CLUSTAL format seed alignment for MF_00832

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RUTD_PSE14      -------------------MFHEIHRCQHADAPLLVLSSGLGGSSRYWADDLAALTRD-H
RUTD_PSEU2      -------------------MFHEFHACQHADAPTLVLSSGLGGSGRYWADDLTLLTRD-Y
RUTD_PSEU5      -------------------MHYELHGRMEPDAPTLVLSSGLGGAAAFWLPQLPALTQD-Y
RUTD_AGRRK      -------------------MHFEVHGLDRPDAKTIILSSGLGGSGSYWAPQIEALATD-F
RUTD_AGRFC      -------------------MHFEVHGRTDAEAPTILLSSGLGGSSAYWLPQIEALSDH-F
RUTD_METED      ---------------MAAPVHHEVHGP--AGGRTVLLSPGLGGSAHYFAPQVPVLAER-F
RUTD_METEP      ---------------MAAPVHHEVHGP--AGGRTVLLSPGLGGSAHYFAPQVPVLAER-F
RUTD_METC4      ---------------MAAPVHHEVHGP--AGGRTVLLSPGLGGSAHYFAPQVPVLAER-F
RUTD_METEA      ---------------MAAPVHHEVHGP--EGGRKVLLSPGLGGSAHYFAPQVPVLAER-F
RUTD_METPB      ---------------MAAPVHHALHGP--EGARTVLLSPGLGGSAHYFAPQVPALAER-F
RUTD_METRJ      ----------------MGPLHHAVAGP--AGGRPVLLSPGLGGAAGYFAPQMAALTAR-F
RUTD_AZOC5      ---------MPYAHGGDADLYYEIHG----AGTPILLSAGMGGGAGFWRPQIEALAAR-H
RUTD_CAUVN      --------MRRMTIGTVDGLHYELHGGPIAGREVVLLSSGLGGSGAFWAPQMQALTQR-W
RUTD_CAUVC      --------MRRMTIGTVDGLHYELHGGPIAGREVVLLSSGLGGSGAFWAPQMQALTQR-W
RUTD_CAUST      -----------MTTGTVDGICYEVHGWPVAGREVVLLSSGLGGSAAFWAPQMKALTER-W
RUTD_CAUSK      -----------MQSGTVDGLYHEVHGGPASDRQTVILSAGLGGSGTFWAPQMQALMSR-F
RUTD_VARPS      -----------------MPLHYEVHGP--ADGEAVLLSSGLGGSAAFWQPQLGALLEAGH
RUTD_SERP5      -------------------MYFEILGKDTPLAPTLVLSAGLGGAGSFWQPQINALGEH-F
RUTD_YERE8      -------------------MYFEITGQNSPAAKTVVLSAGLGGSGRFWQPQLSALGQH-F
RUTD_PANAM      -------------------MYYKVLGQQNADAETVVLSSGLGGSGGFWQPQLAMLSAH-F
RUTD_CROTZ      -------------------MKLRISDAPFPGAPVMVMISGLGGLGGYWLAQQNALSQA-Y
RUTD_CROS8      ------------------MMKLRVSEAPFPGAPVMVMIAGLGGLGGYWLAQQSALSRD-Y
RUTD_KLEP3      -------------------MRLNIAPAPWPGAPVVVLSAGLGGGGGYWLAQRAALEAQ-Y
RUTD_KLEVT      ------------------MMRLNIAPAPWPGAPVVVLSAGLGGGGGYWLAQRAALEAQ-Y
RUTD_KLEP7      -------------------MRLNIAPAPWPGAPVVVLSAGLGGGGGYWLAQRAALEEQ-Y
RUTD_ECO44      -------------------MKLSLSPPPYADAPVVVLISGLGGSGSYWLPQLAVLEQE-Y
RUTD_ECOSM      -------------------MKLSLSPPPYADAPVVVLISGLGGSGSYWLPQLAVLEQE-Y
RUTD_ECOLU      ----------MRISPSEAAMKLSLSPPPYADAPVVVLISGLGGSGSYWLPQLAVLEQE-Y
RUTD_ECO81      -------------------MKLSLSPPPYADAPVVVLISGLGGSGSYWLPQLAVLDQE-Y
RUTD_ECOL6      ----------MRISPSETAMKLSLSPPPYADAPVVVLISGLGGSGSYWLPQLAVLDQE-Y
RUTD_ECOL5      -------------------MKLSLSPPPYADAPVVVLISGLGGSGSYWLPQLAVLEQE-Y
RUTD_ECO27      -------------------MKLSLSPPPYADAPVVVLISGLGGSGSYWLPQLAVLDQE-Y
RUTD_ECOS5      -------------------MKLSLSPPPYADAPVVVLISGLGGSGSYWLPQLAVLDQE-Y
RUTD_ECOK1      -------------------MKLSLSPPPYADAPVVVLISGLGGSGSYWLPQLAVLVQE-Y
RUTD_ECOUT      ----------MRISPSEAAMKLSLSPPPYADAPVVVLISGLGGSGSYWLPQLAVLVQE-Y
RUTD_ECOKI      -------------------MKLSLSPPPYADAPVVVLISGLGGSGSYWLPQLAVLVQE-Y
RUTD_ECO45      -------------------MKLSLSPPPYADAPVVVLISGLGGSGSYWLPQLAVLVQE-Y
RUTD_ECO7I      -------------------MKLSLSPPPYADAPVVVLISGLGGSGSYWLPQLAVLEQE-Y
RUTD_SHIF8      -------------------MKLSLSSPPYADAPVVVLISGLGGSGSYWLPQLAVLEQE-Y
RUTD_SHIFL      -------------------MKLSLSSPPYADAPVVVLISGLGGSGSYWLPQLAVLEQE-Y
RUTD_SHIF2      -------------------MKLSLSSPPYADAPVVVLISGLGGSGSYWLPQLAVLEQE-Y
RUTD_ECO57      -------------------MKLSLSPPPYADAPVVVLISGLGGSGSYWLPQLAVLEQE-Y
RUTD_ECOCB      -------------------MKLSLSPPPYADAPVVVLISGLGGSGSYWLPQLAVLEQE-Y
