CLUSTAL format seed alignment for MF_00825

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

3HAO_CUPMC        --MLTYGAPFNFPRWIDEHAHLLKPPVGNRQVW-Q-----DSDFIVTVVGGPNHRTDYHD
3HAO_CAEBR        ---MAGVTAIEIPQWIQDNQGDFVPPVCNKCMF-------SDQLKVFYVGGPNQRKDFHL
3HAO_CAEEL        ---MSGVTAIEIPQWIQDNQEDFVPPVCNKCMF-------SDQLKVFYVGGPNQRKDFHL
E9HND5_DAPPU      ----MSIQLCNINQWIEDNKASFLPPVCNKLMH-------EKQLKVFFVGGPNQRKDFHI
3HAO_DANRE        --MTNQSLHVNIDKWIAENETSFLPPVCNKLMF-------FYQLNIMYVGGPNVRKDYHI
3HAO_XENTR        -----MAIPVNVKKWIDENREYFLPPVCNKLMQ-------NHQLKVMFVGGPNQRKDYHI
G1PEL8_MYOLU      -----MERPVRVRTWVEENRDSFLPPVCNKLLH-------KEQLKVMFIGGPNIRKDYHI
I3M6Q5_ICTTR      -----MERRVRVKTWVEDNRASFQPPVCNKLMH-------QEQLKIMFVGGPNIRKDYHI
H0WRX4_OTOGA      -----MQRPVPVRTWVEENRASFMPPVCNKLMH-------QKQLKIMFVGGPNSRKDYHI
3HAO_BOVIN        -----MERPVRVKAWVEENRGSFLPPVCNKLLH-------QKQLKIMFVGGPNTRKDYHI
3HAO_HUMAN        -----MERRLGVRAWVKENRGSFQPPVCNKLMH-------QEQLKVMFIGGPNTRKDYHI
G1S437_NOMLE      -----MERRVGVRAWVEENRGSFQPPVCNKLMH-------QEQLKVMFVGGPNTRKDYHI
3HAO_MOUSE        -----MERRVRVKSWVEENRASFQPPVCNKLMH-------QEQLKIMFVGGPNTRKDYHI
3HAO_RAT          -----MERCVRVKSWVEENRASFQPPVCNKLMH-------REQLKIMFVGGPNTRKDYHI
3HAO_NEMVE        -----------MMEWIDENSSLFVPPVCNKLMY-G-----EGQLKIMFVGGPNTRKDYHL
B3RUS6_TRIAD      ----MAGQTIALTKWIDENESSFKPPVCNKLLF-G-----AGQLKIMFVGGPNNRKDYHL
D3B432_POLPP      -----MLPPLNINKWVEEHKHLLEPPVNAKLIY-D---DPDSTFVIMIVGGPNQRTDYHI
3HAO_DICDI        -----MLPPININKWIEENKSLLQPPVGAKLLY-T---DIDSTFVVMIVGGPNQRTDYHV
F1A3J7_DICPU      -----MLPPININKWIENNKHLLQPPVGAQLLY-N---EPNSTFVIMIVGGPNQRTDYHV
I1CI75_RHIO9      ----MALLPINFPRWLEENSDKLQPPVNNSVLY-K-----GNDTIIMIVGGPNKRTDYHV
3HAO_CRYNJ        ----MLPPPINFPKWLEANSHLLKPPVGNKCLY-K-----GSNFITMIVGGPNTRVDFHI
E3KBU9_PUCGT      MTGTVLAPPINFLKWIQENGDKLKPPVNNFCIY-D-----GHDFITMVVGGPNARNDYHV
3HAO_USTMA        ---MPFPLPLNFPKWLSENEHLLQPPVGNFCLF-R-----TRDYTVMAVGGPNARSDYHY
C0NG14_AJECG      ----MLPPALNIPRWLAENAHLLQPPINNYCVY-HPSSTATKGYTVMVVGGPNARTDYHI
3HAO1_ASPFU       ----MLPPALNIPKWLEENSHLLQPPVNNYCVY-HPSSPATAGYTVMIVGGPNARTDYHI
C8VME6_EMENI      ----MLPPALNIPKWLEANSHLLQPPVNNYCVY-HPSSPATSGYTVMIVGGPNARTDYHI
3HAO_YEAST        ---MFNTTPINIDKWLKENEGLLKPPVNNYCLH-------KGGFTVMIVGGPNERTGYHI
A8NN75_COPC7      ---MPLPPPLNFTKWLAENQHKLQPPVNNFCLW-R-----SKDYTIMVVGGPNERNDFHI
F4P3F1_BATDJ      -------MPFNFEKWIKENSHLLKPPVNNYCLW-N-----SDDFIVMAVGGPNARNDYH-
D5GIV5_TUBMM      ---MALSLPLNIPKWLQENAHLLQPPINNYCVY-------DEHLTVMIVGGPNARNDYHI
Q0UU54_PHANO      ---------------------MLKPPINNYCVY-------NDNVTVMIVGGPNERTDYHI
