CLUSTAL format seed alignment for MF_00824

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y1176_STAAM      --MSEIKRLEINYKTDELFENFRAFGNKDLYMVNELNGQMIDASSDSPFYGIFVGDQLGA
Y1019_STAAN      --MSEIKRLEINYKTDELFENFRAFGNKDLYMVNELNGQMIDASSDSPFYGIFVGDQLGA
Y1059_STAAW      --MSEIKRLEINYKTDELFENFRAFGNKDLYMVNELNGQMIDASSDSPFYGIFVGDQLGA
Y1110_STAAS      --MSEIKRLEINYKTDELFENFRAFGNKDLYMVNELNGQMIDASSDSPFYGIFVGDQLGA
Y1152_STAAR      --MSEIKRLEINYKTDELFENFRAFGNKDLYMVNELNGQMIDASSDSPFYGIFVGDQLGA
Y1189_STAAC      --MSEIKRLEINYKTDELFENFRAFGNKDLYMVNELNGQMIDASSDSPFYGIFVGDQLGA
Y1040_STAAB      --MSEIKRLEINYKTDELFENFRAFGNKDLYMVNELNGQMIDASSDSPFYGIFVGDQLGA
Y1739_STAHJ      --MSEVKHLEINYKTDELFEAFREFGNKDLYMVEELQGQMIDASSESPFYGIFHGENLVA
Y851_STAES       --MGEVKHLQINYKTDELFADFREFGNKNLYMIEELKGQMIDASSDSPFYGIFVGNKLVA
Y741_STAEQ       --MGEVKHLQINYKTDELFADFREFGNKNLYMIEELKGQMIDASSDSPFYGIFVGNKLVA
Y1595_STAS1      --MSSVKRLDINYKTDELFEDFRNFGNKDLYLVDELRGEMIDASSDSPFYGIYVGDCLGA
Y4060_BACAN      MGFPKVERLLINYKTLDEFKKFKGCGAQELSMLEELQANIIENDSESPFYGIYYGGSLIA
Y3663_BACHK      MGFPKVERLLINYKTLDEFKKFKGCGAQELSMLEELQANIIENDSESPFYGIYYGGSLIA
Y3680_BACCZ      MGFPKVERLLINYKTLDEFKKFKGCGAQELSMLEELQANIIENDSESPFYGIYYGGSLIA
Y3967_BACC1      MGFPKVERLLINYKTLDEFKKFKGCGAQELSMLEELQANIIENNSESPFYGIYYGGSLIA
Y3921_BACCR      MGFPKVERLLINYKTLDEFKKFKGCGAQELSMLEELQANIIENDSESPFYGIYYGGSLIA
Y2369_BACSK      -MTIKVERLLVNYKTLEEFRHFREYGAAELSMKDDLKNSIIENDSESPFYGIYYGKKLVA
Y2580_ALKHC      MQQIEVKRLLVNYKTLEEFRNFREFGAAELSMKDDLEANIIENDSESPFYGIYFGGKLVA
Y1727_BACLD      --MVKVERLLINYKTLEEFKKFREYGIQELSMLEDLESNMIENDSNSPFYGIYYGNRLVA
YLBP_BACSU       --MTKVERLLINYKTLEEFKKFKEYGIQELSMLEELQDNIIENDSTSPFYGIYFGDKLVA
Y1458_OCEIH      MENVKVENLLINYKTLEKFKRFREYGNQELTMMEDLENNIIENDSKSPFYGIYFGNNLIA
                     .::.* :**** : *  *:  *  :* : ::*. .:*: .* ******: *  * *