RUTD_ECO5E      -------------------MKLSLSPPPYADAPVVVLISGLGGSGSYWLPQLAVLEQE-Y
RUTD_ECO5T      -------------------MKLSLSPPPYADAPVVVLISGLGGSGSYWLPQLAVLEQE-Y
RUTD_ECO24      -------------------MKLSLSPPPYADAPVVVLISGLGGSGSYWLPQLAVLEQE-Y
RUTD_ECOHS      -------------------MKLSLSPPPYADAPVVVLISGLGGSGSYWLPQLAVLEQE-Y
RUTD_ECOLC      -------------------MKLSLSPPPYADAPVVVLISGLGGSGSYWLPQLAVLEQE-Y
RUTD_SHIDS      -------------------MKLSLSPPPYADAPVVVLISGLGGSGSYWLPQLAVLEQE-Y
RUTD_ECO55      -------------------MKLSLSPPPYADAPVVVLISGLGGSGSYWLPQLAVLEQE-Y
RUTD_SHISS      -------------------MKLSLSPPPYADAPVVVLISGLGGSGSYWLPQLAVLEQE-Y
RUTD_ECODH      -------------------MKLSLSPPPYADAPVVVLISGLGGSGSYWLPQLAVLEQE-Y
RUTD_ECOLI      -------------------MKLSLSPPPYADAPVVVLISGLGGSGSYWLPQLAVLEQE-Y
RUTD_ECOD1      -------------------MKLSLSPPPYADAPVVVLISGLGGSGSYWLPQLAVLEQE-Y
RUTD_ECOBW      -------------------MKLSLSPPPYADAPVVVLISGLGGSGSYWLPQLAVLEQE-Y
RUTD_ECOBR      -------------------MKLSLSPPPYADAPVVVLISGLGGSGSYWLPQLAVLEQE-Y
RUTD_ECOSE      -------------------MKLSLSPPPYADAPVVVLISGLGGSGSYWLPQLAVLEQE-Y
RUTD_ECOBD      -------------------MKLSLSPPPYADAPVVVLISGLGGSGSYWLPQLAVLEQE-Y
RUTD_ECO10      -------------------MKLSLSPPPYADAPVVVLISGLGGSGSYWLQQLAVLEQE-Y
RUTD_ECO8A      -------------------MKLSLSPPPYADAPVVVLISGLGGSGSYWLPQLAVLEQE-Y
RUTD_ECO1A      -------------------MKLSLSPPPYADAPVVVLISGLGGSGSYWLPQLAVLEQE-Y
RUTD_ECO26      -------------------MKLSLSPPPYADTPVVVLISGLGGSGSYWLPQLAVLEQE-Y
RUTD_ENTCC      -------------------MKLSVSPPPFDGAPVVVLIAGLGGGGSYWLPQLAALEQE-Y
RUTD_ENT38      -------------------MKISLSPPPFADAPVVVLIAGLGGSGSYWLPQLAALEQE-Y
RUTD_ACIAD      -------------------MNYQLFKHSDENASYVVFSSGLGGHGSFWQAQLDVFRQY-F
                                       .          ::: .*:** . ::  :   :     

RUTD_PSE14      DVLVYDHAGTGRSPADLPAD-YSIRHMAMELLTLLDSLGIQRCHFMGHALGGLVGLEIAL
RUTD_PSEU2      HVLVYDHAGTGRSPAVLPAD-YSIRHMAIELLALLDSLDIQRCHFMGHALGGLVGLELAL
RUTD_PSEU5      RVLVYDQLGTNKSPANLPAG-YSIESMAVELLELLDTLGIRRCHFIGHALGGLVGLQIAL
RUTD_AGRRK      RIVTYDHRGTGRTGGDVPDT-GGISAMADDVLEIAARLQLDRFDFMGHALGGLIGLDIAL
RUTD_AGRFC      RIVTYDHRGTGRTGGEVPTE-GGISAMADDVLEIVSALNLEKFHFMGHALGGLIGLDIAL
RUTD_METED      RVVTYDHRGTGRSPGPLEPG-HDIAAMARDVLDLLDHLGIGTADIVGHALGGLIALQLAL
RUTD_METEP      RVVTYDHRGTGRSPGPLEPG-HDIAAMARDVLDLLDLLDIGTADIVGHALGGLIALQLAL
RUTD_METC4      RVVTYDHRGTGRSPSPLEPG-HDIAAMARDVLALLDHLGIGTADIVGHALGGLIALQLAL
RUTD_METEA      RVVTYDHRGTGRSPGPLEPG-HDIAAMARDVLDLLDHLDIGTADIVGHALGGLIALQLAL
RUTD_METPB      RVVTYDHRGTGRSPGPLEPG-HDIAAMARDVLALLDHLGIGTTDIVGHALGGLIALHLAL
RUTD_METRJ      RVVTYDHRGTGRSPGRLAPD-HDVPAMARDARAVLDAAGIERADVVGHALGGLIALQMAL
RUTD_AZOC5      QVILYDHAGTGRSGRDIGP--RSITEMARDMARVLDAAGVEDAHVAGHAIGGIIGMELAL
RUTD_CAUVN      PVVTYDHRGTGRSVRELPPR-YTLAHMADDMVKVMDALGLAKAHVVGHAAGGNAGLQLAL
RUTD_CAUVC      PVVTYDHRGTGRSVRELPPR-YTLAHMADDMVKVMDALGLAKAHVVGHAAGGNAGLQLAL
RUTD_CAUST      PVVTYDHRGTGRSVRALPPGPYSVDDMAQDMVKVMDALGLTKAHVVGHAAGGNAGLALAL
RUTD_CAUSK      RVVLYDHRGTGRSARTLTDP-HTVAAMGDDIVKLMDALGLERAHVVGHAAGGNAGLALAL
RUTD_VARPS      RVIAYDQRGTGRSPAALDAG-YAIADMARDVVQILDATATPRCHLVGHALGGLVGLQLAL
RUTD_SERP5      RVVVYDHFGTARSKGSVPDG-YSMADMADEVAQLLRSLNVDCCYFVGHALGGMIGLQLAL
RUTD_YERE8      RVITYDQYGTGRSAGVIPSG-YTLADMADELADLLASQHIERYHFVGHALGGMIGLQLAL
RUTD_PANAM      RVVVYDQYGTGASQGSVPAG-YRMEDMADELAGLLNALNISRCHLVGHALGGIMGLHLAL
RUTD_CROTZ      QVVVYDQRGTGDNADTLPEG-YTLTDMAQELHRALALHGVQRYAVLGHALGGLVGLELAL
RUTD_CROS8      QVVVYDQRGTGDNADTLPEG-YTLADMAQELHRALLIHGVHRYAVLGHALGGLVGLELAL
