATKAMKVTADDLKSQG-LIDDVIDEPTNGAHRNKEA
ACCA_HELHP      SIFSVISPEGCAAILWNDPSKIESATKALKITPIELKKCG-LIDDVINEPLIGAHRDKES
ACCA_WOLSU      SVFSVISPEGCAAILWNDPSKIESATKAMKITPDELKKAN-LIDDIIEEPEIGAHRDKEG
ACCA_HELPY      SIFSVISPEGCAAILWDDPSKTEVAIKAMKITPRDLKEAG-LIDDIILEPSKGAHRDKFS
ACCA_HELPJ      SIFSVISPEGCAAILWDDPSKTEVAIKAMKITPRDLKEAG-LIDDIILEPSKGAHRDKFS
ACCA_FRATT      SYFATISPEGCASILHKTAEKASEVTQMMNITSGRLKELK-IVDEVIPEPLGGAHRDYET
ACCA_RHOBA      AYYSVISPEGCAGILWKSHEHAPKAAAALRFTSDHLLRLG-VVDDVLEEPLGGAHRDHHQ
ACCA_AQUAE      AYYSVISPEGCAAILWKDQSKVKEAAKALRLTAKDLKELG-VVDCVIPEPYGAAHWSPRG
ACCA_AGRFC      SVYSVISPEGAASILWRDSTRAKEAATNMKITSEDLKSLG-VIDGIIPEPIGGAHRAPET
ACCA_RHIME      AIYSVISPEGAASILWRDSTRAKEAASNMKITAEDLKSLG-VIDGIIPEPVGGAHRDPDA
ACCA_BRUME      SIYSVISPEGAASILWHDSTRAKDAASNMRITAQDLFDLK-IIDGIIPEPLGGAHRGKES
ACCA_BRUSU      SIYSVISPEGAASILWHDSTRAKDAASNMRITAQDLFDLK-IIDGIIPEPLGGAHRGKES
ACCA_BRUAB      SIYSVISPEGAASILWHDSTRAKDAASNMRITAQDLFDLK-IIDGIIPEPLGGAHRGKES
ACCA_RHILO      AIYSVISPEGAASILWRDTTRSKDAATNMKITAQDLLELK-IIDAIIPEPMGGAQRAPEK
ACCA_NITWN      AIYSVISPEAASSILWRDSSKAQEAATNMKITAQDLLRFG-VIDAILKEPAGGAHRDPAA
ACCA_RHOPA      AVYSVISPEAASSILWRDGTKAQEAANSMKITAQDLLKFG-VIDQILAEPKGGAHRDPEA
ACCA_ZYMMO      AVYSVISPEGCASILWRDAGKASDAATAMKLTATDLYGLG-IVDRIVLEPVGGAHRDPKT
ACCA_CAUVC      SIYSVISPEGAASILWRDGARAKDAATQMRITAQDLIKLG-IVDRIVEEPAGGAHSDTEA
ACCA_RHOS4      SVYSVISPEGCASILWKDAEKMREAAEALRLTAQDLHKLG-VIDRIIKEPLGGAQRGRRE
ACCA_RUEPO      SIYSVISPEGCASILWKNAEKMREAAEALRLTAQDLLKLG-VVDRVIPEPRGGAHRDKTA
ACCA_PELUB      AIYSVISPEGCATILWRDPKRTLEAAKAMKLSSKDLLELK-VIDEIIPEPIGGAHRDRDL
                  ::  .*:. : :*         .   : .          : : :: *           

ACCA_BACAN      QSENIDLMLRKTFEQLNGISKDELIEKRYEKYMKIGQVSFSNASIWIK------------
ACCA_BACCZ      QSENIDLMLRKTFEQLNGISKDELIEKRYEKYMKIGQVSFSNASIWIK------------
ACCA_BACHK      QSENIDLMLRKTFEQLNGISKDELIEKRYEKYMKIGQVSFSNASIWIK------------
ACCA_BACCR      QSENIDLMIQKTFQQLNGISKDELIEKRYEKYMKIGQVSFSNASIWIK------------
ACCA_BACLD      QAAYIDEALKGELKSLLKLDKNELIQQRYNKYKSIGKISTENQYVGIK------------
ACCA_BACSU      QASYMDETLKQSLKTLLKLSEEELVQQRYEKYKAIGKVSVEDQYIGVN------------
ACCA_GEOKA      QAKEIDRVLRRSLKQLLALDGEELVRQRYEKFKQMGQVSFLPETIRAR------------
ACCA_BACHD      QAEAIDQVLEKSLKQLSSLTTEELLNKRYEKYKKIGEFSHVNDAISVN------------
ACCA_OCEIH      QAELIDNIIKQSLVELMLLSSEELVDKRWEKYKQMGTFMS--------------------
ACCA_LISMO      QAEEINKTITKSLHALMAFSEEQLIKQRYEKFKKIGVYETI-------------------
ACCA_LISMF      QAEEINKTITKSLHALMAFSEEQLIEQRYEKFKKIGVYDTL-------------------
ACCA_LISIN      QAEEINKTITKSLHALMAFSEEQLIEQRYDKFKKIGVYETL-------------------
ACCA_BACSK      QADEIDRLLEKALTRLAEKPVDVLLDERYEKFMKIGHIPEEAATTGQ-------------
ACCA_STAAC      QALAIKSAFVAQLDSLESLSRDEIANDRFEKFRNIGSYIE--------------------
ACCA_STAAS      QALAIKSAFVAQLDSLESLSRDEIANDRFEKFRNIGSYIE--------------------