A7EGK9_SCLS1      ----MLTAPLNLPKWLEENSHLLKPPINNYCVY-------NKDVTVMIVGGPNARTDYHI
3HAO_NEUCR        ----MLSSPVNLPKWLEENSHLLKPPINNYCVY-------NDDFTVMIVGGPNARTDYHI
C7YQ36_NECH7      ----MLSAPINLPKWLEENSHLLQPPINNYCVY-------NEEFSVMIVGGPNARTDYHI
3HAO_CANAL        ---MVLGQPINIIKWIEENGDLLKPPVNNFCLH-------RGGFTIMIVGGPNERSDYHI
3HAO_YARLI        ----MLQEPINLPKWLEENQHLLKPPVNNFCIQ-------RGGYTVMIVGGPNARTDYHI
3HAO_BACC1        --MSKTLQSFNLLKWIDENKELLKPPVNNKVIW-Q-----DSEFIAMILGGPNRRRDFHV
3HAO_BACAH        --MSKTLQSFNLLKWIDENKELLKPPVNNKVIW-Q-----DSEFIAMILGGPNRRRDFHV
Q1ITW2_KORVE      MPSIKTLKAFNLHGWIEQNKEKLKPPVGNAQVW-D-----DGEFMVTVVGGPNQRRDFHD
3HAO_SHEWM        ---MSKLAAFNFQQWIDEHQHLLKPPVGNVQIW-E-----NTDMMVTVVGGPNQRTDFHD
3HAO_OCHA4        ---MTKLSAFNFQKWIDEHKHLLKPPVGNQLVF-K-----DADLMVTVVGGPNKRTDYHD
3HAO_JANSC        ---MARLSAFNFKAWIDEHRHLLKPPVGNKMVY-E-----DADLMVTVVGGPNKRTDYHD
3HAO_RUEPO        ---MARLSAFNFQKWIDEHKHLLKPPVGNQQVW-E-----DADLMVTVVGGPNKRTDYHD
3HAO_CUPPJ        MFDLKYGRPLNFKRWLDDHADKLKPPVGNQQIW-Q-----DSDMMVTVVGGPNERSDFHD
3HAO_PSEFL        -MMFTFGKPLNFQRWLDDHSDLLRPPVGNQQVW-Q-----DSDFIVTVVGGPNFRTDFHD
3HAO_BURCJ        --MLSYGKPFNFQRWIDEHVHLLKPPVGNQQVW-Q-----DSDFIVTVVGGPNRRTDYHD
3HAO_PARPJ        --MLTYGKPFNFQRWIDDHAHLLKPPVGNQQVW-Q-----DSDFIVTVVGGPNHRTDYHD
3HAO_BURL3        --MLKYGTPFNFSRWIDEHAHLLKPPVGNQQVW-Q-----DSDFIVTVVGGPNHRTDYHD
A6H1R7_FLAPJ      ---MAIAKPFNLNKWIHENRHLLKPPVGNKNLYVN-----SGDFIVMIVAGPNNRKDYHY
3HAO_XANAC        ----MLTPPINLHAWIEEHRHLLKPPVGNKCIQ-------QDGFIIMVVGGPNARTDYHY
3HAO_XANCP        ----MLVPPINLHAWVEQHRHLLKPPVGNKCIQ-------QDGFIIMIVGGPNARTDYHY
3HAO_XANOM        ----MLIPPINLHAWIEEHRHLLKPPVGNKCIQ-------QDGFIIMIVGGPNARTDYHY
                                        : **:    :                :.*** * .:* 

3HAO_CUPMC        DPLEEFFYQLRGNAYLNLWV--DG-----RRERADLKEGDIFLLPP--------------
3HAO_CAEBR        EEGEEFFFQRKGDMVLKVIE--KG-----QVRDLVIKQGEMFMLPA--------------
3HAO_CAEEL        EEGEEFFFQRKGDMVLKVIE--KG-----QVRDLVIKQGEMFMLPA--------------
E9HND5_DAPPU      EEGEELFYMKKGSMELIVQE--QG-----AFKTVAIQEGQVFLLPG--------------
3HAO_DANRE        EEGEELFYQVRGDMVLKVIE--NG-----KHKDVHIREGEMFLLPA--------------
3HAO_XENTR        EEGEELFYQVQGDMCLKIVE--NG-----KHKDVHIKEGEMFLLPG--------------
G1PEL8_MYOLU      EEGEEVFYQLQGDMVLQVLE--RG-----KHRDVVIRQGEIFLLPA--------------
I3M6Q5_ICTTR      EEGEEVFYQLEGDMVLRVLE--RG-----KHRDVVIRQGEIFLLPA--------------
H0WRX4_OTOGA      EEGEEVFYQLEGDMVLRVLE--QG-----KHRDVVIRQGEIFLLPA--------------
3HAO_BOVIN        EEGEEVFYQLEGDMLLRVLE--RG-----KHRDVVIRQGEIFLLPA--------------