RUTD_KLEP3      QLVSYDHNGTGENAGPLPAD-YSMATMAQELLSALQAAGITRFALVGHALGALIGLQLAL
RUTD_KLEVT      QLVSYDHNGTGENAGPLPAD-YSMATMAQELLSALQAAGITRFALVGHALGALIGLQLAL
RUTD_KLEP7      QLVSYDHNGTGENAGPLPAG-YSLATMAGELFSALQAAGIARFALVGHALGALIGLQLAL
RUTD_ECO44      QVICYDQRGTGNNPDTLEED-YSIAQMAAELHQALVAAGIERYAVVGHALGALVGMQLAL
RUTD_ECOSM      QVVCYDQRGTGNNPDTLAED-YSIAQMAAELHQALVAAGIERYAVVGHALGALVGMQLAL
RUTD_ECOLU      QVVCYDQRGTGNNPDTLAED-YSIAQMAAELHQALVAAGIKRYAVVGHALGALVGMQLAL
RUTD_ECO81      QVVCYDQRGTGNNPDTLAED-YSIAQMAAELHQALVAAGIERYAVIGHALGALVGMQLAL
RUTD_ECOL6      QVVCYDQRGTGNNPDTLAED-YSIAQMAAELHQALVAAGIERYAVVGHALGALVGMQLAL
RUTD_ECOL5      QVVCYDQRGTGNNPDTLAED-YSIAQMAAELHQALVAAGIERYAVVGHALGALVGMQLAL
RUTD_ECO27      QVVCYDQRGTGNNPDTLAED-YSIAQMAAELHQALVAAGIERYAVVGHALGALVGMQLAL
RUTD_ECOS5      QVVCYDQRGTGNNPDTLAED-YSIAQMAAELHQALVAAGIERYAVVGHALGALVGMQLAL
RUTD_ECOK1      QVVCYDQRGTGNNPDTLAED-YSIAQMAAELHQALVAAGIERYAVVGHALGALVGMQLAL
RUTD_ECOUT      QVVCYDQRGTGNNPDTLAED-YSIAQMAAELHQALVAAGIERYAVVGHALGALVGMQLAL
RUTD_ECOKI      QVVCYDQRGTGNNPDTLAED-YSIAQMAAELHQALVAAGIERYAVVGHALGALVGMQLAL
RUTD_ECO45      QVVCYDQRGTGNNPDTLAED-YSIAQMAAELHQALVAAGIERYAVVGHALGALVGMQLAL
RUTD_ECO7I      QVVCYDQRGTGNNPDTLAED-YSIAQMAAELHQALVAAGIERYAVVGHALGALVGMQLAL
RUTD_SHIF8      QVVCYDQRGTGNNPDTLAED-YSIAQMAAELHQALVAAGIERYAVVGHALGALVGMQLAL
RUTD_SHIFL      QVVCYDQRGTGNNPDTLAED-YSIAQMAAELHQALVAAGIERYAVVGHALGALVGMQLAL
RUTD_SHIF2      QVVCYDQRGTGNNPDTLAED-YSIAQMAAELHQALVAAGIERYAVVGHALGALVGMQLAL
RUTD_ECO57      QVVCYDQRGTGNNPDTLAED-YSITQMAAELHQALVAAGIEHYAVVGHALGALVGMQLAL
RUTD_ECOCB      QVVCYDQRGTGNNPDTLAED-YSITQMAAELHQALVAAGIEHYAVVGHALGALVGMQLAL
RUTD_ECO5E      QVVCYDQRGTGNNPDTLAED-YSITQMAAELHQALVAAGIEHYAVVGHALGALVGMQLAL
RUTD_ECO5T      QVVCYDQRGTGNNPDTLAED-YSITQMAAELHQALVAAGIEHYAVVGHALGALVGMQLAL
RUTD_ECO24      QVVCYDQRGTGNNPDTLAED-YSITQMAAELHQALVAAGIERYAVVGHALGALVGMQLAL
RUTD_ECOHS      QVVCYDQRGTGNNPDTLAED-YSIAQMAAELHQVLVAAGIEHYAVVGHALGALVGMQLAL
RUTD_ECOLC      QVVCYDQRGTGNNPDTLAED-YSIAQMAAELHQVLVAAGIEHYAVVGHALGALVGMQLAL
RUTD_SHIDS      QVVCYDQRGTGNNPDTLAED-YSIAQMAAELHQALVAAGIEHYAVVGHALGALVGMQLAL
RUTD_ECO55      QVVCYDQRGTGNNPDTLAED-YSIAQMAAELHQALVAAGIEHYAVVGHALGALVGMQLAL
RUTD_SHISS      QVVCYDQRGTGNNPDTLAED-YSIAQMAAELHQALVAAGIEHYAVVGHALGALVGMQLAL
RUTD_ECODH      QVVCYDQRGTGNNPDTLAED-YSIAQMAAELHQALVAAGIEHYAVVGHALGALVGMQLAL
RUTD_ECOLI      QVVCYDQRGTGNNPDTLAED-YSIAQMAAELHQALVAAGIEHYAVVGHALGALVGMQLAL
RUTD_ECOD1      QVVCYDQRGTGNNPDTLAED-YSIAQMAAELHQALVAAGIEHYAVVGHALGALVGMQLAL
RUTD_ECOBW      QVVCYDQRGTGNNPDTLAED-YSIAQMAAELHQALVAAGIEHYAVVGHALGALVGMQLAL
RUTD_ECOBR      QVVCYDQRGTGNNPDTLAED-YSIAQMAAELHQALVAAGIEHYAVVGHALGALVGMQLAL
RUTD_ECOSE      QVVCYDQRGTGNNPDTLAED-YSIAQMAAELHQALVAAGIEHYAVVGHALGALVGMQLAL
RUTD_ECOBD      QVVCYDQRGTGNNPDTLAED-YSIAQMAAELHQALVAAGIEHYAVVGHALGALVGMQLAL
RUTD_ECO10      QVVCYDQRGTGNNPDTLAED-YSIAQMAAELHQALVAAGIEHYAVVGHALGALVGMQLAL
RUTD_ECO8A      QVVCYDQRGTGNNPDTLAED-YSIAQMAAELHQALVAAGIEHYAVVGHALGALVGMQLAL
RUTD_ECO1A      QVVCYDQRGTGNNPDTLAED-YSIAQMAAELHQALVAAGIEHYAVVGHALGALVGMQLAL
RUTD_ECO26      QVVCYDQRGTGNNPDTLAED-YSIAQMAAELHQALVAAGIEHYAVVGHALGALVGMQLAL
RUTD_ENTCC      QVVCYDQRGTGNNPDTLPEE-YTLAQMAGELAQALTAVGITRYCVVGHALGALIGLQLAL
RUTD_ENT38      QVVCYDQRGTGNNAGELPHG-YTLGNMADELYQALLNAGIPRFTVIGHALGALVGLQLAI
RUTD_ACIAD      HVLIYDQEGCHASSELLADG-YSFEHLALQVKQLLQQLNIVRFHFIGHALGGFIGIELAH
                 :: **: *   .   :      .  :. :              . *** *.  .: :* 

RUTD_PSE14      LRPE---LLQSQVLINAWSSPNPHSARCFSVRKKLLLNSGPDAYVQAQALFLYPADWIAA