ACCA_STAAW      QALAIKSAFVAQLDSLESLSRDEIANDRFEKFRNIGSYIE--------------------
ACCA_STAAR      QALAIKSAFVEQLDSLESLSRDEIANDRFEKFRNIGSYIE--------------------
ACCA_STAAM      QALAIKSAFVAQLDSLESLSRDEIANDRFEKFRNIGSYIE--------------------
ACCA_STAAN      QALAIKSAFVAQLDSLESLSRDEIANDRFEKFRNIGSYIE--------------------
ACCA_STAHJ      QAIDIKQAFVDQLEQLQQQSADELVEDRFNKFRNIGAFIEK-------------------
ACCA_STAES      QALSIKKMFLKHLNELKQLTPEELANDRFEKFRKIGSVVE--------------------
ACCA_STAEQ      QALSIKKMFLKHLNELKQLTPEELANDRFEKFRKIGSVVE--------------------
ACCA_STAS1      QAQSIKRTFESHLSELNQLTQEELVEDRYQKFRTIGSYTE--------------------
ACCA_CLOAB      VANALRENLKKAIEGLSSTGINELLDNRYNKFRQIGKFIENEDN----------------
ACCA_CLOPE      MAQNIKKTILEALGEMKGTDLDTLLNERYNKYRNIENNL---------------------
ACCA_STRPN      LIKSVKKELQTELARLSQKPLEELLEERYQRFRKY-------------------------
ACCA_STRR6      LIKSVKKELQTELARLSQKPLEELLEERYQRFRKY-------------------------
ACCA_STRT2      IIEAIKTAIVDELAELSQLSTEDLLEARYQRFRKY-------------------------
ACCA_STRT1      IIEAIKTAIVDELAELSQLSTEDLLEARYQRFRRY-------------------------
ACCA_ENTFA      INRMLQKAFISKLTELAKLDTETLLEKRYQRFRKY-------------------------
ACCA_CARHZ      TLKAVKEEVVKNLQILKETPVEELLRRRYQRYRYIGSGIVEGGVS---------------
ACCA_TREDE      TADAIKEQILKDLADLTKRDPAVLVKYRSKKIRSIGKYSE--------------------
ACCA_CHLMU      TYRSVQEYVLQEWLKLKDLPVEELLEKRYQKFRTIGLYETSSESSSEA------------
ACCA_CHLTR      TYRSVQEYVLQEWLKLKDLPVEELLEKRYQKFRTIGLYETSSESDSEA------------
ACCA_CHLAB      VYRDVRDFILREWLRLKDLSIEDLLEQRYQKFRTIGLYETSSESSPEA------------
ACCA_CHLCV      VYRNVQNFILQEWLRLKDLSIEDLLEKRYQKFRTIGLYETSSESGPEA------------
ACCA_CHLPN      VYSNVREFIIQEWLRLKDLAIEELLEKRYEKFRSIGLYETTSESGPEA------------
ACCA_PARUW      TYQNVKQFLVEQLHILRRIPSQILLEQRYLKFRQMGEFLEG-------------------
ACCA_FUSNN      TAFNLKNVVLEAVNELEKLPVDELVEKRYEKFRQMGVFNR--------------------
ACCA_NOSS1      AATTLKQALLDNLDELDRLTSQERRQLRYDKFRKIGVFTEVAH-----------------
ACCA_SYNY3      AAAKLKEALLFHLNTLAQLTPQERKQLRYDKFRHLGQFLETAV-----------------
ACCA_SYNP6      TAQSLRQVLLRHLKDLQALSPAQLREQRYQKFRQLGVFLESSD-----------------
ACCA_SYNE7      TAQSLRQVLLRHLKDLQALSPAQLREQRYQKFRQLGVFLESSD-----------------
ACCA_THEEB      AAENLKAALLRNLAEVQALSSSERRELRYQKFRRMGVFTEAV------------------
ACCA_PROMA      AGEALKTSILRHLTELSTLSEHKLRDNRYKKFRQIGSFLELSSQEEQLIT----------
ACCA_PROMT      AGDTLKNALEKHLSELLALSPDELRNNRYSKFRKMGKYLESQSIESEISV----------
ACCA_PROMM      AGEVLREAIERHLDELLGLKVNQLREARYRKFRAMGRVLDPSSSETGLPA----------
ACCA_SYNPX      AGQTLRAALERHLGELLALSERELKEGRYRKFRAMGRFVEGNSQNPGKID----------
ACCA_PROMP      AGNTLKGAIEKHLNELLELKKEELLEQRYSKFRVLGKFVESNNFEEIQEQLPQITE----
ACCA_GLOVI      AAANLKEALLRHLDELLTLDGPTRRTQRYEKFRAMARFQEI-------------------
ACCA_ANTSP      ASHILHSKLVTELNYLLSLSSDKLKELRIPKIRRMGTFYEG-------------------
ACCA_GRATL      AAYILKESLISELHFLTQLLPSKRKNLRYSKFRKIGTFYEGSEDYFG-------------
