CLUSTAL format seed alignment for MF_00828

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PSAM_GLOVI      MAATVVSGAQVAIAFVVALIAGIAALLLSTALGK-
PSAM_PINTH      -----MVELKFLIAFFLAFTAGILAIKLGQALYDC
PSAM_THEEB      ---MALTDTQVYVALVIALLPAVLAFRLSTELYK-
PSAM_SYNEL      ---MALTDTQVYVALVIALLPAVLAFRLSTELYK-
PSAM_SYNY3      ---MALSDTQILAALVVALLPAFLAFRLSTELYK-
PSAM_NOSS1      --MSSISDTQVYIALVVALIPGLLAWRLATELYK-
PSAM_EUGGA      ---MAIDNTQIFIALLTALIPAFFALKLGKELSK-
PSAM_EUGSA      ---MAIDNTQIFIALLTALIPAFFALKLGKELSK-
PSAM_EUGMU      ---MGITSTQIYIALLTALIPAFFALKLGRELNK-
PSAM_EUGVI      ---MTITSTQVYIALLTALIPAFFALKLGKELSK-
PSAM_EUGMY      ---MEISTTQISIILLIALIPAFFSLKLGKELYK-
PSAM_EUGGR      ---MEITTNQVYIALLASLIPAFFAFKLGKSLNQ-
PSAM_PHAAC      ---MELTTTQIFVELILSLIPATLAFNLGKELTK-
PSAM_LEPBU      ---MEITTTQVLGILLIALIPGILAYRLANELAK-
PSAM_EUGDE      ---MGISEVQVFLALIIALIPGILADRLGKELNK-
PSAM_ANTAG      --MTSISDGQIVVALISAFIIVILASRLGKELYQ-
PSAM_MARPO      --MTSISDSQIIVILLSVFITSILALRLGKELYQ-
PSAM_STAPU      --MTLISDSQIVVALVSAFVTGILALRLGRELYR-
PSAM_ZYGCR      --MTIISDSQIVVALISALVTGILALRLGRELYR-
PSAM_CHAGL      --MTAISDSQVYVALVSALITSFLAVRLGLALYD-
PSAM_MESVI      ----MISDIQIMVALFAALFTGILALRLGTELYK-
PSAM_CHLVU      ---MPIADSQVFIALFLALATGIFAVRLGVALYK-
PSAM_OSTTA      ---MPLSDTQVFTALFVALITGILSLRLGTQLYK-
PSAM_CYAPA      ----MLADGQIFTALAVALVPGILALRLALELYKF
PSAM_SYNJB      -----MTDAQVFTILAIALVPAVMALLLGSALARS
PSAM_SYNJA      -----MTDAQVFTILAIALVPAVMAALLGSALARS
PSAM_SYNP6      -----MTDTQVFVALLLALVPAVLAYRLGTELYR-
PSAM_CYACA      ----MITDSQVFIGLVIALVPAILAFKLGLSLYE-
PSAM_PORPU      ----MIDDSQIFVALLFALVSAVLAIRLGKELYQ-
PSAM_PYRYE      ----MIDDSQIFVALLFALVSAVLAIRLGKELYQ-
PSAM_GRATL      ----MISDSQIFVALLFALVSAVLAIRLGTDLYQ-
PSAM_GUITH      ----MISDTQIFVALILALFSFVLAIRLGTSLY--
PSAM_TRICV      ----MIYDSQVYTVLLIALLASVLAIRLGSTLYQ-
PSAM_PHATC      ----MIYDSQIYTVLCIALLAGILAIRLGSTLYE-
PSAM_THAPS      ----MITDFQVYIALMAALLASVLAIRLGATLYQ-
PSAM_EMIHU      ----MITDSQIFFALCIALTAAVLAIGLGRQLYV-
PSAM_PROM5      -MEPSQSINLIILGLIVVMHAGVLALRLGISLARI
PSAM_PROMP      -MEPSQSINLIILGLIVVMHAGVLALRLGISLART
PSAM_PROM9      -MEPTQTINLIALSLIVVVHAGVLALRLGISLGRN
PSAM_SYNSC      -METVLSAPEVFIALVVAAHAAVLALRLSISLYEA
PSAM_SYNPX      -MATALTSAEVFVALVVAAHAAVLALRLSISLYEA
PSAM_SYNS9      -MDSAISSPEIFIALVVAAHAAILALRLSVSLYRA
PSAM_SYNR3      -MATVLSQSEIYIALVVAAHAAILALRLSVSLYRS
PSAM_SYNPW      -MVSSITQAEIFIALVVAAHAGVLAVRLCVSLYRA
                          .   :         :  *   *