RUTD_PSEU2      LRPE---LLHSQVLINAWSSPNPHSARCFSVRKKLLLNSGPEAYVQAQALFLYPADWIAA
RUTD_PSEU5      LRPQ---LLQSLVPINAWSSPNPHSARCFAVRLKLLHDSGPAAYVQAQSLFLYPADWIAA
RUTD_AGRRK      RRPE---LIGKLILINAWSKADPHSGRCFDIRIELLERSGVEAFVKAQPLFLYPAVWMSE
RUTD_AGRFC      RQPR---LIDRLVLINAWSKADPHSGRCFDVRIELLEKSGVDAFVKAQPLFLYPAAWMSE
RUTD_METED      THPE---RVGRIVVINGWAVMDPATRRCFAARKALLRHAGPEAFVRAQAIFLYPAPWLSE
RUTD_METEP      THPE---RVGRIVVINGWAVMDLATRRCFAARKALLRHAGPEAFVRAQAIFLYPAPWLSE
RUTD_METC4      THPE---RVGRIVVINGWAAMDPATRRCFAARKALLRHAGPEAFVRAQAIFLYPAPWLSE
RUTD_METEA      THPE---RVGRIVVINGWAAMDPATRRCFAARKALLRHAGPEAFVRAQAIFLYPAPWLSE
RUTD_METPB      THPE---RVERIVVINGWAVMDPATRRCFSARKALLTQAGPEAFVRAQAIFLYPAPWLSE
RUTD_METRJ      DAPD---RVGRVVVINGWDALDPATRRCFAARRAILAGGGPEAFVRAQAIFLYPAAWLSA
RUTD_AZOC5      AAPE---RVRSLTIVNGWARADGFLRRCFEVRKRILLASGPEAYVRAQPLFLYPPRWIAE
RUTD_CAUVN      DHPD---RLAKLVVVNGWSRPDPHIRRCFDTRLHLLNDTGPEAYVHAQPIFLYPADWISR
RUTD_CAUVC      DHPD---RLAKLVVVNGWSRPDPHIRRCFDTRLHLLNDTGPEAYVHAQPIFLYPADWISR
RUTD_CAUST      NHPD---RLGKLVVVNGWSRPDPHIQRCFDTRIHLLNDTGIKAYVHAQPIFLYPADWISR
RUTD_CAUSK      NHPD---RLDKLVVVNGWSRPDPHIKRCFDTRLALLNDTGIAAYVHAQPLFLYPADWLSA
RUTD_VARPS      DEPA---RVASLVLVNAWSKPNAHSARCFDARLALLDACGPRAYVEAQPIFLYPAAWCAE
RUTD_SERP5      THPQ---LVEKLVVVNGWPTLDSQTRRCFKVRQDLLLNSGVEAYVRAQPLFLFPADWLSQ
RUTD_YERE8      SHPQ---CVERLVAINSWPVLDSQTRRCFHVRQDLLLNSGVAAYVRAQPLFLYPADWLSR
RUTD_PANAM      RYPA---LLQSLVVINGWTVLNSQTRRCFDVRRNLLLNSGVDAYVQAQPLFLYPGDWLSE
RUTD_CROTZ      AYPR---AVSALVIINGWLSLGTWTRRCFDARERLLLDSGPAVYVAAQPLFLYPPQWAQE
RUTD_CROS8      AFPE---AVSALVIVNGWLSLSAWTRRCFEARERLLLDSGPAAYIAAQPLFLYPPSWAQE
RUTD_KLEP3      DRPE---AVSALVLVNGWLTLSPHTRRCFLVRERLLHAGGAQAWVEAQPLFLYPAEWMAA
RUTD_KLEVT      DRPE---AVSALVLVNGWLTLSPHTRRCFLVRERLLHAGGAQAWVEAQPLFLYPAEWMAA
RUTD_KLEP7      DRPE---AVSALALVNGWLSLSPHTRRCFQVRERLLHAGGAQAWVEAQPLFLYPAEWMAA
RUTD_ECO44      DYPA---SLTVLVSVNGWLRINAHTRRCFQVREQLLHSGGAQAWVEAQPLFLYPADWMAA
RUTD_ECOSM      DYPA---SVTVLVSVNGWLRINAHTRRCFQVREQLLHSGGAQAWVEAQPLFLYPADWMAA
RUTD_ECOLU      DYPA---SVTMLVSVNGWLRINAHTRRCFQVREQLLHSGGAQAWVEAQPLFLYPADWMAA
RUTD_ECO81      DYPA---SVTVLVSVNGWLRINAHTRRCFQVREQLLHSGGAQAWVEAQPLFLYPADWMAA
RUTD_ECOL6      DYPA---SVTVLVSVNGWLRINAHTRRCFQVREQLLHSGGAQAWVEAQPLFLYPADWMAA
RUTD_ECOL5      DYPA---SVTVLVSVNGWLRINAHTRRCFQVREQLLHSGGAQAWVEAQPLFLYPADWMAA
RUTD_ECO27      DYPA---SVTVLVSVNGWLRINAHTRRCFQVREQLLHSGGAQAWVEALPLFLYPADWMAA
RUTD_ECOS5      DYPA---SVTVLVSVNGWLRINTHTRRCFQVREQLLHSGGAQAWVEAQPLFLYPADWMAA
RUTD_ECOK1      DYPA---SVTVLVSVNGWLRINAHTRRCFQVREQLLHSGGAQAWVEAQPLFLYPADWMAA
RUTD_ECOUT      DYPA---SVTVLVSVNGWLRINAHTRRCFQVREQLLHSGGAQAWVEAQPLFLYPADWMAA
RUTD_ECOKI      DYPA---SVTVLVSVNGWLRINAHTRRCFQVREQLLHSGGAQAWVEAQPLFLYPADWMAA
RUTD_ECO45      DYPA---SVTVLVSVNGWLRINAHTRRCFQVREQLLHSGGAQAWVEAQPLFLYPADWMAA
RUTD_ECO7I      DYPA---SVTVLVSVNGWLRINAHTRRCFQVREQLLHSGGAQAWVAAQPLFLYPADWMAA
RUTD_SHIF8      DYPA---SVTMLVSVNGWLRINAHTRRCFQVRERLLYSGGAQAWVEAQPLFLYPADWMAA
RUTD_SHIFL      DYPA---SVTMLVSVNGWLRINAHTRRCFQVRERLLYSGGAQAWVEAQPLFLYPADWMAA
RUTD_SHIF2      DYPA---SVTMLVSVNGWLRINAHTRRCFQVRERLLYSGGAQAWVEAQPLFLYPADWMAA
RUTD_ECO57      DHPA---SVTVLVCVNGWLRINAHTRRCFQVRERLLYSGGAQAWVEAQPLFLYPADWMAA
RUTD_ECOCB      DHPA---SVTVLVCVNGWLRINAHTRRCFQVRERLLYSGGAQAWVEAQPLFLYPADWMAA
RUTD_ECO5E      DHPA---SVTVLVCVNGWLRINAHTRRCFQVRERLLYSGGAQAWVEAQPLFLYPADWMAA
RUTD_ECO5T      DHPA---SVTVLVCVNGWLRINAHTRRCFQVRERLLYSGGAQAWVEAQPLFLYPADWMAA
RUTD_ECO24      DYPA---SVTVLISVNGWLRINAHTRRCFQVRERLLYSGGAQAWVEAQPLFLYPADWMAA