ACCA_PORPU      ASKYLRKELIKQLNILLRLNKSELKIQRYEKFRKMGAFYEI-------------------
ACCA_CYACA      MVRILKNKIRDQLDFFDTFSPSELKHHRYLKFRKLGLYYDC-------------------
ACCA_THET2      AIRNIKEALLKALEELKGLSPEALYEDRYRRFRSLGAFAEP-------------------
ACCA_THET8      AIRNIKEALLKALEELKGLSPEALYEDRYRRFRSLGAFAEP-------------------
ACCA_DEIRA      AAEALGSVISRHLDDLSALTPDDLLAQRAARFRSLGAFEER-------------------
ACCA_GEOSL      MARTLHEAIARQLKELKAIPAEQLVEERYQKFRKMSRFIEG-------------------
ACCA_PELCD      AAEQVRICLKKHLDDLKDLSSDELREQRYQKLRAMTMVQE--------------------
ACCA_CHLTE      MASTLKSILIEELQGLLTKDARTLVDERIAKFSGMGVWEES-------------------
ACCA_AROAE      MAQTLKRALQDALRQVADLSPAELVEKRLERLMSYGRFKEQKVA----------------
ACCA_DECAR      MAQNLKKALQDALKQLSGLSTAELLATRYERLMSYGRFKEQAVS----------------
ACCA_BORBR      MARLLRRALGDALRQLQGLGPEQLVDQRLQRLMSYGRFQEVRA-----------------
ACCA_BORPA      MARLLRRALGDALRQLQGLGPEQLVDQRLQRLMSYGRFQEVRA-----------------
ACCA_BORPE      MARLLRRALGDALRQLQGLGPEQLVDQRLQRLMSYGRFQEVRA-----------------
ACCA_BURMA      MAALLRRALGDSLRQFQGMSVDALRERRFERLMAYGKFKETTPRA---------------
ACCA_BURPS      MAALLRRALGDSLRQFQGMSVDALRERRFERLMAYGKFKETTPRA---------------
ACCA_CUPPJ      MAAMLKRSLAESLRQFQGVSVKELQARRYERLLAYGKFKETGAQE---------------
ACCA_RALSO      MATMLKRALAESLRQFQGMKTSELQARRHERLMAYGKFKETGSN----------------
ACCA_NEIMA      TMKNVKAVLEKQLHEAQSIPLADLLSRRFDRIMAYGKFSEQ-------------------
ACCA_NEIMB      TMKNVKAVLEKQLHEAQSIPLADLLSRRFDRIMAYGKFSEQ-------------------
ACCA_NEIG1      TMKNVKAVLEKQLHEAQSIPLADLLSRRFDRIMAYGKFSEQ-------------------
ACCA_CHRVO      MMTTLKRVLQDQLKEVQSKPMDALLKERFDRLMSYGRFKEDAA-----------------
ACCA_NITEU      VMQSVKQTLQESLRKLQDIPLETLLQKRLDRLLGYGRFKINQPD----------------
ACCA_THIDA      MFQSMRRALTDTLAELRKQPTEAMLGARYQRLRAYGSFKEAPAR----------------
ACCA_BLOFL      TSISIKTQLLLDLVELDALQEEKLLTRRYQKFMNYGYC----------------------
ACCA_BLOPB      TSISLKTQLLLDLTELDSFDEKELLNRRYQRLMHYGYC----------------------
ACCA_WIGBR      ITSNLKNRILKDLKELDKFTTSDLLNNRYKKLMSYGYN----------------------
ACCA_IDILO      MAVRLKRQLIADLGSLQGLSHEELLDQRYRKLMSFGYC----------------------
ACCA_PSEHT      MARNLKVRLKRDLADLQALSLEEMLDQRYKRLMSFGYCS---------------------
ACCA_COLP3      MAAHLKQAIKKDLSELEGLSKDELIEQRYDRLMSFGYC----------------------
ACCA_ECOLI      MAASLKAQLLADLADLDVLSTEDLKNRRYQRLMSYGYA----------------------
ACCA_ECO57      MAASLKAQLLADLADLDVLSTEDLKNRRYQRLMSYGYA----------------------
ACCA_SHIFL      MAASLKAQLLADLADLDVLSTEDLKNRRYQRLMSYGYA----------------------
ACCA_SHIDS      MAASLKAQLLADLADLDVLSTEDLKNRRYQRLMSYGYA----------------------
ACCA_SHIBS      MAASLKAQLLADLADLDVLSTEDLKNRRYQRLMSYGYA----------------------
ACCA_SHISS      MAVSLKAQLLADLADLDVLSTEDLKNRRYQRLMSYGYA----------------------
ACCA_ECOL6      MAASLKAQLLADLADLDVLSTEDLKNRRYQRLMSYGYA----------------------
ACCA_SALTI      MAASLKAQLLEDLADLDVLSTDDLKNRRYQRLMSYGYA----------------------
