CLUSTAL format seed alignment for MF_00830

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RUTB_PSE14      ---------MNASATVAGVDLPDGQPARVLHARPEPLRMKPGETALVVVDMQNAYASLGG
RUTB_PSEU2      ---------MTTPTTVAGVDLPDLQPARELPARPEPLRMKPGETALVVVDMQNAYASLGG
RUTB_PSEU5      ---------MNAVEQISGYGLSATDEPVQLPARPEPLAMKASETALIVVDMQNAYASRGG
RUTB_PANAM      ------MMNIVENQTVVRRAPDNAGEERVLAARPEAIGFTPQQTALIVVDMQNAYASQGG
RUTB_SERP5      -------MKIVENQPVVRRQSPQAEVTLTLPARPEAIAFAPQETALIVVDMQNAYASQGG
RUTB_YERE8      ---------------------------MILNARPEPIAFPTSASALIVVDMQNAYASEGG
RUTB_METC4      ---------MEADAPAGYRDPSGRHGAVTLPARPEPIAFDADTTVLIVVDMQNAYATKGG
RUTB_METED      ---------MEADAPAGYRDPSGRHGAVTLPARPEPIAFDADATVLIVVDMQNAYATKGG
RUTB_METEA      ---------MDADAPAGYRDPSGRHGAVTLPARPEPVAFDADATVLIVVDMQNAYATKGG
RUTB_METEP      ---------MDADAPAGYRDPSGRHGAVTLPARPEPVAFDADATVLIVVDMQNAYATKGG
RUTB_METPB      ----------MDDAPAGYRDPSGRHGAVTLTARPEPIAFDTDATALIVVDMQNAYATKGG
RUTB_METRJ      ---MDRPTTYPMDQPAGFRDAQGRHGGVVLPARPEPIALDPATTFLIVVDVQNAYASPGG
RUTB_CROTZ      ------------------------MNAVNLMARPEALTFAPEQSALIVVDMQNAYASQGG
RUTB_CROS8      ------------------------MNTITLTARPEALTFAPEQSALIVVDMQNAYASQGG
RUTB_KLEP3      --------------------------MITLPARPESLTFAPQQSALIVVDMQNAYASQGG
RUTB_KLEVT      --------------------------MITLPARPESLTFAPQQSALIVVDMQNAYASQGG
RUTB_KLEP7      --------------------------MITLPARPESLSFAPQQSALIVVDMQNAYASQGG
RUTB_ENT38      --------------------------MTTLPARPEAITFAPQHSALIVVDMQNAYASQGG
RUTB_ENTCC      --------------------------MTTLNARPEAITFSAPQSALIVVDMQNAYASPGG
RUTB_ECO7I      --------------------------MTTLTARPEAITFDPQQTALIVVDMQNAYATPGG
RUTB_ECOSM      -------------------------MMTTLTARPEAITFDPQQTALIVVDMQNAYATPGG
RUTB_ECOK1      ------------MPRPSPCADSGGGMMTTLTARPEAITFDPQQTALIVVDMQNAYATPGG
RUTB_ECOUT      ------------MPRPSPCADSGGGMMTTLTARPEAITFDPQQTALIVVDMQNAYATPGG
RUTB_ECOKI      -------------------------MMTTLTARPEAITFDPQQTALIVVDMQNAYATPGG
RUTB_ECO45      --------------------------MTTLTARPEAITFDPQQTALIVVDMQNAYATPGG
RUTB_ECO27      --------------------------MTTLTARPEAITFDPQQTALIVVDMQNAYATPGG
RUTB_ECOL6      ------------MPRPSPCADSGGGMMTTLTARPEAITFDPQQTALIVVDMQNAYATPGG
RUTB_ECOL5      --------------------------MTTLTARPEAITFDPQQSALIVVDMQNAYATPGG
RUTB_ECO81      --------------------------MTTLTARPEAITFDPQQTALIVVDMQNAYATPGG
RUTB_ECOS5      --------------------------MTTLTARPEAITFDPQQSALIVVDMQNAYATPGG
RUTB_ECO10      --------------------------MTTLTARPEAITFDPQQSALIVVDMQNAYATPGG
RUTB_ECOSE      --------------------------MTTLTARPEAITFDPQQSALIVVDMQNAYATPGG
RUTB_ECOD1      --------------------------MTTLTARPEAITFDPQQSALIVVDMQNAYATPGG
RUTB_ECODH      --------------------------MTTLTARPEAITFDPQQSALIVVDMQNAYATPGG