RUTD_ECOHS      DYPA---SVTVLVSVNGWLRINAHTRRCFQVRERLLYSGGAQAWVEAQPLFLYPADWMAA
RUTD_ECOLC      DYPA---SVTVLVSVNGWLRINAHTRRCFQVRERLLYSGGAQAWVEAQPLFLYPADWMAA
RUTD_SHIDS      DYPA---SVTVLVSVNGWLRINAHTRRCFQVRERLLYSGGAQAWVEAQPLFLYPADWMAA
RUTD_ECO55      DYPA---SVTVLISVNGWLRINAHTRRCFQVRERLLYSGGAQAWVEAQPLFLYPADWMAA
RUTD_SHISS      DYPA---SVTVLISVNGWLRINAHTRRCFQVRERLLYSGGAQAWVEAQPLFLYPADWMAA
RUTD_ECODH      DYPA---SVTVLISVNGWLRINAHTRRCFQVRERLLYSGGAQAWVEAQPLFLYPADWMAA
RUTD_ECOLI      DYPA---SVTVLISVNGWLRINAHTRRCFQVRERLLYSGGAQAWVEAQPLFLYPADWMAA
RUTD_ECOD1      DYPA---SVTVLISVNGWLRINAHTRRCFQVRERLLYSGGAQAWVEAQPLFLYPADWMAA
RUTD_ECOBW      DYPA---SVTVLISVNGWLRINAHTRRCFQVRERLLYSGGAQAWVEAQPLFLYPADWMAA
RUTD_ECOBR      DYPA---SVTVLISVNGWLRINAHTRRCFQVRERLLYSGGAQAWVEAQPLFLYPADWMAA
RUTD_ECOSE      DYPA---SVTVLISVNGWLRINAHTRRCFQVRERLLYSGGAQAWVEAQPLFLYPADWMAA
RUTD_ECOBD      DYPA---SVTVLISVNGWLRINAHTRRCFQVRERLLYSGGAQAWVEAQPLFLYPADWMAA
RUTD_ECO10      DYPA---SVTVLISVNGWLRINAHTRRCFQVRERLLYSGGAQAWVEAQPLFLYPADWMAA
RUTD_ECO8A      DYPA---SVTVLISVNGWLRINAHTRRCFQVRERLLYSGGAQAWVEAQPLFLYPADWMAA
RUTD_ECO1A      DYPA---SVTVLISVNGWLRINAHTRRCFQVRERLLYSGGAQAWVEAQPLFLYPADWMAA
RUTD_ECO26      DYPA---SVTVLISVNGWLRINAHTRRCFQVRERLLYSGGAQAWVEAQPLFLYPADWMAA
RUTD_ENTCC      DTPD---ALKALVCVNGWLTLNAHTRRCFQIRERLLHAGGAQAWVEAQPLFLYPADWMAA
RUTD_ENT38      AHPD---AVRALVCVNGWLSLNAHTRRCFQIRERLLHAGGAQAWVEAQPLFLYPADWMAA
RUTD_ACIAD      RYASETCQLLSLTLINAWQQLDPHTLRCFTTRIALLQHAGTAAYLHAQALFLYPPLWISE
                  .     :     :*.*   .    ***  *  :*       ::   .::*:*  *   

RUTD_PSE14      NGARLADDEAHALAHFPGTDNLLRRIHALQTFDVEAS--LARIQTPTLLIANRDDMLVPW
RUTD_PSEU2      NGPRLADDEAHALAHFPDTDNLLRRIHALETFDVSAE--LSRIHTPTLLIANRDDMLVPW
RUTD_PSEU5      NSERLARDDAHALAHFPPTMNLVRRIEALLAFDIEAE--LPRITTPTLLIANRDDMLVPW
RUTD_AGRRK      NAERMAADERHGVAHFQGKANVLKRIAALRAFDIDDR--LSEIRTPTLVVGTRDDLLVPY
RUTD_AGRFC      HQERLARDDAHGVAHFQGKTNVLRRIAALRAFDIDAR--LGEIGNPVLVVATKDDLLVPY
RUTD_METED      NAARVANDEAQALAHFPGEETVLARISALEAFDGTAA--LARIPHETLLMAARDDVLVPF
RUTD_METEP      NAARVADDEAQALAHFPGEETVLARIAALETFDATGA--LPRIPHETLLMAARDDVLVPY
RUTD_METC4      NAARVAADEAQALAHFPGTRTALARITALETFDATAA--LGRIPHETLLMAARDDVLVPF
RUTD_METEA      NAARLADDEAQALAHFAGTRTVLTRIAALETFDATAA--LGRIPHETLLMAARDDVLVPF
RUTD_METPB      NAARVADDEAQALAHFPGAKTVLARIAALEAFDATAA--LARIPHETLLMAARDDVLVPF
RUTD_METRJ      QAERVEADEAQALAHFPGAETVLTRIAALEGFAIADR--LGAIGHETLVMAARDDVLVPY
RUTD_AZOC5      NIAVLEEEEAQMVAHFPGTQTMLNRIETFLAFDGRER--LADIRVPTLLAAAKDDALVPS
RUTD_CAUVN      NHTRLMAEEAHHVAAFPPREVMLARINALLAFDIDAR--LEDITHRVLISASADDMLVPM
RUTD_CAUVC      NHTRLMAEEAHHVAAFPPREVMLARINALLAFDIDAR--LEDITHRVLISASADDMLVPM
RUTD_CAUST      NHARLMAEEAHHVAGFPPREVMLARINALLAFDIDAR--LEEIPHRVLVSASADDMLVPM
RUTD_CAUSK      NNARLEAEEVHHINGFPSPDVMRTRIQALLEFDIDED--LETIRCPVLVSASADDMLVPL
RUTD_VARPS      HAQRVADEVDHAFAHFPGEANMRARIGALRAFDIDAR--LGAITAPTLVAAAMDDALVPW
RUTD_SERP5      HSALLDEELQHQTAHFQGTENLLRRLTALMNTDFRPH--LADITTPTLALCSRDDLLVPY
RUTD_YERE8      NTLLLEQEEVQQIAHFQGMENLLRRLNALMNADFRSV--LPHITTPTLALCATDDLLVPY
RUTD_PANAM      HEAFLQEERQHQVANFQGMENLLHRLQALMDSDLTTS--LKGVIAPTLALSAKDDLLVPW
RUTD_CROTZ      NQPRLEAEEALQNAHFQGTENLLRRLWALKTADYRER--AARVTTPVQLICARDDVLVPW
RUTD_CROS8      NQPRLEAEEALHNAHFQGTENLLRRLWALKNADYRER--AARVITPVQIICARDDMLVPW
RUTD_KLEP3      RLPRLEAEDALAISHFQGKENLLKRLQALKQADFSRR--AAAIACPTLIVSAADDLLVPA
RUTD_KLEVT      RLPRLEAEDALAISHFQGKENLLKRLQALKQADFSRR--AAAIACPTLIVSAADDLLVPA
