CLUSTAL format seed alignment for MF_00829

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y1527_OCEIH      MNLDQPSTENMKYILDTLAEELQIVNRSIMEVEDYNLDKYEDLKMMYEMVKTKGQLSALE
Y913_STAS1       -----MAKSIEQ-MIEEIRDRLNLVNQSLIDPDNYKSADEQEIREIHEYVTSKASFTPSE
Y1938_STAAC      -----MAMTNEE-KVLAIREKLNIVNQGLLDPEKYKNANEEELTDIYDFVQSRERLSPSE
Y2093_STAA8      -----MAMTNEE-KVLAIREKLNIVNQGLLDPEKYKNANEEELTDIYDFVQSRERLSPSE
Y1861_STAA3      -----MAMTNEE-KVLAIREKLNIVNQGLLDPEKYKNANEEELTDIYDFVQSRERLSPSE
Y1812_STAAB      -----MAMTNEE-KVLAIREKLNIVNQGLLDPEKYKNANEEQLTDIYDFVQSRERLSPSE
Y1970_STAAR      -----MAMTNEE-KVLAIREKLNIVNQGLLDPEKYKNANEEELTDIYDFVQSRERLSPSE
Y1802_STAAS      -----MAMTNEE-KVLAIREKLNIVNQGLLDPEKYKNANEEELTDIYDFVQSRERLSPSE
Y1880_STAAM      -----MAMTNEE-KVLAIREKLNIVNQGLLDPEKYKNANEEELTDIYDFVQSRERLSPSE
Y1820_STAAW      -----MAMTNEE-KVLAIREKLNIVNQGLLDPEKYKNANEEELTDIYDFVQSRERLSPSE
Y1696_STAAN      -----MAMTNEE-KVLAIREKLNIVNQGLLDPEKYKNANEEELTDIYDFVQSRERLSPSE
Y1076_STAHJ      -----MSQNNNETMIADIRKKLNIVNQGLLNPDKFKNANQQDIEEIHNFVMSKDSFSPSE
Y1565_STAES      -----MSLSNEE-MISNIRQKLNIVNQALLNPEKFKSTPHQDISEIYEFVMSKDSFSPSE
Y1418_STAEQ      -----MSLSNEE-MISNIRQKLNIVNQALFNPEKFKSTPHQDISEIYEFVMSKDSFSPSE
Y2298_ALKCK      --MASLTLEEIETMLDDMKKKLNVVNASVITSDSVSPAKHDDLIALHAHVMRSPSFSISE
Y1819_LISIN      MNLETPSQENLDFMLAEITTKLKMVNVGVFENLELDSVDYNALTDIYQLIKRKSNFSPRE
Y1707_LISMO      MNLETPSQENLNFMLTEITTKLKMVNVGVFENLELDSVDYNALVDIYQLIKRKSTFSPRE
Y1731_LISMF      MNLETPSQENLNFMLTEITTKLKMVNVGVFENLELDSVDYNALIDIYQLIKRKSNFSPRE
Y1727_LISW6      MNLETPSQENVNFMLTEITTKLKMVNVGVFENLELDSVDYNALIDIYQLIKRKSNFSPRE
Y816_BACLD       --MSDQKTAELNKMIEEISQKLNMLNIGVIKAEDFSNEKLEDLEYLHQMVMKKKSFSPSE
YFKK_BACSU       --MSSPNTETLTQMIEEISQKLNMLNVGVIKAEDFSDEKIEDLTYLHRMVMKKESFSPSE
Y2488_ALKHC      MNLNEESRENVVFMIEEIKKKLQVVNGSVLNPDSVDMSRYEDLRDIYDMIKKKNNFSVSE
Y418_GEOKA       MDLSKRSAENVAYMIEQLKQKLKVLNLDAIKPSHFSEEWYDELRDIYEMVMKRETFSPSE
Y406_BACAN       MDLSVKSEENVEYMVEAIKEKLRMVNAGAMRAASFNEEMYEDLRDIYEHVMKRETFSISE
Y520_BACC1       MDLSVKSEENVEYMVEAIKEKLRMVNAGAMRAASFNEEMYEDLRDIYEHVMKRETFSISE
Y380_BACCZ       MDLSVKSEENVEYMVEAIKEKLRMVNAGAMRAASFNEEMYEDLRDIYEHVMKRETFSISE
Y406_BACAH       MDLSVKSEENVEYMVEAIKEKLRMVNAGAMRAASFNEEMYEDLRDIYEHVMKRETFSISE
Y383_BACHK       MDLSVKSEENVEYMVEAIKEKLRMVNAGAMRAASFNEEMYEDLRDIYEHVMKRETFSISE
Y449_BACCR       MDLSVKSEENVEYMVEAIKEKLRMVNAGAMRAASFNEEMYEDLRDIYDHVMKRETFSISE
                               :  :   *.::*   :     .    : :  ::  :     ::  *

Y1527_OCEIH      KQAFIQELSSIRK----
Y913_STAS1       ASAIADALGQIRK----
Y1938_STAAC      VTAIADALGQLRHE---
Y2093_STAA8      VTAIADALGQLRHE---
Y1861_STAA3      VTAIADALGQLRHE---
Y1812_STAAB      VTAIADALGQLRHD---
Y1970_STAAR      VTAIADALGQLRHD---
Y1802_STAAS      VTAIADALGQLRHD---
Y1880_STAAM      VTAIADALGQLRHD---
Y1820_STAAW      VTAIADALGQLRHD---
Y1696_STAAN      VTAIADALGQLRHD---
Y1076_STAHJ      VTAIADELGNLRQD---
Y1565_STAES      VTAIADHLGQLRQDMED
Y1418_STAEQ      VTAIADHLGQLRQDMED
Y2298_ALKCK      MDEIVQELGQLRGRKS-
Y1819_LISIN      MQLFAEELRRIRK----
Y1707_LISMO      MQLFAEELRRVRK----
Y1731_LISMF      MQLFAEELRRIRK----
Y1727_LISW6      MQLFAEELRRIRK----
Y816_BACLD       MQAIAEELAALRK----
YFKK_BACSU       MQAIAQELASLRK----
Y2488_ALKHC      MDAIAVELGRLRK----
Y418_GEOKA       MQAIVEELGSLRKK---
Y406_BACAN       MQAITEELGTLIKK---
Y520_BACC1       MQAITEELGTLIKK---
Y380_BACCZ       MQAITEELGTLIKK---
Y406_BACAH       MQAITEELGTLIKK---
Y383_BACHK       MQAITEELGTLIKK---
Y449_BACCR       MQAITEELGTLIKK---
                    :   *  :