CLUSTAL format seed alignment for MF_00827

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

YJHX2_SALTI      --------------MNLSRQEQRTLHVLAKGGRITHIRDASGRVTAVECYSREGLLLADC
YJHX_SALTY       --------------MNLSRQEQRTLHVLAKGGRITHIRDASGRVTAVECYSREGLLLADC
YJHX_SALPA       --------------MNLSRQEQRTLHVLAKGGRITHIRDASGRVTAVECYSREGLLLADC
YJHX_SALPB       --------------MNLSRQEQRTLHVLAKGGRITHIRDASGRVTAVECYSREGLLLADC
YJHX_SALCH       --------------MNLSRQEQRTLHVLAKGGRITHIRDASGRVTAVECYSREGLLLADC
YJHX1_SALTI      --------------MNLSRQEQRTLHVLAKGGRIVHVRDASGRVTSVECYSREGLLLADC
YJHX_ECOLI       --------------MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDC
YJHX_ECODH       --------------MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDC
Y251_KLEP7       --------------MNLSRQEQRTLHVLAKGGRIAHVRDTSGRITAVECYTREGLLLSDC
Y712_PSEAE       --------------MNVSKPEQRTLHALAQGGHIAFLRDASGKITRVECYNRDGHLLLDC
Y4799_PSEA7      --------------MNVSKPEQRTLHALAQGGHIAFFRDASGKVTQVECYNRDGHLLLDC
Y3746_HAHCH      --------------MNISKPEQRTLHVLAKGGRIIFTRNSSGKVTFVECYTREGYVLADC
Y1532_SERP5      --------------MNISKAEQRVLHVLAKGGYIAFTRDDAGRVTHVQCLTREGLGLADC
Y1628_BEII9      --------------MNISRSEQRVLHVLAQGGYVRHQRADNGRILDVLCFTRDGHVLADC
Y1614_OCHA4      --------------MNISRMEQRVLHVLAQGGYIRHQRED-GHICEIECFTREGYLLSDC
Y419_RUEST       --------------MNISKNEQRVLHVLAQGGRILYERAPNGRVTEVTCYTREGLILANC
Y2144_RHORT      --------------MTISRTEQRVLHVLALGGRILHERGEGPKITTITCVTRDGLILADC
Y1729_MYXXD      --------------MNVSRKELRVLNVLAQGGRILKHKDENGRLTHVACVTPEGWQLSLC
Y869_ALIF1       --------------MNISKQEQRVLHTLAMGGEIRRYLNEDGKLTEITCFTREGYGLSNC
Y226_CAUVC       --------------MNISKPQQRTLHALAQGGRIELERDDNGRIISADCLTRDGWALTDC
Y4643_CAUSK      --------------MNISKPQQRTLHALAQGARIELLRDDHGRIVAAYCITGEGWRLSDC
Y1374_PARL1      --------------MNISKFEQRTLHALARGGLIRVEKDDKGKIHTATCVTREGWLLADC
Y1859_RHIEC      --------------MDISRTEQRILHLMAQGGRIEIIRDDNRKIENVSCFTRDGWLYPGV
Y1945_RHIE6      --------------MDISRTEQRILHLMAQGGRIEISRDDDRKIENVSCFTRDGWLYPGV
Y2079_RHIL3      --------------MDISRTEQRILHLMAQGGRIEITRDDDRKIEAVSCFTRDGWLYPGV
Y1313_RHIME      --------------MDISRAEQRILHHLAQGGRIEITRE-GKAIAEIRCFTRDGWVYPGV
Y945_SINMW       --------------MDISRAEQRILHHLAQGGRIEITRE-GKTITEIRCFTRDGWVYPGV
Y189_RHILO       MPHYNCHSVLCASKRTRGAVGQRILHMLAQGGRIEIEKNQKKRIASVKCLTRDGWHHPGV
Y1321_AGRFC      --------------MDISRAEQRILHLLAQGGRIELVRDDTRKIEKITLYTRDGWIFGGL
Y1721_CHESB      --------------MDISRAEQRILHILAQGGCIQVEKDEDGRIAEISCVTRDGWHLPGL
Y3437_HYPNA      --------------MDISRAEQRILHLLAQGGRIDLVRDEAGKLTDAHCYSRDGWRYTGL
                                  .    : *: :* *  :         :      . :*      

YJHX2_SALTI      TLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRAQPDNR------
YJHX_SALTY       TLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRAQPDNR------
YJHX_SALPA       TLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRAQPDNR------
YJHX_SALPB       TLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRAQPDNR------
YJHX_SALCH       TLAVFKKLKTKKLIKSVNGQPYRINTTGLNSVRAQPDNR------
YJHX1_SALTI      TLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRSQPDNR------
YJHX_ECOLI       TLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRAQLDNR------
YJHX_ECODH       TLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRAQLDNR------
Y251_KLEP7       TLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRAQADNR------
Y712_PSEAE       TLAVFSRLKNKGLVHSRQGRPYRISMAGLKAVRPQADNR------
Y4799_PSEA7      TLAVFARLKSKRLIHSSQGRPYRISMAGLKAVRPQADNR------
Y3746_HAHCH      TLPVFTKLKNKRLIHSKSGKPYQINMAGLKAVRPQLDNQ------
Y1532_SERP5      SLAVFTKLKTKRLILSRQGRPYRVTIDGLKAVRAQLDNR------
Y1628_BEII9      TLEVFVKLRRKRLIESKASSPYRISDKGRRSVRAQLDNR------
Y1614_OCHA4      TMAVFQQLRRKRLIESRMGSPYRISFKGRENVRAQLNNR------
Y419_RUEST       KLDVFNKLRRKRLVESKSSRPYQISEKGRRSVRAQLDNR------
Y2144_RHORT      DLAVFSRLRRRRLIESRAGGPYRLSPLGRAMVRPQSDNQGHITC-
Y1729_MYXXD      TLEVFQQLKRRKLISSVKGGPYLITRLGLQALCGSSKTR------
Y869_ALIF1       TMDTFKKLKNKKLISSKGGRPYRITPLGATSAQAQMNQR------
Y226_CAUVC       TVAVFQSLKRKRLIASQDGGPYRITRLGLANLRAQLDNRVGAKAW
Y4643_CAUSK      SLAVFKALKKRRFIASSGGGPYRITRDGAVNLRAQVDNRVTARGG
Y1374_PARL1      TVATFRRLRKRRLIASKDGSPYRITREGLHAVRAQLDNR------
Y1859_RHIEC      DLDLFRRLKRLKAIKSSGGQPYRITERGLRLVRSQLDNR------
Y1945_RHIE6      DLDLFRRLKRLKAIKSSGGQPYRITERGLTLVRSQLDNR------
Y2079_RHIL3      DLDLFRRLKRLRAIKSSGGQPYRITERGLRLVRSQLNNR------
Y1313_RHIME      DLELFRKLKRKRAIKSSAGKPYRITERGLHLVRSELNNR------
Y945_SINMW       DLELFRKLKRKRAIRSSAGKPYRITERG---VRSELNNR------
Y189_RHILO       DLDLFRKLKRKKAVSSSGGGPYRITRRGLELVRSELDNR------
Y1321_AGRFC      DLLTFRKLKQKRAIASSGGKPYRITTRGLELVRGELDNR------
Y1721_CHESB      DLALFRKVKRKGAIASTNGGPYRITRRGLQLVRSQTDNR------
Y3437_HYPNA      DMALFRKLKRRRTIASERGQPYRITRRGLQLVRSQPDNC------
                  :  *  ::    : *  . ** :.         . .