RUTD_KLEP7      RLPRLEAEDALAISHFQGKENLLKRLQALKQADFSRR--ASAIACPTLIISAADDLLVPA
RUTD_ECO44      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSRH--TDRIRCPVQIICASDDLLVPS
RUTD_ECOSM      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSRH--ADRIRCPVQIICASDDLLVPT
RUTD_ECOLU      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSHH--ADRIRCPVQIICASDDLLVPS
RUTD_ECO81      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSRH--ADRIRCPVQIICASDDLLVPS
RUTD_ECOL6      RAPRLEAEGALALAHFQGKNNLLRRLNALKRADFSRH--ADRIRCPVQIICASDDLLVPS
RUTD_ECOL5      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSRH--ADRIRCPVQIICASDDLLVPS
RUTD_ECO27      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSHH--ADRIRCPVQIICASDDLLVPT
RUTD_ECOS5      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSHH--ADRIRCPVQIICASDDLLVPT
RUTD_ECOK1      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSHH--ADRIRCPVQIICASDDLLVPT
RUTD_ECOUT      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSHH--ADRIRCPVQIICASDDLLVPT
RUTD_ECOKI      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSHH--ADRIRCPVQIICASDDLLVPT
RUTD_ECO45      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSHH--ADRIRCPVQIICASDDLLVPT
RUTD_ECO7I      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSHH--ADRIRCPVQIICASDDLLVPT
RUTD_SHIF8      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSHH--ADRIRRPVQIICASDDLLVPT
RUTD_SHIFL      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSHH--ADRIRCPVQIICASDDLLVPT
RUTD_SHIF2      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSHH--ADRIRCPVQIICASDDLLVPT
RUTD_ECO57      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSHH--ADRIRCPVQIICASDDLLVPS
RUTD_ECOCB      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSHH--ADRIRCPVQIICASDDLLVPS
RUTD_ECO5E      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSHH--ADRIRCPVQIICASDDLLVPS
RUTD_ECO5T      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSHH--ADRIRCPVQIICASDDLLVPS
RUTD_ECO24      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSHH--ADRIRCPVQIICASDDLLVPS
RUTD_ECOHS      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSHH--ADRIRCPVQIICASDDLLVPS
RUTD_ECOLC      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSHH--ADRIRCPVQIICASDDLLVPS
RUTD_SHIDS      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSHH--ADRIRCPVQIICASDDLLVPS
RUTD_ECO55      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSHH--ADRIRCPVQIICASDDLLVPS
RUTD_SHISS      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSHH--ADRIRCPVQIICASDDLLVPS
RUTD_ECODH      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSHH--ADRIRCPVQIICASDDLLVPT
RUTD_ECOLI      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSHH--ADRIRCPVQIICASDDLLVPT
RUTD_ECOD1      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSHH--ADRIRCPVQIICASDDLLVPT
RUTD_ECOBW      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSHH--ADRIRCPVQIICASDDLLVPT
RUTD_ECOBR      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSHH--ADRIRCPVQIICASDDLLVPT
RUTD_ECOSE      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSHH--ADRIRCPVQIICASDDLLVPT
RUTD_ECOBD      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSHH--ADRIRCPVQIICASDDLLVPT
RUTD_ECO10      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSHH--ADRIRCPVQIICASDDLLVPT
RUTD_ECO8A      RVPRLEAEDALALAHFQGKNNLLRRLNALKRADFSHH--ADRIRCPVQIICASDDLLVPT
RUTD_ECO1A      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSHH--ADRIRCPVQIICASDDLLVPS
