CLUSTAL format seed alignment for MF_00833

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RUTF2_AGRRK      ----------------------------MQAPSLTVTAPASP-SPDE-RKQEYRDAMARL
RUTF_AGRFC       ----------------------------MQMMSLEKEAAMET-KTAEQRSLDYRNAMARL
RUTF1_AGRRK      MRLLEMRGLTWYVACIQISARHAGTMGMNMKTSVAIEKAIPV-ADPDVVRAEFRNAMARM
RUTF_VARPS       ----------------------------MLPNAMASNHVMPSGAPPVLPKADYRNAMARL
RUTF_ECOK1       -----------------MAIPANFLRACHVCPLKKPAGCCKEQTMNIVDQQTFRDAMSCM
RUTF_ECOUT       -----------------MAIPANFLRACHVCPLKKPAGCCKEQTMNIVDQQTFRDAMSCM
RUTF_ECOKI       --------------------------------------------MNIVDQQTFRDAMSCM
RUTF_ECO45       --------------------------------------------MNIVDQQTFRDAMSCM
RUTF_ECOBR       --------------------------------------------MNIVDQQTFRDAMSCM
RUTF_ECO24       --------------------------------------------MNIVDQQTFRDAMSCM
RUTF_ECOLU       --------------------------------------------MNIVDQQTFRDAMSCM
RUTF_ECO7I       --------------------------------------------MNIVDQQTFRDAMSCM
RUTF_ECO5E       --------------------------------------------MNIVDQQTFRDAMSCM
RUTF_ECO5T       --------------------------------------------MNIVDQQTFRDAMSCM
RUTF_ECO57       --------------------------------------------MNIVDQQTFRDAMSCM
RUTF_ECOL5       --------------------------------------------MNIVDQQTFRDAMSCM
RUTF_ECOL6       ------------------------MRACHVCPLKKPAGCCKEQTMNIVDQQTFRDAMSCM
RUTF_ECO27       --------------------------------------------MNIVDQQTFRDAMSCM
RUTF_ECOS5       --------------------------------------------MNIVDQQTFRDAMSCM
RUTF_ECO10       --------------------------------------------MNIVDQQTFRDAMSCM
RUTF_ECOSM       --------------------------------------------MNIVDQQTFRDAMSCM
RUTF_ECOBD       --------------------------------------------MNIVDQQTFRDAMSCM
RUTF_ECO44       --------------------------------------------MNIVDQQTFRDAMSCM
RUTF_ECO81       --------------------------------------------MNIVDQQTFRDAMSCM
RUTF_ECO1A       --------------------------------------------MNIVDQQTFRDAMSCM
RUTF_ECOCB       --------------------------------------------MNIVDQQTFRDAMSCM
RUTF_ECO26       --------------------------------------------MNIVDQQTFRDAMSCM
RUTF_ECOLC       --------------------------------------------MNIVDQQTFRDAMSCM
RUTF_ECOHS       --------------------------------------------MNIVDQQTFRDAMSCM
RUTF_SHIDS       --------------------------------------------------------MSCM
RUTF_ECOLI       --------------------------------------------MNIVDQQTFRDAMSCM
RUTF_ECOBW       --------------------------------------------MNIVDQQTFRDAMSCM
RUTF_ECOD1       --------------------------------------------MNIVDQQTFRDAMSCM
RUTF_ECODH       --------------------------------------------MNIVDQQTFRDAMSCM
RUTF_ECO8A       --------------------------------------------MNIVDQQTFRDAMSCM
RUTF_ECO55       --------------------------------------------MNIVDQQTFRDAMSCM
RUTF_SHIF2       --------------------------------------------MNIVDQQTFRDAMSCM
RUTF_SHIF8       --------------------------------------------MNIVDQQTFRDAMSCM
RUTF_ECOSE       --------------------------------------------------------MSCM
RUTF_SHIFL       --------------------------------------------------------MSCM
RUTF_SHISS       --------------------------------------------------------MSCM
RUTF_ENT38       --------------------------------------------MSTLDVQTFRDAMACV
RUTF_ENTCC       --------------------------------------------MTTPDKQTFRDAMACV
RUTF_KLEP3       --------------------------------------------MELADKASFRDAMAHV
RUTF_KLEVT       --------------------------------------------MELADKASFRDAMAHV
RUTF_KLEP7       --------------------------------------------MELTDKASFRDAMAHV
RUTF_CROTZ       ----------------------------------------------MSEQQAFRDAMSRL
RUTF_CROS8       ----------------------------------------------MSEQQAFRDAMSRL
RUTF_SERP5       -----------------------MQSQTLLADT--------PLQSPYVEKQDFRDAMARL
RUTF_YERE8       -----------------------MQTQSLPTDSLPASS---ALRSVAVDKQDFRDAMARL
RUTF_PANAM       -------------------MTEDTSMQSTLNATLPETDMPLAEKEAAVEKQEYRNAMARL
RUTF_ACIAD       -------------------MTVLTQTTKHIESLLGQMKQIHRETFMQVDQQAFRQGMSNL
RUTF_PSE14       --------------------------------MHADSEALATLPADPVSQLAFRDAMSSL
RUTF_PSEU2       --------------------------------MPTSSATPAILPIAAVSQLAFRDAMSGL
RUTF_PSEU5       --------------------------------MQLAQCETTSQFSAPVIREDYRDAMARL
RUTF_BRADU       ----------------------------------------MRMRMQDVAPQDYRDAMACL
RUTF_STAND       ----------------------------MARSAPLDETNSGAAKAPAISREQYRDAMARL