3HAO_HUMAN        EEGEEVFYQLEGDMVLRVLE--QG-----KHRDVVIRQGEIFLLPA--------------
G1S437_NOMLE      EEGEEVFYQLEGDMVLRVLE--QG-----KHRDVIIRQGEIFLLPA--------------
3HAO_MOUSE        EEGEEVFYQLEGDMILRVLE--QG-----QHRDVPIRQGEIFLLPA--------------
3HAO_RAT          EEGEEVFYQLEGDMVLRVLE--QG-----EHRDVVIRQGEIFLLPA--------------
3HAO_NEMVE        EEGEELFFQVKGDMCLKVLE--KG-----KPKDIIIKEGEMFLLPS--------------
B3RUS6_TRIAD      EEGEELFYMIRGDMCLNIIE--KG-----KFKSIPIKEGQIFLLPR--------------
D3B432_POLPP      NQTDEFFYQFKGDMILKIVDKSDG-----QFKDVRIREGECFLLPG--------------
3HAO_DICDI        NETDEFFYQFKGDMILKIVDK-DG-----SFRDINIREGETFILPG--------------
F1A3J7_DICPU      NQTDEFFYQFKGDMVLKVVD--NG-----EFKDIVIREGESFILPG--------------
I1CI75_RHIO9      NQTEEFFYQVKGNLLIKIVE--NG-----EFKDIHINEA---------------------
3HAO_CRYNJ        NTTEEWFYQYKGAMTLKVVD--EG-----KIKDIVIEEGDMFLLPA--------------
E3KBU9_PUCGT      NETEEWFYQIKGDMLLKVIS--QN-----QFQDIFIREGEMFLLPP--------------
3HAO_USTMA        QPTEEFFYQYKGDMLLKVIDE-DG-----KFQDIPIKQGEMFMLPA--------------
C0NG14_AJECG      NTTPEFFYQHRGPMLLKTVD--TS-TSPPTFHDTPIHEGSLFLLPA--------------
3HAO1_ASPFU       NTTPEFFYQYRGSMLLKTVD--TS-VSPPVFQDIPIHEGSIFLLPA--------------
C8VME6_EMENI      NSTPEFFYQYRGSMLLKTVD--TS-TNPPTFQDIPIHEGSLFLLPA--------------
3HAO_YEAST        NPTPEWFYQKKGSMLLKVVD--ET-DAEPKFIDIIINEGDSYLLPG--------------
A8NN75_COPC7      NETEEWFYQHTGGMLLRVVD--EG-----KFRDIRIEEGEMFLLPGTKPLTSFFRLGTHI
F4P3F1_BATDJ      ----EWFYQYKGDMLLKVVD--GG-----EFKDIPIKENEMFLLPG--------------
D5GIV5_TUBMM      NETPEWFYQYKGDMLLKVVED-SG-----KFRDVHIQEGDMFLLPP--------------
Q0UU54_PHANO      NETPEWFYQHKGSMLLKIVD--QSRPAAEQFRDIHIHEGDMFLLPP--------------
A7EGK9_SCLS1      NETAEWFYQYKGAMMLKVVD--EG-----EFKDIIIGEGEMFLLPP--------------
3HAO_NEUCR        NQTPEWFYQYKGAMMLKVVD--DG-----NFRDIIIREGEMFLLPG--------------
C7YQ36_NECH7      NLTPEWFYQYKGAMMLKVVD--EG-----KFRDIIIREGDMFLLPG--------------
3HAO_CANAL        NQTPEYFYQFKGTMCLKVVD--DG-----EFKDIFINEGDSFLLPP--------------
3HAO_YARLI        NQTPEWFHQKKGHMTLKVVD--DG-----EFRDITINEGDIFLLPA--------------
3HAO_BACC1        DPSDEFFYQIKGECYVECITE-EG-----KREVVTVKEGDVFMLPA--------------
3HAO_BACAH        DPSDEFFYQIKGECYVECITE-EG-----KREVVTVKEGDVFMLPA--------------
Q1ITW2_KORVE      DPTEEFFYQLQGDIKLRVIEEVGK-----PPVEIPIREGEVFLLPK--------------
3HAO_SHEWM        DPVEEFFYQLKGDMVLKIIE--EG-----KCHDLFIREGDIFFLPP--------------
3HAO_OCHA4        DPVEEFFYQLKGDMLLKLHDTSTG-----EFYDVPIREGDIFLLPA--------------
3HAO_JANSC        DPVEEFFYQLEGDMVLKLYD--GE-----EFYDVPIREGEIFLLPP--------------