RUTD_ECO26      RAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSHH--ADRIRCPVQIICASDDLLVPS
RUTD_ENTCC      RAPRLEAEEALALAHFQGKNNLLRRLNALKKADFSRH--AARMACPVHLICSADDLLVPS
RUTD_ENT38      RAPRMEAEEALALAHFQGTNNLQRRLLALKQADFRAQ--AKHVHCPVQIICSTDDLLVPS
RUTD_ACIAD      HTALLEQQEAKMQSDFPPHANVLKRLNALMQYQVNTARIDTLKQLPVCLIANQDDMLVPY
                .   :  :       *        *: ::                 .      ** *** 

RUTD_PSE14      QQSQHLAEALPNARLVLLEYGGHASNITDPLPFQRTLLDFLNAQT---------------
RUTD_PSEU2      QQSRHLANALPNATLVLLEYGGHASNITDPLPFQRALRAFLSTQP---------------
RUTD_PSEU5      QRSQHLADNMPNAQLALLNYGGHASSVSDSEPFNQILLDHLAEQCGQVAAA---------
RUTD_AGRRK      TRSVRLAEGLSAAELALSDFGAHAVNVVEPEEFNNKVLRFLRARSEVR------------
RUTD_AGRFC      TRSLRLAEGLPQSELCLLDFGAHAVNITEPDLFNTRLLQFLLPADQT-------------
RUTD_METED      TASDILAAGLPNARLDLAPEGGHAHSVTRSASFNRTLLDFLASP----------------
RUTD_METEP      TASDILAAGLPNARLDLAPEGGHAHSVTRPEAFNRTLLDFLASP----------------
RUTD_METC4      TASDVLAAGLPNARLDLAPEGGHAHSVTRPEAFNRTLLDFLASP----------------
RUTD_METEA      TASDILAAGLPNARLDLAPEGGHAHSATRPEAFNRTLLDFLTSP----------------
RUTD_METPB      TASDALAAGLPNARLDLAPEGGHAHSVTRPDAFNRTLLDFLASP----------------
RUTD_METRJ      TRSERLAAALPNARLALAPEGGHAHSVTRPEAFNRALLDFLDRD----------------
RUTD_AZOC5      YLSTLLAEGIPDARIAEVDWGAHAFSAVTPDVFNEMLLGFCGEIDQ--------------
RUTD_CAUVN      SCSQRLAGRLPNADFQQVAWGGHGFTVTDPETFNEALVSFLEGA----------------
RUTD_CAUVC      SCSQRLAGRLPNADFQQVAWGGHGFTVTDPETFNEALVSFLEGA----------------
RUTD_CAUST      SCSQRLAARLPNADFQQVAWGGHGFTVTDPETFNEGLIKFLEGA----------------
RUTD_CAUSK      SCSRRLAERLPNATLDIAPWGGHGFTVTAPEAFNAAVLNFLSGEAA--------------
RUTD_VARPS      TCSQRLADGLKDVTLHFLPHGGHAHSVTEAAVFNRSLLDFLARVSAPGVPA---------
RUTD_SERP5      HCSHQLAASLPNGELAEMAYGGHAMSVTDTEHFNRILLGWLL-KTQNAQTRLQP------
RUTD_YERE8      PCSQALAELLPDGEWAQMSYGGHAMSVTNSEQFNGILLSYLLMDTGIAKCELALNQSNTS
RUTD_PANAM      SCSADLASRLPHGEHLQMGYGGHAMSVTDPDTFNPILLDWLQRQASHPSGTPSDFIPVEM
RUTD_CROTZ      TCSQALHEALPHSRLDVMTSGGHACNVTAPQRFNSLLYAGLAALTPAPHKETV-------
RUTD_CROS8      TCSQALHEALPHSRLDVMDFGGHACNVTAPQPFHSLLYAGLASLAPAPHKETV-------
RUTD_KLEP3      SCSRVLQAAIPGSQRVEMPWGGHACNVTDADTFNTILCDGLAAMLPVAREIR--------
RUTD_KLEVT      SCSRVLQAAIPGSQRVEMPWGGHACNVTDADTFNTILCDGLAAMLPVAREI---------
RUTD_KLEP7      SCSRVLQTAIPGSQLVEMPWGGHACNVTDADTFNTILRDGLSAMLPVARETR--------
RUTD_ECO44      ACSSELHAALPDSQKMVMRYGGHACNVTDPETFNALLLNGLASLLHHREAACKELL----
RUTD_ECOSM      ACSSELHAALPDSQKMVMRYGGHACNVTDPETFNALLLNGLASLLHHREAACKELL----
RUTD_ECOLU      ACSSELHAALPDSQKMVMRYGGHACNVTHPETFNALLLNGLASLLHHREAACKELL----
RUTD_ECO81      ACSSELHAALPDSQKMVMRYGGHACNVTAPETFNALLLNGLASLLHHREAAL--------
RUTD_ECOL6      ACSSELHAALPDSQKMVMRYGGHACNVTDPETFNALLLNGLASLLHHREAAL--------
RUTD_ECOL5      ACSSELHAALPDSQKMVMRYGGHACNVTDPETFNALLLNGLASLLHHREAAL--------
RUTD_ECO27      ACSSELHAALPDSQKMVMRYGGHACNVTDPETFNALLLNGLASLLHHREAAL--------
RUTD_ECOS5      ACSSELHAALPDSQKMVMRYGGHACNVTDPETFNALLLNGLASLLHHREAAL--------
RUTD_ECOK1      ACSSELHAALPDSQKMVMRYGGHACNVTDPETFNALLLNGLASLLHHREAAL--------
RUTD_ECOUT      ACSSELHAALPDSQKMVMRYGGHACNVTDPETFNALLLNGLASLLHHREAAL--------
RUTD_ECOKI      ACSSELHAALPDSQKMVMRYGGHACNVTDPETFNALLLNGLASLLHHREAAL--------
RUTD_ECO45      ACSSELHAALPDSQKMVMRYGGHACNVTDPETFNALLLNGLASLLHHREAAL--------
RUTD_ECO7I      ACSSELHAALPDSQKMVMRYGGHACNVTDPETFNALLLNGLASLLHHREAAL--------
RUTD_SHIF8      ACSSELHAALPDSQKMVMPYGGHACNVTDPETFNALLLNGLASLLHHREAAL--------