RUTF_METEA       ------------------------------------MTESE-SAAVPVDAAAYREAMSRL
RUTF_METED       --------------------------------MTAFETESE-SAAVPVDAAAYREAMSRL
RUTF1_METC4      ------------------------------------MTESE-SAAVPVDAAAFREAMSRL
RUTF1_METEP      ------------------------------------MTDSESAAAVSVDAAAYREAMSRL
RUTF_METPB       ------------------------------------MTVSETESAVPVDASAYREAMSRL
RUTF2_METEP      ------------------------------------MISSD---PEAVSASAYREAMAQL
RUTF2_METC4      ------------------------------------MISSD---PEAVSASAYREAMAQL
                                                                         *: :

RUTF2_AGRRK      GAAVNIVTTDGPGGLAGFAATAVCSVTDSPPTLLVCLNRTSSAYPAVNANRVLCVNTLER
RUTF_AGRFC       GAAVNIVTTDGAAGRAGFAATAVCSVSDNPPTLLVCLNRNASAYKVVKANGVICINTLAA
RUTF1_AGRRK      AAAVNIVTTNGPAGLAGFAATAVCSVTDSPPTLLVCLNRSASVHPAVTENGVLCVNVLSE
RUTF_VARPS       GAAVNIITTDGPAGRAGFTASAVCSVTDEPPMLLVCLNRSASVYPAFTANGVLCVNVLAA
RUTF_ECOK1       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSA
RUTF_ECOUT       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSA
RUTF_ECOKI       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSA
RUTF_ECO45       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSA
RUTF_ECOBR       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSA
RUTF_ECO24       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSA
RUTF_ECOLU       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSA
RUTF_ECO7I       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSA
RUTF_ECO5E       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSA
RUTF_ECO5T       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSA
RUTF_ECO57       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSA
RUTF_ECOL5       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSA
RUTF_ECOL6       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSA
RUTF_ECO27       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSA
RUTF_ECOS5       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSA
RUTF_ECO10       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSA
RUTF_ECOSM       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSA
RUTF_ECOBD       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSA
RUTF_ECO44       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSA
RUTF_ECO81       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSA
RUTF_ECO1A       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSA
RUTF_ECOCB       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSA
RUTF_ECO26       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSA
RUTF_ECOLC       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSA
RUTF_ECOHS       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSA
RUTF_SHIDS       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSA
RUTF_ECOLI       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPAFNENRTLCVNTLSA
RUTF_ECOBW       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPAFNENRTLCVNTLSA
RUTF_ECOD1       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPAFNENRTLCVNTLSA
RUTF_ECODH       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPAFNENRTLCVNTLSA
RUTF_ECO8A       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSA
RUTF_ECO55       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSA
RUTF_SHIF2       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSA
RUTF_SHIF8       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSA
RUTF_ECOSE       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSA
RUTF_SHIFL       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSA
RUTF_SHISS       GAAVNIITTDGPSGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSA
RUTF_ENT38       GAAVNIITTDGPAGQAGFTASAVCSVTDSPPTLLVCLNRGASVWPTFNENRTLCVNTLSA
RUTF_ENTCC       GAAVNIITTDGPAGRAGFTASAVCSVTDSPPTLLVCLNRGASVWPTFSENRTLCVNTLSA
RUTF_KLEP3       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRSASVWPVFSEHHTLCVNTLAA
RUTF_KLEVT       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRSASVWPVFSEHHTLCVNTLAA
RUTF_KLEP7       GAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRSASVWPVFSEHHTLCVNTLAA
RUTF_CROTZ       GAAVNIVTTDGPAGMAGFTASAVCSVTDSPPTLLVCLNRNASVWPVFQANGQLCVNTLAA
RUTF_CROS8       GAAVNIVTTDGPAGMAGFTASAVCSVTDSPPTLLVCLNRNASVWPVFQANGQLCVNTLAA
RUTF_SERP5       GSAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRSASVYSVFKQNQTLCVNTLAA
RUTF_YERE8       GSAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRSASVYSVFQQNQTLCVNTLCA
RUTF_PANAM       GSAVNIITTDGPGGRAGFTASAVCSVTDTPPTLLVCLNRSASVHPAFIQNQVLCVNTLAD