3HAO_RUEPO        DPVEEFFYQLKGDMVLKLYE--GG-----EFYDVPIREGDIFLLPP--------------
3HAO_CUPPJ        DPIEELFYQFKGNAYLLLWE--DG-----RYERVDLREGDMLLLPP--------------
3HAO_PSEFL        DPMEEFFYQFKGNAYLNIMD--RG-----QMDRVELKEGDIFLLPP--------------
3HAO_BURCJ        DPLEEFFYQLRGNAYLNLWI--DG-----KRERVELKEGDVFLLPP--------------
3HAO_PARPJ        DPLEEFFYQLRGNAYLHLWI--DG-----KRERVDLKEGDVFLLPP--------------
3HAO_BURL3        DPFEEFFYQLRGNAYLHLWI--DG-----KRERVDLKEGDMFLLPP--------------
A6H1R7_FLAPJ      NETEELFYQLEGDITIYIQE--DG-----EKKAMQLSAGDMYLHPA--------------
3HAO_XANAC        DEGPEWFFQLEGEMVLKVQD--EG-----VARDIPIRAGEVFLLPP--------------
3HAO_XANCP        DEGPEWFFQLEGEMVLKVQD--DG-----TARDIPIRAGEIFLLPP--------------
3HAO_XANOM        DEGPEWFFQLEGEMVLKVQD--DG-----VARDIPIRAGEIFLLPP--------------
                      * *.   *   :                   :                        

3HAO_CUPMC        ---HVRHSPQRPEAGSACLVIERQRPA-GMLDGFEWYC--DAC--GH---LVHRVEVQLK
3HAO_CAEBR        ---RVEHSPQR-FANSIGLVVERERKN-TEFDCVRFLV--GSS--NV---TLFERWFFLT
3HAO_CAEEL        ---RVEHSPQR-FSNSIGLVVERERKN-TEFDCVRFLV--GSS--NI---TLFERWFYLT
E9HND5_DAPPU      ---KIPHSPQR-KDDTIGLVVERERAK-QELDCLRYFV--NDS--TE---SLFERWFYCD
3HAO_DANRE        ---RIPHSPQR-QANTVGLVIERRRLS-KETDGLRYFV--ANS--TE---VLFERWFYCE
3HAO_XENTR        ---RIPHSPQR-YADTVGLVFERRRLD-TEKDGLRYYV--EGT--TE---VLFEKWFYCE
G1PEL8_MYOLU      ---GIPHSPQR-FANTVGLVIERRRLK-TELDGLRYYV--GNT--TD---VLFEKWFYCE
I3M6Q5_ICTTR      ---GVPHSPQR-FANTMGLVIERRRLE-TELDGLRYYV--GDT--VD---VLFEKWFYCK
H0WRX4_OTOGA      ---RVPHSPQR-FANTMGLVIERERLK-TELDGLRYYV--GDT--VD---VLFEKWFSCK
3HAO_BOVIN        ---GVPHSPQR-FANTVGLVIERRRLK-TELDGLRYYV--GDT--TD---VLFEKWFYCE
3HAO_HUMAN        ---RVPHSPQR-FANTVGLVVERRRLE-TELDGLRYYV--GDT--MD---VLFEKWFYCK
G1S437_NOMLE      ---RVPHSPQR-FANTVGLVVERRRLE-TELDGLRYYV--GDT--MD---VLFEKWFYCK
3HAO_MOUSE        ---RVPHSPQR-FANTMGLVIERRRLE-SELDGLRYYV--GDT--ED---VLFEKWFHCK
3HAO_RAT          ---RVPHSPQR-FANTMGLVIERRRME-TELDGLRYYV--GDT--ED---VLFEKWFHCK
3HAO_NEMVE        ---RFNHSPQR-FENTVGLVIERERLP-EEIDGLRYFC--EDG--VT---VLWEKFFHCT
B3RUS6_TRIAD      ---KIPHSPQR-LESTVGLVIERERRM-HEMDCLRYYCEDGNS--HNN--ILYERWFHCE
D3B432_POLPP      ---NTPHSPQR-FKDTVGLVIEQKRNA-QSIDRLCWFC--QGC--KE---KLFEESFNVK
3HAO_DICDI        ---NTPHSPQR-YRDTIGLVIEKKRSS-ENIDKLLWFCDNKDC--RK---LLFSRSFHVD
F1A3J7_DICPU      ---NTPHSPQR-YKDTIGLVLEKKRTP-ESIDQLLWYC--DNC--KK---LLFQKSFNVD
I1CI75_RHIO9      ---NVPHNPVR-FENTIGIVIERVRLS-HHIDSLRWYCENTNC--RK---IIYEESFYCV
3HAO_CRYNJ        ---NTPHSPRR-VADTIGVVMEMVRPG-EFLDTMRWYCPSPTHANAEKLVTIREVTFYCS