RUTB_ECOBW      --------------------------MTTLTARPEAITFDPQQSALIVVDMQNAYATPGG
RUTB_ECOLI      --------------------------MTTLTARPEAITFDPQQSALIVVDMQNAYATPGG
RUTB_ECOBD      --------------------------MTTLTARPEAITFDPQQSALIVVDMQNAYATPGG
RUTB_ECOBR      --------------------------MTTLTARPEAITFDPQQSALIVVDMQNAYATPGG
RUTB_ECO5E      -------------------------MMTTLTARPEAITFDPQQSALIVVDMQNAYATPGG
RUTB_ECO5T      --------------------------MTTLTARPEAITFDPQQSALIVVDMQNAYATPGG
RUTB_ECO57      --------------------------MTTLTARPEAITFDPQQSALIVVDMQNAYATPGG
RUTB_ECO24      -------------------------MMTTLTARPEAITFDPQQSALIVVDMQNAYATPGG
RUTB_ECOCB      ------------MPRPSPCADSGGGMMTTLTARPEAITFDPQQSALIVVDMQNAYATPGG
RUTB_SHISS      ------------MPRPSPCADSGGGMMTTLTARPEAITFDPQQSALIVVDMQNAYATPGG
RUTB_ECOLC      -------------------------MMTTLTARPEAITFDPQQSALIVVDMQNAYATPGG
RUTB_ECO55      --------------------------MTTLTARPEAITFDPQQSALIVVDMQNAYATPGG
RUTB_ECO26      --------------------------MTTLTARPEAITFDPQQSALIVVDMQNAYATPGG
RUTB_SHIF2      ------------MPRPSLCADSGGGMMTTLTARPEAITFDPQQSAQIVVDMQNAYATPGG
RUTB_SHIFL      ------------MPRPSLCADSGGGMMTTLTARPEAITFDPQQSAQIVVDMQNAYATPGG
RUTB_SHIF8      -------------------------MMTTLTARPEAITFDPQQSAQIVVDMQNAYATPGG
RUTB_ECOHS      -------------------------MMTTLTARPEAITFDPQQSALIVVDMQNAYATPGG
RUTB_ECO1A      --------------------------MTTLTARPEAITFDPQQSALIVVDMQNAYATPGG
RUTB_ECO8A      --------------------------MTTLTARPEAITFDPQQSALIVVDMQNAYATPGG
RUTB_ECO44      --------------------------MTILTARPEAITFDPQQSALIVVDMQNAYATPGG
RUTB_ECOLU      --------------------------MTILTARPEAITFDPQQSALIVVDMQNAYATPGG
RUTB_ACIAD      ------------MNTVIADFTERAGTGRVLKAEPEAIQLAPEQTALIVVDMQNAYTSIGG
RUTB_AGRFC      ---------------------------MTLPARPEPITLKPSETAVVVVDMQNAYSTEGG
RUTB_AGRRK      ---------MSAVTAAGYQAPQERSQSVTLPARPEPITLKPSETAVVVVDMQNAYSTEGG
RUTB_HALO1      ------------MTGNLSGENPAESVSTTLAARPEDIALDVAHTAVVVIDMQNAYASPGG
RUTB_VARPS      MSTPARNTTLTSNTPAGAPRLPGAPAPQVLPARPEPLALHASDSALIVVDMQNAYASMGG
RUTB_AZOC5      ----------------------------MLPARPEPLSVAVEETAVVVVDMQNAYASPGG
RUTB_CAUVC      ----------------------------MLPARPEPLPVDPKTTAVIVIDMQNAYASPGG
RUTB_CAUVN      ---------------MSSPITPLSPGCVMLPARPEPLPVDPKTTAVIVIDMQNAYASPGG
RUTB_CAUST      ---------------MSSPITPLSPGCVMLPARPEPVPVDPKTTAVIVIDMQNAYASPGG
RUTB_CAUSK      ---------------------MTTPDTLMLPARPEPIALPVDKTAVIVIDMQNAYASPGG
                                             * *.** : .    :  :*:*:****:: .*

RUTB_PSE14      YLDLAGFDVSSTGPVIVNINKACAAARAAGIPVIFFQNGWDPAYVEAGGPGSPNWHKSNA
RUTB_PSEU2      YLDLAGFDVSSTGPVIANINKACAAARAAGIPVIFFQNGWDPAYVEAGGPGSPNWHKSNA
RUTB_PSEU5      YLDLAGFDVSATQPVIAKIRQALNAARAAGMQVIFLQNGWDNGYVEAGGPGSPNWHKSNA
RUTB_PANAM      YLDLAGFDVSATAPVIANIKVAIAAARAAGIKVIFFQNGWDNQYVEAGGRARPTSINPMR