ACCA_SALTY      MAASLKAQLLEDLADLDVLSTDDLKNRRYQRLMSYGYA----------------------
ACCA_SALCH      MAASLKAQLLEDLADLDVLSTDDLKNRRYQRLMSYGYA----------------------
ACCA_SALPA      MAASLKAQLLEDLADLDVLSTDDLKNRRYQRLMSYGYA----------------------
ACCA_PECAS      MAASLKAQLLADLLDLEGLSEEALLNRRYQRLMNYGYC----------------------
ACCA_YERPE      IAISLKAQLLADLNDLDVLNDEELLNRRYQRLMNYGYC----------------------
ACCA_YERPS      IAISLKAQLLADLNDLDVLNDEELLNRRYQRLMNYGYC----------------------
ACCA_PHOLL      ISTSLKAQLLIDLAELDHLTSEELVNRRYQRLMQYGYC----------------------
ACCA_VIBVU      MAANMKATLLRQLAELEQFPQDVLLERRYQRLMNYGYC----------------------
ACCA_VIBVY      MAANMKATLLRQLAELEQFPQDVLLERRYQRLMNYGYC----------------------
ACCA_VIBPA      MAENMKATLLRQLEDLEQLDEESLRERRYQRLMNYGYC----------------------
ACCA_VIBCH      TAENVKATLLRQLADLDALDHENLLERRYQRLMNYGYC----------------------
ACCA_ALIF1      TAENIKQRLLEQLKELDAFDNEALLERRYQRLMSYGYC----------------------
ACCA_PHOPR      ISASLKATLVANLAELEALDTDELLERRYQRLMSYGYC----------------------
ACCA_HAEIN      IAENLKLRLKEDLAELDELSKEELLNRRYERLMSYGYC----------------------
ACCA_HAEI8      IAENLKLRLKEDLAELDELSKEELLNRRYERLMSYGYC----------------------
ACCA_HAEDU      IAHNLKQQILADLAELDSLTTEALLERRYERLMSYGYV----------------------
ACCA_MANSM      MAQALKQRILSDLEDLDILDKETLLDRRYQRLMNYGYV----------------------
ACCA_PASMU      MAHNLKQRLLDDLKELEMLDEDNLLHRRYNRLMDYGYC----------------------
ACCA_PSE14      AAALIREELSSQLAMLKEFDNDELLARRYDRLMSYGL-----------------------
ACCA_PSEU2      AAALIREELSSQLAMLKEFDNDELLARRYDRLMSYGL-----------------------
ACCA_PSESM      AAALIREELSSQLAMLKAFDNDALLARRYDRLMSYGL-----------------------
ACCA_PSEF5      AAASIRAELSTQLAMLKEMDNDTLLARRYDRLMSYGL-----------------------
ACCA_PSEPK      MSESIRADLVQQLDMLGKFDNDALLARRYERLMSYGL-----------------------
ACCA_PSEAE      MAESIRGELLAQLKMLQGLEMGELLERRYDRLMSYGAP----------------------
ACCA_COXBU      MAEKLKKHLQANLTNLQAKSANDLLEERYRRWLSYGKD----------------------
ACCA_METCA      MADNLKTELKRNLEELAALPMEELLAMRYERLMGYGVYEEPAT-----------------
ACCA_LEGPL      MASRLKRLLTSELQALKKVPLDQLIELRYQKFMAMGACD---------------------
ACCA_LEGPA      MASRLKRLLTSELQALKKVPLDQLIELRYQKFMAMGACD---------------------
ACCA_LEGPH      MASRLKRLLTSELQALKKVPLDQLIELRYQKFMAMGACD---------------------
ACCA_XANAC      MGKRLKAVLLNELDALEKIPVDTLLQQRYERLRSYGAYEGH-------------------
ACCA_XANC5      MGKRLKAVLLNELDALEKIPVDALLQQRYERLRSYGAYEGH-------------------
ACCA_XANCP      MGKRLKAVLLNELDALEKVPVDALMQQRYERLRSYGAYEGH-------------------
ACCA_XANC8      MGKRLKAVLLNELDALEKVPVDALMQQRYERLRSYGAYEGH-------------------
ACCA_XANOR      MGKRLKAVLLNELDALEKVPLETLLQQRYERLRSYGAYEGR-------------------
ACCA_XYLFA      MANRLKAVLLNELEALDKVPLVTLLNQRHKRLRTYGAYENH-------------------
ACCA_XYLFT      MANRLKAVLLNELEALDKVPLVTLLNQRHKRLRTYGAYENH-------------------
ACCA_CAMJE      AAVAIADYVKKSLNELENIDVRELSANRMQKILKLGAYQEA-------------------