E3KBU9_PUCGT      ---NTPHNPCR-FADTIGLVMERKRPK-DSIDRLRWFCPNTEA--HAEPHLVREVAFHCT
3HAO_USTMA        ---HTPHSPVR-FANTVGIVVERTRPD-GSPDAMRWYCPNKEA-HGETPTLVKEVHFQCT
C0NG14_AJECG      ---NTPHSPVR-FADTVGIVVEMPRAD-GAEDTLRWYC--GGC--KG---VVWETSFVCT
3HAO1_ASPFU       ---NTPHCPVR-FKDTVGVVMEQPRPK-DAVDTMLWFC--KKC--GE---VVWEKRFVCT
C8VME6_EMENI      ---NTPHCPVR-FKDTVGVVMEQPRPG-NAEDAMRWYCRKEGC--GE---VVWEKRFVCT
3HAO_YEAST        ---NVPHSPVR-FADTVGIVVEQDRPG-GENDKIRWYC--SHC--RQ---VVHESELQML
A8NN75_COPC7      LLANTPHNPVR-FANTVGIVVERIRPE-GSLDRLRWYCP-SDT--HEELTVIYEESFHCT
F4P3F1_BATDJ      ---NVPHNPVR-FENTVGVVLERKRPA-GSLDHLRWYC--EQC--TE---IVYQESFHCT
D5GIV5_TUBMM      ---NIPHNPVR-FADTVGIVIEQKRPP-QSLDRLRWYC--PDC--ES---VVYEAAFHCT
Q0UU54_PHANO      ---NTPHNPVR-YKDTVGVVLEQKRPE-GSQDRLRWYC--QSC--GE---KVHEASFHCT
A7EGK9_SCLS1      ---NTPHNPVR-FANTVGIVLEQPRPK-DSLDRLRWYC--TNC--RE---VVEEAAFHCT
3HAO_NEUCR        ---NTPHNPVR-FADTVGIVLEQKRPA-DTIDRMRWYC--QNC--KE---IVHEASFHCT
C7YQ36_NECH7      ---NTPHNPVR-FANTVGVVLEQRRPK-DSLDRMRWYC--AEC--GE---VVHEAAFHCT
3HAO_CANAL        ---NVPHNPCR-YENTIGIVVEQDRPA-GVNDKVRWYC--QKC--QT---VIHEVEFYLT
3HAO_YARLI        ---NVPHNPVR-YADTIGVVVEQDRPE-GMKDALRWYCPNEKC--RE---IVFENSFQLV
3HAO_BACC1        ---MVPHSPHR-VANTYGLVIERKRNQ-GELEDFVWFC--DEC--NH---EMHRVRVQLS
3HAO_BACAH        ---MVPHSPHR-VANTYGLVIERKRSQ-GELEDFVWFC--DEC--NH---EMHRVRVQLS
Q1ITW2_KORVE      ---HMRHSPQR-GPNTIGMVVEMPRPE-GTVDAFEWYC--PNC--HQ---LVHRAEVKLK
3HAO_SHEWM        ---HVRHSPQRPMPGSIGLVIEPKRPE-GAKDAFEWYC--FKC--DG---LVHRVEVLLK
3HAO_OCHA4        ---HIRHSPQRPQEGSIGLVIEPARPE-GVLDAVEWYC--FEC--SG---LVHRAEVDLE
3HAO_JANSC        ---HMRHSPQRPQEGSVGLVIEAKRPE-GAADAIEWYC--FNC--GN---LVHRAELMLT
3HAO_RUEPO        ---HVRHSPQRPQEGSIGLVIEPKRPE-GAHDAIEWFC--FGC--GS---LVHRAELLLE
3HAO_CUPPJ        ---HTLHSPQRPEADSRCLVVERKRPQ-GQNDAFQWSC--ASC--GT---IVQRHEVTLQ
3HAO_PSEFL        ---HLRHSPQRPEAGSRCLVIERQRPK-GMLDGFEWYC--LSC--NG---LVYRVDVQLN
3HAO_BURCJ        ---HVRHSPQRPESGSACLVIERQRPE-GTVDGFEWYC--DAC--GE---RVHRVELQLK
3HAO_PARPJ        ---HVRHSPQRPEAGSVCLVIERQRPA-GVVDGFEWYC--DAC--GH---LVYRVEVQLK
3HAO_BURL3        ---HVRHSPQRPEAGSACLVIERQRPA-GVVDGFEWYC--DAC--GH---LVHRVEVQLK
A6H1R7_FLAPJ      ---KVPHSPVR-SANSIGLVVERKRNNIDAKDGLLWFC--DNC--NY---KLHEVYFELN
3HAO_XANAC        ---KVPHSPQR-ADGSIGLVIERERLP-TEQDGLQWYC--PQC--NH---KLYEAMFPLK
3HAO_XANCP        ---KVPHSPQR-AAGSIGLVIERERLP-HEQDGLQWYC--PQC--NH---KLYEAMFPLE
3HAO_XANOM        ---RVPHSPQR-AAGSIGIVIERVRLP-HEQDGLQWYC--PQC--NH---KLYEAMFPLK
                        * * *   .:  :*.*  *      : . :               :    .   