RUTB_SERP5      YLDLAGFDISATAPVIANIKRAISAARAAGIKVIFFQNGWDNQYVEAGGQGSPNWHKSNA
RUTB_YERE8      YLDLAGFDVSATAPIITNIKRAITAARAAGIQVIFFQNGWDPQYVEAGGEGSPNWHKSNA
RUTB_METC4      YLDLAGFDVSATGPVIERIAQAVAAARAAGIRVVWFQNGWDPDYVEAGGPGSPNWHKSNA
RUTB_METED      YLDLAGFDVSATGPVIERIARAVAAARAAGIRVVWFQNGWDPDYVEAGGPGSPNWHKSNA
RUTB_METEA      YLDLAGFDVSATGPVIERIARAVAAARAAGIRVVWFQNGWDPDYVEAGGPGSPNWHKSNA
RUTB_METEP      YLDLAGFDVSATGPVIERIARAVAAARAAGIRVVWFQNGWDPDYVEAGGPGSPNWHKSNA
RUTB_METPB      YLDLAGFDVSATGPVIERIARAVAAARAAGIRVIWFQNGWDPDYVEAGGPGSPNWHKSNA
RUTB_METRJ      YLDRAGFDVSGTGPVIARIARAVAAARAAGIPVLWFQNGWDPAYVEAGGPGSPNWHKSNA
RUTB_CROTZ      YLDLAGFDVSTTAPVIENIKTAVAAAREAGMTIVWFQNGWDSDYLEAGGPGSPNFHKSNA
RUTB_CROS8      YLDLAGFDVSSTAPVIENIKTAVAAAREAGMTIVWFQNGWDSDYLEAGGPGSPNFHKSNA
RUTB_KLEP3      YLDLAGFDVSATRPVIVNINTAVAAARAAGMLIIWFQNGWDDQYVEAGGPGSPNYHKSNA
RUTB_KLEVT      YLDLAGFDVSATRPVIDNINTAVAAARAAGMLIIWFQNGWDDQYVEAGGPGSPNYHKSNA
RUTB_KLEP7      YLDLAGFDVSATRPVIDNINTAVAAARAAGMLIIWFQNGWDDQYVEAGGPGSPNYHKSNA
RUTB_ENT38      YLDLAGFDVSATQPVIANIKTAVAAARAAGILIIWFQNGWDDQYVEAGGPGSPNFHKSNA
RUTB_ENTCC      YLDLAGFDVSATRPVIENIKTAVAAARAAGMLIIWFQNGWDDQYVEAGGPGSPNFHKSNA
RUTB_ECO7I      YLDLAGFDVSTTRPVIANIQTAVTAARAAGMLIIWFQNGWDAQYVEAGGPGSPNFHKSNA
RUTB_ECOSM      YLDLAGFDVSTTRPVIANIQTAVTAARAAGMLIIWFQNGWDAQYVEAGGPGSPNFHKSNA
RUTB_ECOK1      YLDLAGFDVSTTRPVIANIQTAVTAARTAGMLIIWFQNGWDEQYVEAGGPGSPNYHKSNA
RUTB_ECOUT      YLDLAGFDVSTTRPVIANIQTAVTAARTAGMLIIWFQNGWDEQYVEAGGPGSPNYHKSNA
RUTB_ECOKI      YLDLAGFDVSTTRPVIANIQTAVTAARTAGMLIIWFQNGWDEQYVEAGGPGSPNYHKSNA
RUTB_ECO45      YLDLAGFDVSTTRPVIANIQTAVTAARTAGMLIIWFQNGWDEQYVEAGGPGSPNYHKSNA
RUTB_ECO27      YLDLAGFDVSTTRPVIANIQTAVTAARAAGMLIIWFQNGWDEQYVEAGGPGSPNYHKSNA
RUTB_ECOL6      YLDLAGFDVSTTRPVIANIQTAVTAARTAGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNA
RUTB_ECOL5      YLDLAGFDVSTTRPVIANIQTAVTAARAAGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNA
RUTB_ECO81      YLDLAGFDVSTTRPVIANIQTAVTAARAAGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNA
RUTB_ECOS5      YLDLAGFDVSTTRPVIANIQTAVTAARAAGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNA
RUTB_ECO10      YLDLAGFDVSTTRPVIANIQTAVTAARAAGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNA
RUTB_ECOSE      YLDLAGFDVSTTRPVIANIQTAVTAARAAGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNA
RUTB_ECOD1      YLDLAGFDVSTTRPVIANIQTAVTAARAAGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNA
RUTB_ECODH      YLDLAGFDVSTTRPVIANIQTAVTAARAAGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNA
RUTB_ECOBW      YLDLAGFDVSTTRPVIANIQTAVTAARAAGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNA
RUTB_ECOLI      YLDLAGFDVSTTRPVIANIQTAVTAARAAGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNA
RUTB_ECOBD      YLDLAGFDVSTTRPVIANIQTAVTAARAAGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNA
RUTB_ECOBR      YLDLAGFDVSTTRPVIANIQTAVTAARAAGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNA
RUTB_ECO5E      YLDLAGFDVSTTRPVIANIQTAVTAARAAGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNA
RUTB_ECO5T      YLDLAGFDVSTTRPVIANIQTAVTAARAAGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNA
RUTB_ECO57      YLDLAGFDVSTTRPVIANIQTAVTAARAAGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNA
RUTB_ECO24      YLDLAGFDVSTTRPVIANIQTAVTAARAAGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNA
RUTB_ECOCB      YLDLAGFDVSTTRPVIANIQTAVTAARAAGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNA
RUTB_SHISS      YLDLAGFDVSTTRPVIANIQTAVTAARAAGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNA
RUTB_ECOLC      YLDLAGFDVSTTRPVIANIQTAVTAARAAGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNA
RUTB_ECO55      YLDLAGFDVSTTRPVIANIQTAVTAARAAGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNA
RUTB_ECO26      YLDLAGFDVSTTRPVIANIQTAVTAARAAGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNA
RUTB_SHIF2      YLDLAGFDVSTTRPVIANIQTAVTAARAAGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNA
RUTB_SHIFL      YLDLAGFDVSTTRPVIANIQTAVTAARAAGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNA
RUTB_SHIF8      YLDLAGFDVSTTRPVIANIQTAVTAARAAGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNA
RUTB_ECOHS      YLDLAGFDVSTTRPVIANIQTAVTAARAAGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNA
RUTB_ECO1A      YLDLAGFDVSTTRPVIANIQTAVTAARAAGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNA
RUTB_ECO8A      YLDLAGFDVSTTRPVIANIQTAVTAARAAGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNA
RUTB_ECO44      YLDLAGFDVSTTRPVIANIQTAVTAARAAGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNA
RUTB_ECOLU      YLDLAGFDVSTTRPVIANIQTAVTAARAAGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNA
RUTB_ACIAD      YLDLAGFDVSKTKPVVENIQKAVTAAHAAGIQVIYFKNGWDNQYVEAGGAGSPNFHKSNA
RUTB_AGRFC      YVDLAGFDISGAKGTIANIKKTLDAARAAGVQVIYFQNGWDKDYVEAGGPGSPNWHKSNA
RUTB_AGRRK      YVDLAGFDIAGAKGTIANIKKTLDAARAAGVQVIYFQNGWDKDYVEAGGPGSPNYHKSNA
RUTB_HALO1      YVDLAGFDIAGAAGVIGRIATVLESARTAGMQVVFLQNGWDPDYVEAGGPQSPNWHKSNA
RUTB_VARPS      YVDSAGFDISGAQGTIANIARTIAAARTAGMLVVFLQNGWDAAYVEAGGPGSPNWHKSNA
RUTB_AZOC5      YLDIAGFDISGAKAAISAIAETVEAARAAGVTVIYFQNGWDKDYVEAGGPGSPNWHKSNA
RUTB_CAUVC      YLDLAGFDISGAAKVTHEIKGVLEVARSAGMTVIYFQNGWDDGYVEAGGPGSPNWWKSNA
RUTB_CAUVN      YLDLAGFDISGAAKVTHEIKGVLEVARSAGMTVIYFQNGWDDGYVEAGGPGSPNWWKSNA
RUTB_CAUST      YLDLAGFDISGAAKVIHEIKGVLEVARSAGMQVIYFQNGWDDQYVEAGGPGSPNWWKSNA
RUTB_CAUSK      YLDLAGFDISGAAAVIDKIKGVLDVARGAGMPVIYFQNGWDSDYVEAGGPGSPNWHKSNA
                *:* ****:: :         .   *: **: :::::****  * ****   *.  :.  