ACCA_CAMJR      AAVAIADYVKKSLNELENIDVRELSANRMQKILKLGAYQEA-------------------
ACCA_HELHP      AAKAIESYFLKAFEEISQDD--NYLNKRYQKLMNYGAFS---------------------
ACCA_WOLSU      AAKSLVNYFLKSLEEIRGEE--HYLQKRFDRLMSYGSFTQSA------------------
ACCA_HELPY      AANTIKEYFLDALRTIQQDP--HFLDNRYQKLMSLGSFVESMN-----------------
ACCA_HELPJ      AANTIKEYFLDALRTIQQDP--HFLDNRYQKLMSLGSFVESMN-----------------
ACCA_FRATT      TATNIRKAVAAELKILSEMTVEQRNSRRYDKLMSFGRFKEA-------------------
ACCA_RHOBA      MATRMKTYLSRQLSELEEMPVDLMLEQRYEKFRKLGVFLEES------------------
ACCA_AQUAE      TAMMVGMTLKKCLDELSKLTEEGVVRSRLEKFKNMGAFKIAS------------------
ACCA_AGRFC      VISATGDVIAKALADLSQRSGTQLRAERRQKFLDIGRNL---------------------
ACCA_RHIME      VISRTETVIGDALKELSARNGDELRADRRQKYLNIGRNL---------------------
ACCA_BRUME      VIDATGDIIAASLRSMKDIDGETLKQERRQKFLEIGRNI---------------------
ACCA_BRUSU      VIDATGDIIAASLRSMKDIDGETLKQERRQKFLEIGRNI---------------------
ACCA_BRUAB      VIDAAGDIIAASLRSMKDIDGETLKQERRQKFLEIGRNI---------------------
ACCA_RHILO      VIAATGDLIAKTMKEFAGANTDFREQ-RREKYLAMGRSL---------------------
ACCA_NITWN      VIALTGDAIAGALNDLRNLDRDSLRQQRRQKFIDIGRKLG--------------------
ACCA_RHOPA      MIATAGDAIAAAFAELKGQGRDAIRAKRRQKFLDIGRKLA--------------------
ACCA_ZYMMO      AIDALKMALLQELAFLKPMDRDALRSMRRKKFLDIGG-----------------------
ACCA_CAUVC      AIQAVGDAVEDELKAMAAMSPAELKKQRSDRFYAIGRAGLQ-------------------
ACCA_RHOS4      TVDAVGKAIEMMLKELVGRKPEWLVKDRRNKFLDMGSKGLAA------------------
ACCA_RUEPO      AMEAVRGAIAAMLKELDGKSAEALIKDRRKKFLDIGSKGLAA------------------
ACCA_PELUB      ILDNVRKSIEKNLNEFFNMSGEEIFNHRKNKFLTIGRSKGFVNQIDDLSTLSMKESKVNL
                        .                  *  :                             

ACCA_BACAN      -----------------------------
ACCA_BACCZ      -----------------------------
ACCA_BACHK      -----------------------------
ACCA_BACCR      -----------------------------
ACCA_BACLD      -----------------------------
ACCA_BACSU      -----------------------------
ACCA_GEOKA      -----------------------------
ACCA_BACHD      -----------------------------
ACCA_OCEIH      -----------------------------
ACCA_LISMO      -----------------------------
ACCA_LISMF      -----------------------------
ACCA_LISIN      -----------------------------
ACCA_BACSK      -----------------------------
ACCA_STAAC      -----------------------------
ACCA_STAAS      -----------------------------
ACCA_STAAW      -----------------------------
ACCA_STAAR      -----------------------------
ACCA_STAAM      -----------------------------
ACCA_STAAN      -----------------------------
ACCA_STAHJ      -----------------------------
ACCA_STAES      -----------------------------
ACCA_STAEQ      -----------------------------
ACCA_STAS1      -----------------------------
ACCA_CLOAB      -----------------------------