3HAO_CUPMC        --SIVTDLPPLFESFY-ASEDKRRCPH---------------------------------
3HAO_CAEBR        --DVVKDLPPLIKEFY-NSNEFKTGKPGKGTFACNAPYEARWTD-LPVPINRKEFIYDHI
3HAO_CAEEL        --DVVKDLPPLIKEFY-GSNEFKTGKPGKGTFACNAPYEARWTD-LPVPINRKEFIYDHI
E9HND5_DAPPU      --DLGVQLVPVIKEFF-ASEQCKTGRPVPGTIPENPHFHPDGQLQLENPFNLKEWLQSHR
3HAO_DANRE        --NLGTQLVPIIKEFM-DSKENETGKPDPANPIKPAPYPLNTMN-VMTPFSFREWVEKQK
3HAO_XENTR        --DLGTQLAPIMKEFF-SSEQYKSGKPDPAQPIGKMPFFLNTEQ-VMEPFSFQNWLNKHR
G1PEL8_MYOLU      --DLGTQLAPIIQEFF-SSEQHRTGKPIPDQLLMDTPFPLSTRS-VMEPMSLEAWLAGHR
I3M6Q5_ICTTR      --DLGTQLAPIIQEFF-RSEQCRTGKPIPDQLLKEPPFPLSTRS-VMEPVSLKAWLDGHR
H0WRX4_OTOGA      --DLGTQLIPIIQEFF-NSEQYRTGKPIPDQLPKEPPFPLNSRS-IMEPMSLEAWLDGHR
3HAO_BOVIN        --DLGTQLAPIIQEFF-SSEQYRTGKPNPDQLLKEPPFPLSTRS-VMEPMCLEAWLDGHR
3HAO_HUMAN        --DLGTQLAPIIQEFF-SSEQYRTGKPIPDQLLKEPPFPLSTRS-IMEPMSLDAWLDSHH
G1S437_NOMLE      --DLGTQLAPIIQEFF-SSEQYRTGKPIPDQLLKEPPFPLSTRS-IMEPMSLEAWLDSHS
3HAO_MOUSE        --DLGTQLAPIIQEFF-HSEQYRTGKPNPDQLLKELPFPLNTRS-IMKPMSLKAWLDGHS
3HAO_RAT          --DLGTQLAPIIQEFF-HSEQYRTGKPNPDQLLKEPPFPLSTRS-VMEPMSLKAWLESHS
3HAO_NEMVE        --DL-TQIAPVIKEFF-ESEEHKTGKP---SKESSCSINVDTETELMEPFPLKQWLKDNK
B3RUS6_TRIAD      --DLGCQLAPIIKEYF-ASEEYKTGKPGKNSIIQDPVFHPDEETTVKEPFSLKEWIDNNR
D3B432_POLPP      GLDLGKELKPIILRFY-EEEPLRTCKK---------------------------------
3HAO_DICDI        DLDLGKQLTPIINEFY-GNEENRTCKH---------------------------------
F1A3J7_DICPU      DLDLGKQLTPIIQEFY-SNEKLRTCTS---------------------------------
I1CI75_RHIO9      --DLGTQLKPIIEKFA-ASKELRTYFS---------------------------------
3HAO_CRYNJ        --DLDTQLKPVIERWM-SDEEWRRCPE---------------------------------
E3KBU9_PUCGT      --DLGTQLKPFITEWM-ENEDLRKCSN---------------------------------
3HAO_USTMA        --DLGTQLKPIIDAWV-NDEAGRQCSH---------------------------------
C0NG14_AJECG      --DLGTQVKEVVERFA-ADEGKRRCGS---------------------------------
3HAO1_ASPFU       --DLGTQVKEVVEEFA-ADQEKRTCKA---------------------------------
C8VME6_EMENI      --DLGTQVKEVVEEFA-GDEGKRTCKA---------------------------------
3HAO_YEAST        --DLGTQVKEAILDFE-NDVEKRTCFH---------------------------------
A8NN75_COPC7      --DLGTQLKPLIQRWQ-SDPTIRTCKV---------------------------------
F4P3F1_BATDJ      --NLGTQLKPVIQRYF-ASEDLRTCKK---------------------------------
D5GIV5_TUBMM      --DLGVQIKEAVNRFK-ECEELRKCAK---------------------------------
Q0UU54_PHANO      --DLGTQIKEAVNGFK-ADMEARKCKN---------------------------------
A7EGK9_SCLS1      --DLGTQIKEAVNSFK-DSEERRKCKK---------------------------------
3HAO_NEUCR        --DLGTQIKAAVEAFK-GNEQLRTCKK---------------------------------
C7YQ36_NECH7      --DLGTQIKAAVQDFK-GDNDKRTCGK---------------------------------
3HAO_CANAL        --DLGTQIKEAIVKFD-ADLDARTCKN---------------------------------
3HAO_YARLI        --DLGTQIKEAILDFD-GDIEKRTCKA---------------------------------
3HAO_BACC1        --DIEKQVKEAIHSFN-SNKEIRACKN---------------------------------
3HAO_BACAH        --DIEKQVKEAIHSFN-SNKEIRACKN---------------------------------
Q1ITW2_KORVE      --SIVKDLPPLFEQFY-SNEELRRCKH---------------------------------
3HAO_SHEWM        --SIVRDLPPIYQAFY-QDEQARTCPQ---------------------------------
3HAO_OCHA4        --SIVDDLPPLYAAFY-NDEKLRTCPH---------------------------------
3HAO_JANSC        --SIVDDLPPVYQAFY-ASEEARTCGS---------------------------------
3HAO_RUEPO        --SIVRDLPPVYQAFY-ADEQARTCPN---------------------------------
3HAO_CUPPJ        --SIVADLPPLYEKFYASSEDARRCPG---------------------------------
3HAO_PSEFL        --SIVTDLPPLFDIFY-GNVGLRKCPQ---------------------------------
3HAO_BURCJ        --SIVNDLPPLFDAFY-ESEEKRRCPR---------------------------------
3HAO_PARPJ        --SIVSDLPPLFNAFY-ASEEKRRCGH---------------------------------