Y1176_STAAM      RMALLKKGDVEEIYFPDFEDYILLWKLEVLPKYQNRGYASELIDFAKSFNMPIKAIGRND
Y1019_STAAN      RMALLKKGDVEEIYFPDFEDYILLWKLEVLPKYQNRGYASELIDFAKSFNMPIKAIGRND
Y1059_STAAW      RMALLKKGDVEEIYFPDFEDYILLWKLEVLPKYQNRGYASELIDFAKSFNMPIKAIGRND
Y1110_STAAS      RMALLKKGDVEEIYFPDFEDYILLWKLEVLPKYQNRGYASELIDFAKSFNMPIKAIGRND
Y1152_STAAR      RMALLKKGDVEEIYFPDFEDYILLWKLEVLPKYQNRGYASELIDFAKSFNMPIKAIGRND
Y1189_STAAC      RMALLKKGDVEEIYFPDFEDYILLWKLEVLPKYQNRGYASELIDFAKSFNMPIKAIGRND
Y1040_STAAB      RMALLKKGDVEEIYFPDFEDYILLWKLEVLPKYQNRGYASELIDFAKSFNMPIKAIGRND
Y1739_STAHJ      RMALLKKGDVEEIYFPEFDDYLLLWKLEVLDNYKNKGYGQSLIDYAKSYNMPIKAIARQN
Y851_STAES       RMALLDKGEVEETYFPNSNDYILLWKLEVLDTYQRRGYAKQLLNFAKENKKPIKAIARNN
Y741_STAEQ       RMALLDKGEVEETYFPNSNYYILLWKLEVLDTYQRRGYAKQLLNFAKENKKPIKAIARNN
Y1595_STAS1      RMALYRKGEVEETHFPGFDDYNVIWKLEVLRDFQGRGYGTSLLDFAKDQGLPIKVIARNQ
Y4060_BACAN      RMSLYMK-RNGGEPFEITGTYLELYKLEVLPNFQKQGFGEMLVNYAKGLQFPIKTIARIH
Y3663_BACHK      RMSLYMK-RNGGEPFEITGTYLELYKLEVLPNFQKQGFGEMLVNYAKGLQFPIKTIARIH
Y3680_BACCZ      RMSLYMK-RNGGEPFEITGTYLELYKLEVLPNFQKQGFGEMLVNYAKGLQFPIKTIARIH
Y3967_BACC1      RMSLYMK-RNGGEPFEITGTYLELYKLEVLPTFQKQGFGEMLVNYAKGLQFPIKTIARIH
Y3921_BACCR      RMSLYMK-RNGGEPFEITGPYLELYKLEVLPTFQKQGFGQMLVNHAKQMQFPIKTIARIH
Y2369_BACSK      RMSLYKIDGNFDRYFDPPQDYLELWKLEVLEPYRGRGYGRALVDFAKSFGLPVKTNARQS
Y2580_ALKHC      RMSLYRIDGKYDRYFEPPQDYLELWKLEVLEPYRGKGFGRALVDFAKSFNLPVKTNARQR
Y1727_BACLD      RMSLYKVDGKSNQYFEEGQDYLELWKLEVLPGYQRNGYGTMLVEFAKSFGLPIRTSPRVK
YLBP_BACSU       RMSLYQVNGKSNPYFDNRQDYLELWKLEVLPGYQNRGYGRALVEFAKSFKMPIRTNPRMK
Y1458_OCEIH      RMSLYEVSKQYDYYFEPSQDYLTLWKLEVLPDYQNKGYGEVLVNFAKSFELPIKTNPRIN
                 **:*          *     *  ::*****  :: .*:.  *::.**    *::.  *  

Y1176_STAAM      SKDFFLHHGFTDVEAKNIE--GHDVLLWKPIR-----------------
Y1019_STAAN      SKDFFLHHGFTDVEAKNIE--GHDVLLWKP-------------------
Y1059_STAAW      SKDFFLHHGFTDVEAKNIE--GHDVLLWKP-------------------
Y1110_STAAS      SKDFFLHHGFTDVEAKNIE--GHDVLLWKP-------------------
Y1152_STAAR      SKDFFLHHGFTDVEAKNIE--GHDVLLWKP-------------------
Y1189_STAAC      SKDFFLHHGFTDVEAKNIE--GHDVLLWKP-------------------
Y1040_STAAB      SKDFFLHHGFTDVEAKNIE--GHDVLLWKP-------------------
Y1739_STAHJ      SKEFLMNQDFEDVHAKNPE--GHDVLVWAPK------------------
Y851_STAES       SKEFFLKQGFKDVETKNPE--GHDILIWNP-------------------
Y741_STAEQ       SKAFFLTQGFKDVATKNPE--GHDILIWNP-------------------
Y1595_STAS1      SKDFFIKQGFTDLEETNRD--GHDVLVWTP-------------------
Y4060_BACAN      SAGFWDKLNFQPVSVPD----GD-FYVWHPETNLNAVTNEESA------
Y3663_BACHK      SAGFWDKLNFQPVSVPD----GD-FYVWHPETNLNAVTNEESA------
Y3680_BACCZ      SAGFWDKLNFQPVSVPD----GD-FYVWHPETNLNTVTNEESA------
Y3967_BACC1      SAGFWDKLNFQPVSVPD----GD-FYVWHPETNLNTVTNEESA------
Y3921_BACCR      SAGFWDKLNFNPVSVTD----GD-FYIWHPETNLNAVTNEESA------
Y2369_BACSK      TGEFWNKLGFEPITYNEARDRGESPYVWFPQGVQEQTTKPEQARAE---
Y2580_ALKHC      SNEFWTKMGFEPVTYQTDRDRGESPYVWYPEGVKEQLSEDEGSVETLEN
Y1727_BACLD      SSDFWNKMGFTPVKYDMARDKGENPLVWHPASEPSQSS-ESA-------
YLBP_BACSU       SAEFWNKMNFKTVKYDMARDKGENPLIWHPDMDREMTPGESA-------
Y1458_OCEIH      SHGFWEKMGFIKAHYEMERDLGENPLIWLPEGVKEKDMKS---------
                 :  *    .*           *.   :* *