ACCA_CLOPE      -----------------------------
ACCA_STRPN      -----------------------------
ACCA_STRR6      -----------------------------
ACCA_STRT2      -----------------------------
ACCA_STRT1      -----------------------------
ACCA_ENTFA      -----------------------------
ACCA_CARHZ      -----------------------------
ACCA_TREDE      -----------------------------
ACCA_CHLMU      -----------------------------
ACCA_CHLTR      -----------------------------
ACCA_CHLAB      -----------------------------
ACCA_CHLCV      -----------------------------
ACCA_CHLPN      -----------------------------
ACCA_PARUW      -----------------------------
ACCA_FUSNN      -----------------------------
ACCA_NOSS1      -----------------------------
ACCA_SYNY3      -----------------------------
ACCA_SYNP6      -----------------------------
ACCA_SYNE7      -----------------------------
ACCA_THEEB      -----------------------------
ACCA_PROMA      -----------------------------
ACCA_PROMT      -----------------------------
ACCA_PROMM      -----------------------------
ACCA_SYNPX      -----------------------------
ACCA_PROMP      -----------------------------
ACCA_GLOVI      -----------------------------
ACCA_ANTSP      -----------------------------
ACCA_GRATL      -----------------------------
ACCA_PORPU      -----------------------------
ACCA_CYACA      -----------------------------
ACCA_THET2      -----------------------------
ACCA_THET8      -----------------------------
ACCA_DEIRA      -----------------------------
ACCA_GEOSL      -----------------------------
ACCA_PELCD      -----------------------------
ACCA_CHLTE      -----------------------------
ACCA_AROAE      -----------------------------
ACCA_DECAR      -----------------------------
ACCA_BORBR      -----------------------------
ACCA_BORPA      -----------------------------
ACCA_BORPE      -----------------------------
ACCA_BURMA      -----------------------------
ACCA_BURPS      -----------------------------
ACCA_CUPPJ      -----------------------------
ACCA_RALSO      -----------------------------
ACCA_NEIMA      -----------------------------
ACCA_NEIMB      -----------------------------
ACCA_NEIG1      -----------------------------
ACCA_CHRVO      -----------------------------
ACCA_NITEU      -----------------------------
ACCA_THIDA      -----------------------------
ACCA_BLOFL      -----------------------------
ACCA_BLOPB      -----------------------------
ACCA_WIGBR      -----------------------------
ACCA_IDILO      -----------------------------
ACCA_PSEHT      -----------------------------
ACCA_COLP3      -----------------------------
ACCA_ECOLI      -----------------------------
ACCA_ECO57      -----------------------------
ACCA_SHIFL      -----------------------------
ACCA_SHIDS      -----------------------------