3HAO_BURL3        --SIVDDLPPLFDAFY-ASDTLRRCAH---------------------------------
A6H1R7_FLAPJ      --DIENDFNKHFKHFY-GTENLRTCKK---------------------------------
3HAO_XANAC        --NIETDFPPVFDRFY-RSPALRTCSQ---------------------------------
3HAO_XANCP        --NIETDFPPVFDHFY-RSLALRTCTQ---------------------------------
3HAO_XANOM        --NIETDFPPVFDHFY-RSLALRTCSQ---------------------------------
                    .:  :.      :                                             

3HAO_CUPMC        -------------------------CGQVHPGRAA-------------------------
3HAO_CAEBR        SEVKNG-PVKIYGAPEYKTEVMLLGEGSYDLEAGAVELIIWLQENTFAVVEESGFTYALK
3HAO_CAEEL        SEVKNG-PVRIYGAPEYKTEVMLLGEGSYDLESGTVELLIWLQENTFAVVEESGFTYAMK
E9HND5_DAPPU      TEIHQNGKKNLFDGAKYKSDVIIYGKGVDEFKPIQHEIWLWQLEGESVVKLNGQDITLKS
3HAO_DANRE        PVLASGCPVDMF-GEQFETETLLFGSGTSANKRRT-DGWIWQLEGLSNVFMNGKEYSLTA
3HAO_XENTR        LEINQKKRVSLF-GHNQETKAVVYGSGESKDSKAQTDTWIWQLEGTSCVTLGNEVLKLGS
G1PEL8_MYOLU      RELQGGASINLF-GDTYETQVIVHGQGSSKGWKQNVDMWLWQLEGSSVVTMGGQHLSLTP
I3M6Q5_ICTTR      RELQAGTSINLF-GDSYETQVIVHGQGRSRGLEQDVDLWLWQLEGSSVVTLGEEHLGLAP
H0WRX4_OTOGA      RELQTGTTLSLF-GDTYETQVLAHGQGSSTGLRQDVDVWLWQLEGSSVVIMEGQHLSLTP
3HAO_BOVIN        KELQAGTPLSLF-GDTYESQVMVHGQGSSEGLRRDVDVWLWQLEGSSVVTMEGQRLSLTL
3HAO_HUMAN        RELQAGTPLSLF-GDTYETQVIAYGQGSSEGLRQNVDVWLWQLEGSSVVTMGGRRLSLAP
G1S437_NOMLE      RELQAGTPLSLF-GDTYETQVVAYGQGSSEGLRQNVDVWLWQLEGSSVVTMGGRSLSLAP
3HAO_MOUSE        RELQAGTSLSLF-GDSYETQVIAHGQGSSKGPRQDVDVWLWQQEGSSKVTMGGQCIALAP
3HAO_RAT          RELQAGTSLSLF-GDSYETQVIAHGQGSSKGPRQDVDVWLWQLEGSSKVTMGGQCVALAP
3HAO_NEMVE        DSYRSGSMAIFEKG---EFKVHAHGSGEQEGHSQG-EMWFWQLEGKATVNVDEITRELNK
B3RUS6_TRIAD      NTVNKQNELMLFSETECQLRIATN-CTVKCGSSSE-EIWIWIYEGN--------------
D3B432_POLPP      -------------------------CGCISEKPVIKDNIE--------------------
3HAO_DICDI        -------------------------CNHISQKPTVNDYIQ--------------------
F1A3J7_DICPU      -------------------------CNHISQKPKVNDHMI--------------------
I1CI75_RHIO9      -------------------------YTICIVQFPDHVA----------------------
3HAO_CRYNJ        -------------------------CGEVAPPK---------------------------
E3KBU9_PUCGT      -------------------------CGTTAPPS---------------------------
3HAO_USTMA        -------------------------CGYTQGARELPA-----------------------
C0NG14_AJECG      -------------------------CGMVAGVRYAEGEVVQPGRFPE-------------
3HAO1_ASPFU       -------------------------CGTIAETRYQEGEVVQPPRFLE-------------
C8VME6_EMENI      -------------------------CGTIAESRFKEGEVVQPPKIPE-------------
3HAO_YEAST        -------------------------CKTLNYARPQSN-----------------------
A8NN75_COPC7      -------------------------CGTVADPK---------------------------
F4P3F1_BATDJ      -------------------------CGHVNPTK---------------------------
D5GIV5_TUBMM      -------------------------CGGMATAAPAAVRGT--------------------
Q0UU54_PHANO      -------------------------CGTICDTAPAKA-----------------------
A7EGK9_SCLS1      -------------------------CGTVAESAPPPGSIQDPNLS---------------
3HAO_NEUCR        -------------------------CGVLADWSPKPGSIQDPNVQ---------------
C7YQ36_NECH7      -------------------------CGTLADWAPKPGSIKDPNLE---------------
3HAO_CANAL        -------------------------CGTVNSSRRD-------------------------
3HAO_YARLI        -------------------------CGTVATSRP--------------------------
3HAO_BACC1        -------------------------CGHIMP--EEVEEWKCE------------------
3HAO_BACAH        -------------------------CGHIMP--EEVGEWKCE------------------
Q1ITW2_KORVE      -------------------------CGTVHPGKQ--------------------------
3HAO_SHEWM        -------------------------CGELHPGKEPPQGWVTLLENKEQDKS---------
3HAO_OCHA4        -------------------------CNTVHPGKNPPEGWVAL------------------
3HAO_JANSC        -------------------------CGEVHPGKEPPEGWVTL------------------