RUTB_PSE14      LKTMRKRPELEGQLLAKGGWDYQLVDELKPQPGDIVVPKIRYSGFFNSSFDSVLRSRGIR
RUTB_PSEU2      LKTMRKRPELEGQLLAKGGWDYQLVDELTPQPGDIVVPKIRYSGFFNSSFDSVLRSRGIR
RUTB_PSEU5      LKTMRKRPELAGTLLAKGGWDYALVDELAPQPGDILVPKPRYSGFFNSQLDSTLRARGIR
RUTB_PANAM      LKTMRKRPELMGKLLAKGDWDYDLVDELQPQPGDIVLPKPRYSGFFNTQLDSLLRSYGIH
RUTB_SERP5      LKTMRKRPELMGKLLARGDWDYDLVDELQPQAGDIVLPKPRYSGFFNTQLDSLLRSYGIH
RUTB_YERE8      LKTMRKQPELMGKLLAKGDWDYALVDELQPQAGDIVIAKPRYSGFFNTQLDSILRAKGIH
RUTB_METC4      LKTMRRRPEMNQRLLAKGTWDYALVDALTPEPGDIVLPKPRYSGFYNTPLDSMLRARGIR
RUTB_METED      LKTMRRRPEMNQRLLAKGTWDYALVDALTPEPGDIVLPKPRYSGFYNTPLDSMLRARGIR
RUTB_METEA      LKTMRLRPQMNQRLLAKGTWDYALVDALTPEPGDIVLPKPRYSGFYNTPLDSMLRARGIR
RUTB_METEP      LKTMRRRPEMNQRLLAKGTWDYALVDALTPEPGDIVLPKPRYSGFYNTPLDSMLRARGIR
RUTB_METPB      LKTMRRRPEMNERLLAKGTWDYALVDALRPEPGDIVLGKPRYSGFYNTPLDSMLRARGIR
RUTB_METRJ      LKTMRRNPEANTQLLAKGSWDYALVDALTPEPGDIVMGKPRYSGFYNTPLDSTLRARGVT
RUTB_CROTZ      LKTMRRRPELHGKLLAKGGWDYQLVDELTPLPGDIVLPKPRYSGFFNTPLDSMLRARNIR
RUTB_CROS8      LKTMRRCPELHGKLLAKGGWDYQLVDELTPLPGDIVLPKPRYSGFFNTPLDSMLRARNIR
RUTB_KLEP3      LKTMRQRPELQGKLLAKGGWDYQLVDELTPQEGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_KLEVT      LKTMRQRPELQGKLLAKGGWDYQLVDELTPQEGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_KLEP7      LKTMRQRPELQGKLLAKGGWDYQLVDELTPQEGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_ENT38      LKTMRNRPELQGTLLAKGGWDYQLVDELVPEPGDIVLPKPRYSGFFNTPLDSLLRSRGIR
RUTB_ENTCC      LKTMRKRPELQGKLLAKGGWDYQLVDELVPEAGDIVLPKPRYSGFFNTPLDSLLRSRGIR
RUTB_ECO7I      LKTMRKQPQLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSSFFNTPLDSILRSRGIR
RUTB_ECOSM      LKTMRKQPQLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_ECOK1      LKTMRNQPLLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_ECOUT      LKTMRNQPLLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_ECOKI      LKTMRNQPLLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_ECO45      LKTMRNQPLLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_ECO27      LKTMRNQPLLQGKLLTKGSWDYQLVDELMPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_ECOL6      LKTMRNQPQLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_ECOL5      LKTMRNQPQLQGKLLAKGSWDYQLVDELMPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_ECO81      LKTMRKQPQLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_ECOS5      LKTMRKQPQLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_ECO10      LKTMRNQPQLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_ECOSE      LKTMRNQPQLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_ECOD1      LKTMRKQPQLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_ECODH      LKTMRKQPQLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_ECOBW      LKTMRKQPQLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_ECOLI      LKTMRKQPQLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_ECOBD      LKTMRKQPQLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_ECOBR      LKTMRKQPQLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_ECO5E      LKTMRKQPQLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_ECO5T      LKTMRKQPQLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_ECO57      LKTMRKQPQLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_ECO24      LKTMRKQPQLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_ECOCB      LKTMRKQPQLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_SHISS      LKTMRKQPQLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_ECOLC      LKTMRKQPQLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_ECO55      LKTMRKQPQLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_ECO26      LKTMRKQPQLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_SHIF2      LKTMRKQPQLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_SHIFL      LKTMRKQPQLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_SHIF8      LKTMRKQPQLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_ECOHS      LKTMRKQPQLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_ECO1A      LKTMRKQPQLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_ECO8A      LKTMRKQPQLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_ECO44      LKTMRKQPQLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_ECOLU      LKTMRKQPQLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIR
RUTB_ACIAD      LKTMRKQPELQGKLLAKGGWDFELIDELQPKSQDIVIEKPRYSGFFNTALDSMLRARGIR
RUTB_AGRFC      LKTMRKRPELQGQLLAKGTWDYAIVDELQPQPGDILVPKTRYSGFFNTNMDSVLRARGIR
RUTB_AGRRK      LKTMRQRPELQGQLLAKGTWDYAIVDELQPQPGDILVPKTRYSGFFNTNMDSVLRARGIR
RUTB_HALO1      LKTMRARPELEGKLLARGGWDYALVDGLKPQPGDIQVHKPRYSAFFHSQLDSVLRARGIR
RUTB_VARPS      LKTMRARPELAGKFLAKGGWDYELIAEMKPQPGDIVVPKTRYSGFFNSTLDSTLRARGIR
RUTB_AZOC5      LKTMRKKPELQGQLLAKGGWDYALVDQLAPQPGDIVVPKPRYSGFFNSQFDSILRARGIR
RUTB_CAUVC      LKTMRARPELQGKLLARGQWDYELVDDLTPQPGDIRLHKTRYSGFFNSQLDSVLRARGIR
RUTB_CAUVN      LKTMRARPELQGKLLARGQWDYELVDDLTPQPGDIRLHKTRYSGFFNSQLDSVLRARGIR
RUTB_CAUST      LKTMRAKPELQGKLLARGQWDYELVDELKPQPGDIQLHKTRYSGFFNSQLDSVLRARGIR
RUTB_CAUSK      LKTMRARPELQGKLLARGGWDYDLVDALKPEPGDIQLHKTRYSGFFNSQLDSVLRSRGIR
                *****  *     :*::* **: ::  : *   ** : * ***.*::: :** **: .: 

RUTB_PSE14      NLVFTGIATNVCVESTLRDGFHLEYFGVVLADATHQAGPDFAQQAALFNIETFFGWISSV
RUTB_PSEU2      NLVFTGIATNVCVESTLRDGFHLEYFGVVLADATHQAGPEFAQQAALFNIETFFGWVSSV
RUTB_PSEU5      NLVFTGIATNVCVESTLRDGFHLEYFGVVLADATHQAGPEFAQQAALYNIETFFGWVSSV
RUTB_PANAM      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPEFAQKAAIYNIETFFGWVSSV
RUTB_SERP5      HLVFTGIATNVCVESTLRDGFFLEYFGIVLADATHQAGPQFAQQAALYNIETFFGWVSDV
RUTB_YERE8      HLIFTGIATNVCVESTLRDGFFFEYFGVVLEDATHQAGPDFAQKAALYNIETFFGWVSDV
RUTB_METC4      TLVFTGIATNVCVESTLRDGYHREYFGIVLADATHQAGPPALQEGALRNIETFFGWVSDV
RUTB_METED      TLVFTGIATNVCVESTLRDGYHREYFGIVLADATHQAGPPALQEGALRNIETFFGWVSDV
RUTB_METEA      TLVFTGIATNVCVESTLRDGYHREYFGIVLADATHQAGPPALQEGALRNIETFFGWVSDV
RUTB_METEP      TLVFTGIATNVCVESTLRDGYHREYFGIVLADATHQAGPPALQEGALRNIETFFGWVSDV
RUTB_METPB      TLVFTGIATNVCVESTLRDGYHREYFGVVLADATHQAGPPSLQEGALRNIETFFGWVSDV
RUTB_METRJ      TLVFTGIATNVCVESTLRDGFHREYFGIVLADATHQAGPESLHRAALANIETFFGWVSDV
RUTB_CROTZ      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPPFAQQAALFNIETFFGWVSDV
RUTB_CROS8      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPPFAQQAALFNIETFFGWVSDV
RUTB_KLEP3      HLVFTGIATNVCVESTLRDGFFLEYFGIVLEDATHQAGPAFAQQAALFNIETFFGWVSDV
RUTB_KLEVT      HLVFTGIATNVCVESTLRDGFFLEYFGIVLEDATHQAGPAFAQQAALFNIETFFGWVSDV
RUTB_KLEP7      HLVFTGIATNVCVESTLRDGFFLEYFGIVLEDATHQAGPAFAQQAALFNIETFFGWVSDV
RUTB_ENT38      HLIFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPEFAQKAALFNIETFFGWVSTV
RUTB_ENTCC      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPEFAQKAALFNIETFFGWVSNV
RUTB_ECO7I      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPEFAQKAALFNIETFFGWVSDV
RUTB_ECOSM      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPEFAQKAALFNIETFFGWVSDV
RUTB_ECOK1      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPEFAQKAALFNIETFFGWVSDV
RUTB_ECOUT      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPEFAQKAALFNIETFFGWVSDV
RUTB_ECOKI      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPEFAQKAALFNIETFFGWVSDV
RUTB_ECO45      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPEFAQKAALFNIETFFGWVSDV
RUTB_ECO27      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPEFAQKAALFNIETFFGWVSDV
RUTB_ECOL6      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPEFAQKAALFNIETFFGWVSDV
RUTB_ECOL5      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPEFAQKAALFNIETFFGWVSDV
RUTB_ECO81      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPEFAQKAALFNIETFFGWVSDV
RUTB_ECOS5      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPEFAQKAALFNIETFFGWVSDV
RUTB_ECO10      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPEFAQKAALFNIETFFGWVSDV
RUTB_ECOSE      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPEFAQKAALFNIETFFGWVSDV
RUTB_ECOD1      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPKFAQKAALFNIETFFGWVSDV
RUTB_ECODH      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPKFAQKAALFNIETFFGWVSDV
RUTB_ECOBW      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPKFAQKAALFNIETFFGWVSDV
RUTB_ECOLI      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPKFAQKAALFNIETFFGWVSDV
RUTB_ECOBD      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPEFAQKAALFNIETFFGWVSDV
RUTB_ECOBR      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPEFAQKAALFNIETFFGWVSDV
RUTB_ECO5E      HLVFTSIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPEFVQKAALFNIETFFGWVSDV
RUTB_ECO5T      HLVFTSIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPEFVQKAALFNIETFFGWVSDV
RUTB_ECO57      HLVFTSIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPEFVQKAALFNIETFFGWVSDV
RUTB_ECO24      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPEFVQKAALFNIETFFGWVSDV
RUTB_ECOCB      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPEFVQKAALFNIETFFGWVSDV
RUTB_SHISS      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPEFAQKAALFNIETFFGWVSDV
RUTB_ECOLC      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPEFAQKAALFNIETFFGWVSDV
RUTB_ECO55      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPEFAQKAALFNIETFFGWVSDV
RUTB_ECO26      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPEFAQKAALFNIETFFGWVSDV
RUTB_SHIF2      HLVFTGIATNVCVESTLRDGFFLEHFGVVLEDATHQAGPEFAQKAALFNIETFFGWVSDV
RUTB_SHIFL      HLVFTGIATNVCVESTLRDGFFLEHFGVVLEDATHQAGPEFAQKAALFNIETFFGWVSDV
RUTB_SHIF8      HLVFTGIATNVCVESTLRDGFFLEHFGVVLEDATHQAGPEFAQKAALFNIETFFGWVSDV
RUTB_ECOHS      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPEFAQKAALFNIETFFGWVSDV
RUTB_ECO1A      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPEFAQKAALFNIETFFGWVSDV
RUTB_ECO8A      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPEFAQKAALFNIETFFGWVSDV
RUTB_ECO44      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPEFAQKAALFNIETFFGWVSDV
RUTB_ECOLU      HLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPEFAQKAALFNIETFFGWVSDV
RUTB_ACIAD      NLVFVGIATNVCVESTLRDGFFLEYFGVALDDACYQAGPVEMHRASMYNIKTFFGWVSDT
RUTB_AGRFC      NLVFVGIATNVCVESSLRDAFHLEYFGVMLEDATHHLGPDFIQQATVYNVEKFFGWVATV
RUTB_AGRRK      NLVFVGIATNVCVESSLRDAFHLEYFGVMLEDATHHLGPDFIQQATVYNVEKFFGWVATV
RUTB_HALO1      NLVFVGIATNVCVESTLRDGFHLEYFCVLLEDATHHLGPEFVQAATVYNVEKFFGWVSTV
RUTB_VARPS      HLVFTGIATNVCVESTLRDAFHLEYFAVMLEDATHELGGAAIQKASVYNVETFFGWVSTV
RUTB_AZOC5      NLVFCGIATNVCVESTLRDGFHLEYFGILLEDATHQAGPEYVQKAAIYNVETFFGWVSTV
RUTB_CAUVC      HLVFTGIATNVCVESTLRDGFMLEYFGTVLEDATHQAGPDFVQKAALFNIETFFGWVSTT
RUTB_CAUVN      HLVFTGIATNVCVESTLRDGFMLEYFGTVLEDATHQAGPDFVQKAALFNIETFFGWVSTT
RUTB_CAUST      HLVFVGIATNVCVESTLRDGFFLEYFGTVLEDATHQAGPEFVQKAALFNIESFFGWVSTT
RUTB_CAUSK      HLVFVGIATNVCVESTLRDGFFLEYFGTVLEDATHQAGPDFVQKAALYNIETFFGWVSTT
                 *:* .*********:***.:  *:*   * ** :. *    : .:: *::.****:: .