RUTD_SHIFL      ACSSELHAALPDSQKMVMPYGGHACNVTDPETFNALLLNGLASLLHHREAAL--------
RUTD_SHIF2      ACSSELHAALPDSQKMVMPYGGHACNVTDPETFNALLLNGLASLLHHREAAL--------
RUTD_ECO57      ACSSELHAALPDSQKMVMRYGGHACNVTDPETFNALLLNGLASLLHHREAAL--------
RUTD_ECOCB      ACSSELHAALPDSQKMVMRYGGHACNVTDPETFNALLLNGLASLLHHREAAL--------
RUTD_ECO5E      ACSSELHAALPDSQKMVMRYGGHACNVTDPETFNALLLNGLASLLHHREAAL--------
RUTD_ECO5T      ACSSELHAALPDSQKMVMRYGGHACNVTDPETFNALLLNGLASLLHHREAAL--------
RUTD_ECO24      ACSSELHAALPDSQKMVMRYGGHACNVTDPETFNALLLNGLASLLHHREAAL--------
RUTD_ECOHS      ACSSELHAALPDSQKMVMRYGGHACNVTDPETFNALLLNGLASLLHHREAAL--------
RUTD_ECOLC      ACSSELHAALPDSQKMVMRYGGHACNVTDPETFNALLLNGLASLLHHREAAL--------
RUTD_SHIDS      ACSSELHAAL--------------------------------------------------
RUTD_ECO55      ACSSELHAALPDSQKMVMRYGGHACNVTDPETFNALLLNGLASLLHHREAAL--------
RUTD_SHISS      ACSSELHAALPDSQKMVMRYGGHACNVTDPETFNALLLNGLASLLHHREAAL--------
RUTD_ECODH      ACSSELHAALPDSQKMVMPYGGHACNVTDPETFNALLLNGLASLLHHREAAL--------
RUTD_ECOLI      ACSSELHAALPDSQKMVMPYGGHACNVTDPETFNALLLNGLASLLHHREAAL--------
RUTD_ECOD1      ACSSELHAALPDSQKMVMPYGGHACNVTDPETFNALLLNGLASLLHHREAAL--------
RUTD_ECOBW      ACSSELHAALPDSQKMVMPYGGHACNVTDPETFNALLLNGLASLLHHREAAL--------
RUTD_ECOBR      ACSSELHAALPDSQKMVMPYGGHACNVTDPETFNALLLNGLASLLHHREAAL--------
RUTD_ECOSE      ACSSELHAALPDSQKMVMPYGGHACNVTDPETFNALLLNGLASLLHHREAAL--------
RUTD_ECOBD      ACSSELHAALPDSQKMVMPYGGHACNVTDPETFNALLLNGLASLLHHREAAL--------
RUTD_ECO10      ACSSELHAALPDSQKMVMPYGGHACNVTDPETFNALLLNGLASLLHHREAAL--------
RUTD_ECO8A      ACSSELHAALPDSQKMVMPYGGHACNVTDPETFNALLLNGLASLLHHREAAL--------
RUTD_ECO1A      ACSSELHAALPDSQKMVMPYGGHACNVTDPETFNALLLNGLASLLHHREAAL--------
RUTD_ECO26      ACSSELHAALPDSQKMVMPYGGHACNVTDPETFNALLLNGLASLLHHREAAL--------
RUTD_ENTCC      VCSSELQAALPHSHSVVMRQGGHACNVTEPETFNTLLLNGLASLLHSHEPAL--------
RUTD_ENT38      VCSTELHAALPGSHKTVMRQGGHACNVTDPDTFNALLLNGLASLMHNPEPVFKESQ----
RUTD_ACIAD      VQSLNLWKKLPDAQLKLLPYGGHASTVTEARQVNQLMLDFLKTSAPT-------------
                  *  *   :                                                  

RUTD_PSE14      ----
RUTD_PSEU2      ----
RUTD_PSEU5      ----
RUTD_AGRRK      ----
RUTD_AGRFC      ----
RUTD_METED      ----
RUTD_METEP      ----
RUTD_METC4      ----
RUTD_METEA      ----
RUTD_METPB      ----
RUTD_METRJ      ----
RUTD_AZOC5      ----
RUTD_CAUVN      ----
RUTD_CAUVC      ----
RUTD_CAUST      ----
RUTD_CAUSK      ----
RUTD_VARPS      ----
RUTD_SERP5      ----
RUTD_YERE8      AIHL
RUTD_PANAM      P---
RUTD_CROTZ      ----
RUTD_CROS8      ----
RUTD_KLEP3      ----
RUTD_KLEVT      ----
RUTD_KLEP7      ----
RUTD_ECO44      ----
RUTD_ECOSM      ----
RUTD_ECOLU      ----
RUTD_ECO81      ----
RUTD_ECOL6      ----
RUTD_ECOL5      ----
RUTD_ECO27      ----
RUTD_ECOS5      ----
RUTD_ECOK1      ----
RUTD_ECOUT      ----
RUTD_ECOKI      ----
RUTD_ECO45      ----
RUTD_ECO7I      ----
RUTD_SHIF8      ----
RUTD_SHIFL      ----
RUTD_SHIF2      ----
RUTD_ECO57      ----
RUTD_ECOCB      ----
RUTD_ECO5E      ----
RUTD_ECO5T      ----
RUTD_ECO24      ----
RUTD_ECOHS      ----
RUTD_ECOLC      ----
RUTD_SHIDS      ----
RUTD_ECO55      ----
RUTD_SHISS      ----
RUTD_ECODH      ----
RUTD_ECOLI      ----
RUTD_ECOD1      ----
RUTD_ECOBW      ----
RUTD_ECOBR      ----
RUTD_ECOSE      ----
RUTD_ECOBD      ----
RUTD_ECO10      ----
RUTD_ECO8A      ----
RUTD_ECO1A      ----
RUTD_ECO26      ----
RUTD_ENTCC      ----
RUTD_ENT38      ----
RUTD_ACIAD      ----