3HAO_RUEPO        -------------------------CGEIHPGKEPPEGWVKL------------------
3HAO_CUPPJ        -------------------------CGEIHPGR-DFQAWHRTLARHSS------------
3HAO_PSEFL        -------------------------CGQVHPGKAAIEAVARGDQP---------------
3HAO_BURCJ        -------------------------CGVVHPGKQGRTD----------------------
3HAO_PARPJ        -------------------------CGHVHPGKAV-------------------------
3HAO_BURL3        -------------------------CGHMHPGKAT-------------------------
A6H1R7_FLAPJ      -------------------------CGTVMQRL---------------------------
3HAO_XANAC        -------------------------CGHLHPAPERYATVEG-------------------
3HAO_XANCP        -------------------------CGHVHPAPERYAAVEA-------------------
3HAO_XANOM        -------------------------CGHLHPAPERYAAVED-------------------
                                                                              

3HAO_CUPMC        ------------------------------------
3HAO_CAEBR        SETMVRIKPNTKCLLNVKGGFAITIRMPG-------
3HAO_CAEEL        SETMVRIKPNTKCLLNVKGGFAITIRMPA-------
E9HND5_DAPPU      DDSLLIPAGEEHQLMRDADSCFLMSVAMPTPNENI-
3HAO_DANRE        GDCLLIFGETEYKWQRSQDCVALYVAQDPDRKRPY-
3HAO_XENTR        GDSLLIPEKSLYSWIREDCSIALSTSQVPA------
G1PEL8_MYOLU      DESLLVPARTEYSWERGQGSVALAVTQDPARKKPLG
I3M6Q5_ICTTR      DDSLLVPAGTSYVWERSQSSVALSVTQDPSRKKCLG
H0WRX4_OTOGA      DDSLLVPARTSYAWERAPGSVALSVTQDPACKRPLE
3HAO_BOVIN        DDSLLVPAGTLYGWERGQGSVALSVTQDPACKKSLG
3HAO_HUMAN        DDSLLVLAGTSYAWERTQGSVALSVTQDPACKKPLG
G1S437_NOMLE      DDSLLVLAGTSYAWERMQGSVALSVTQDPACKKPLG
3HAO_MOUSE        DDSLLVPAGTSYVWERAQGSVALSVTQDPARKKPWW
3HAO_RAT          DDSLLVPAGFSYMWERAQGSVALSVTQDPACKKPLG
3HAO_NEMVE        NDVLMITAGSDFRVKREEGSVGLSITVDSLANK---
B3RUS6_TRIAD      ------------------------------------
D3B432_POLPP      ------------------------------------
3HAO_DICDI        ------------------------------------
F1A3J7_DICPU      ------------------------------------
I1CI75_RHIO9      ------------------------------------
3HAO_CRYNJ        ------------------------------------
E3KBU9_PUCGT      ------------------------------------
3HAO_USTMA        ------------------------------------
C0NG14_AJECG      ------------------------------------
3HAO1_ASPFU       ------------------------------------
C8VME6_EMENI      ------------------------------------
3HAO_YEAST        ------------------------------------
A8NN75_COPC7      ------------------------------------
F4P3F1_BATDJ      ------------------------------------
D5GIV5_TUBMM      ------------------------------------
Q0UU54_PHANO      ------------------------------------
A7EGK9_SCLS1      ------------------------------------
3HAO_NEUCR        ------------------------------------
C7YQ36_NECH7      ------------------------------------
3HAO_CANAL        ------------------------------------
3HAO_YARLI        ------------------------------------
3HAO_BACC1        ------------------------------------
3HAO_BACAH        ------------------------------------
Q1ITW2_KORVE      ------------------------------------
3HAO_SHEWM        ------------------------------------
3HAO_OCHA4        ------------------------------------
3HAO_JANSC        ------------------------------------
3HAO_RUEPO        ------------------------------------
3HAO_CUPPJ        ------------------------------------
3HAO_PSEFL        ------------------------------------
3HAO_BURCJ        ------------------------------------
3HAO_PARPJ        ------------------------------------
3HAO_BURL3        ------------------------------------
A6H1R7_FLAPJ      ------------------------------------
3HAO_XANAC        ------------------------------------
3HAO_XANCP        ------------------------------------
3HAO_XANOM        ------------------------------------