RUTB_PSE14      DDFCTTFSPVGQPS--------
RUTB_PSEU2      DDFCTTFSPVGQPS--------
RUTB_PSEU5      DAFCQSFAAAPEVAVAS-----
RUTB_PANAM      SHFCDAVGYKTEQNAA------
RUTB_SERP5      DSFCNTLAAPLSQTA-------
RUTB_YERE8      ETFCNCIAPSAQLSQSA-----
RUTB_METC4      AAFEAALSSDEARRIPA-----
RUTB_METED      AAFEAALSSDEARRIPA-----
RUTB_METEA      AAFEAALSSDEARRIPA-----
RUTB_METEP      AAFEAALSSDEARRIPA-----
RUTB_METPB      AAFEAALQPDEARRIPA-----
RUTB_METRJ      AAFESALGVPSRAPAGADLAG-
RUTB_CROTZ      QRFCDALSPAALARIA------
RUTB_CROS8      QSFCDALSPEALARIA------
RUTB_KLEP3      ESFCHALSPATPLSLAKEKRYA
RUTB_KLEVT      ESFCHALSPATPLSLAKEKRYA
RUTB_KLEP7      ESFCHALSPAAPLALAKEKRYA
RUTB_ENT38      ADFCDAVSPPSLARIA------
RUTB_ENTCC      ADFCDALNPP-LARIA------
RUTB_ECO7I      ETFCDALSPTSFARIA------
RUTB_ECOSM      ETFCDALSPTSFARIA------
RUTB_ECOK1      ETFCDALSSTSFARIA------
RUTB_ECOUT      ETFCDALSSTSFARIA------
RUTB_ECOKI      ETFCDALSSTSFARIA------
RUTB_ECO45      ETFCDALSSTSFARIA------
RUTB_ECO27      ETFCDALSSTSFARIA------
RUTB_ECOL6      ETFCDALSSTSFARIA------
RUTB_ECOL5      ETFCDALSSTSFARIA------
RUTB_ECO81      ETFCDALSSTSFARIA------
RUTB_ECOS5      ETFCDALSSTSFARIA------
RUTB_ECO10      ETFCDALSPTSFARIA------
RUTB_ECOSE      ETFCDALSPTSFARIA------
RUTB_ECOD1      ETFCDALSPTSFAHIA------
RUTB_ECODH      ETFCDALSPTSFAHIA------
RUTB_ECOBW      ETFCDALSPTSFAHIA------
RUTB_ECOLI      ETFCDALSPTSFAHIA------
RUTB_ECOBD      ETFCDALSPTSFAHIA------
RUTB_ECOBR      ETFCDALSPTSFAHIA------
RUTB_ECO5E      ETFCDALSPTSFARIA------
RUTB_ECO5T      ETFCDALSPTSFARIA------
RUTB_ECO57      ETFCDALSPTSFARIA------
RUTB_ECO24      ETFCDALSPTSFARIA------
RUTB_ECOCB      ETFCDALSPTSFARIA------
RUTB_SHISS      ETFCDALSPTSFARIA------
RUTB_ECOLC      ETFCDALSPTSFARIA------
RUTB_ECO55      ETFCDALSPTSFARIA------
RUTB_ECO26      ETFCDALSPTSFARIA------
RUTB_SHIF2      ETFCDALSPTSFARIA------
RUTB_SHIFL      ETFCDALSPTSFARIA------
RUTB_SHIF8      ETFCDALSPTSFARIA------
RUTB_ECOHS      ETFCDALSPTSFARIA------
RUTB_ECO1A      ETFCDALSPTSFARIA------
RUTB_ECO8A      ETFCDALSPTSFARIA------
RUTB_ECO44      ETFCDALSPTSFARIA------
RUTB_ECOLU      ETFCDALSPTSFARIA------
RUTB_ACIAD      QSFVNTFQHNQQLAKTA-----
RUTB_AGRFC      NDFCGVISQAAPVTD-------
RUTB_AGRRK      NDFCATVSQAAPTEA-------
RUTB_HALO1      EDFCASMRAIAKP---------
RUTB_VARPS      DDFVRSFAPATA----------
RUTB_AZOC5      ADFRRAFAQIPPKED-------
RUTB_CAUVC      ADFKGTFGQLAPG---------
RUTB_CAUVN      ADFKGTFGQLAPG---------
RUTB_CAUST      ADFKGTFGQLAPRT--------
RUTB_CAUSK      ADFKGAVGQREGAG--------
                  *   .