ACCA_SHIBS      -----------------------------
ACCA_SHISS      -----------------------------
ACCA_ECOL6      -----------------------------
ACCA_SALTI      -----------------------------
ACCA_SALTY      -----------------------------
ACCA_SALCH      -----------------------------
ACCA_SALPA      -----------------------------
ACCA_PECAS      -----------------------------
ACCA_YERPE      -----------------------------
ACCA_YERPS      -----------------------------
ACCA_PHOLL      -----------------------------
ACCA_VIBVU      -----------------------------
ACCA_VIBVY      -----------------------------
ACCA_VIBPA      -----------------------------
ACCA_VIBCH      -----------------------------
ACCA_ALIF1      -----------------------------
ACCA_PHOPR      -----------------------------
ACCA_HAEIN      -----------------------------
ACCA_HAEI8      -----------------------------
ACCA_HAEDU      -----------------------------
ACCA_MANSM      -----------------------------
ACCA_PASMU      -----------------------------
ACCA_PSE14      -----------------------------
ACCA_PSEU2      -----------------------------
ACCA_PSESM      -----------------------------
ACCA_PSEF5      -----------------------------
ACCA_PSEPK      -----------------------------
ACCA_PSEAE      -----------------------------
ACCA_COXBU      -----------------------------
ACCA_METCA      -----------------------------
ACCA_LEGPL      -----------------------------
ACCA_LEGPA      -----------------------------
ACCA_LEGPH      -----------------------------
ACCA_XANAC      -----------------------------
ACCA_XANC5      -----------------------------
ACCA_XANCP      -----------------------------
ACCA_XANC8      -----------------------------
ACCA_XANOR      -----------------------------
ACCA_XYLFA      -----------------------------
ACCA_XYLFT      -----------------------------
ACCA_CAMJE      -----------------------------
ACCA_CAMJR      -----------------------------
ACCA_HELHP      -----------------------------
ACCA_WOLSU      -----------------------------
ACCA_HELPY      -----------------------------
ACCA_HELPJ      -----------------------------
ACCA_FRATT      -----------------------------
ACCA_RHOBA      -----------------------------
ACCA_AQUAE      -----------------------------
ACCA_AGRFC      -----------------------------
ACCA_RHIME      -----------------------------
ACCA_BRUME      -----------------------------
ACCA_BRUSU      -----------------------------
ACCA_BRUAB      -----------------------------
ACCA_RHILO      -----------------------------
ACCA_NITWN      -----------------------------
ACCA_RHOPA      -----------------------------
ACCA_ZYMMO      -----------------------------
ACCA_CAUVC      -----------------------------
ACCA_RHOS4      -----------------------------
ACCA_RUEPO      -----------------------------
ACCA_PELUB      FIKNFFKSKLNLAVLFGVIVLLGYFIFSL