RUTF_ACIAD       GAAVNVITTDGVAGKSGFTASAVCSVTDTPPTLLVCLNRSASVFETFKQNQVLCVNTLAA
RUTF_PSE14       AAAVNVITTDGPGGRAGFTATAVCSVTDQPPTLLVCINRSASVYETFIENGLLCVNTLGN
RUTF_PSEU2       AAAVNLITTDGPGGRAGFTATAVCSVTDQPPTLLVCINRSASVYDAFIENGTLCVNTLGN
RUTF_PSEU5       AAAVNIITTDGPSGRAGFTATAVCSVTDEPPTLLVCLNRSASAHPIVTANGQLCVNTLAG
RUTF_BRADU       GAAVNIVTTDGSAGRAGFTASAICSVTDDPPTLLVCINRGSSAYSSVTRNEVVCVNVLSA
RUTF_STAND       GAAVTIVTTDGPGGRAGFTASAVCSVTDSPPTLLVCLNKSSSAAHAVHANGVVCVNTLAA
RUTF_METEA       ASAVHLITTDGPGGRAGFTASAVCSVSDAPPTLLVCINRTSSAYAALTQNGTLCVNTLGE
RUTF_METED       ASAVHLITTDGPGGRAGFTASAVCSVSDAPPTLLVCINRASSAYAALTQNGTLCVNTLGE
RUTF1_METC4      ASAVHLITTDGPGGRAGFTASAVCSVSDAPPTLLVCINRASSAYAALTQNGTLCVNTLGE
RUTF1_METEP      ASAVHLITTDGPGGRAGFTASAVCSVSDAPPTLLVCINRASSAYAALTQNGTLCVNTLGE
RUTF_METPB       ASAVHLITTDGPGGRAGFTASAVCSVSDAPPTLLVCINRAASAYAPLIRNGTLCVNTLGG
RUTF2_METEP      ASAVHLVTTDGPGGRAGLTATSVCSVSDGPPTLLVCLNRNSSAYPAFLRNGVLCINTLTA
RUTF2_METC4      ASAVHLVTTDGPGGRAGLTATSVCSVSDGPPTLLVCLNRNSSAYPAFLRNGVLCINTLTA
                 .:** ::**:* .* :*::*:::***:* ** ****:*: :*.   .  :  :*:*.*  

RUTF2_AGRRK      GHEDLSRLFGGKTPVHERFEGASWSSLETGAPVLDDALISLDCRVKAISDGGTHDILICD
RUTF_AGRFC       HHEVLSTLFGGKTPAEERFAAGSWGVLETGAPVLEDALVSFDCRIREAHDGGTHDILICT
RUTF1_AGRRK      GHQDLSRLFGGKTPVAERFAAAAWSELSTGSPALEDALVSFDCRIVRRADGGTHDILMCE
RUTF_VARPS       GHQALSGLFGGKTPMDERFAAGRWSRKATGSPVLEDAAASFDCRVVQATSAGTHDVLFCE
RUTF_ECOK1       GQEPLSNLFGGKTPMELRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_ECOUT       GQEPLSNLFGGKTPMELRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_ECOKI       GQEPLSNLFGGKTPMELRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_ECO45       GQEPLSNLFGGKTPMELRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_ECOBR       GQEPLSNLFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_ECO24       GQEPLSNLFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_ECOLU       GQEPLSNLFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_ECO7I       GQEPLSNLFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_ECO5E       GQEPLSNLFGGKTPMEHRFAAARWQNGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_ECO5T       GQEPLSNLFGGKTPMEHRFAAARWQNGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_ECO57       GQEPLSNLFGGKTPMEHRFAAARWQNGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_ECOL5       GQESLSNLFGGKTPMEHRFAAARWQTGVTGCPQLGEALVSFDCRISQVVSVGTHDILFCA
RUTF_ECOL6       GQESLSNLFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_ECO27       GQEPLSNLFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCRINQVVSVGTHDILFCT
RUTF_ECOS5       GQEPLSNLFGGKTPMEHRFAAARWQTGVTGCPQLEKALVSFDCRISQVVSVGTHDILFCA
RUTF_ECO10       GQEPLSNLFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_ECOSM       GQEPLSNLFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_ECOBD       GQEPLSNLFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_ECO44       GQEPLSNLFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_ECO81       GQEPLSNLFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_ECO1A       GQEPLSNLFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_ECOCB       GQEPLSNLFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_ECO26       GQEPLSNLFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_ECOLC       GQEPLSNLFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_ECOHS       GQEPLSNLFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_SHIDS       GQEPLSNLFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_ECOLI       GQEPLSNLFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_ECOBW       GQEPLSNLFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_ECOD1       GQEPLSNLFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_ECODH       GQEPLSNLFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_ECO8A       GQEPLSNLFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_ECO55       GQEPLSNLFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_SHIF2       GQEPLSNLFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_SHIF8       GQEPLSNLFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_ECOSE       GQEPLSNLFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_SHIFL       GQEPLSNLFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_SHISS       GQEPLSNLFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCA
RUTF_ENT38       GQEPLSNLFGGKTPMADRFAAARWQTGETGCPRLEDALASFDCRISQVVSVGTHDILFCT
RUTF_ENTCC       GQEPLSNLFGGKTPMEDRFAAARWQTGETGCPRLEEALASFDCRISQVVSVGTHDILFCD
RUTF_KLEP3       GQEALSTLFGGKTAMDERFAAADWQTGATGCPRLEAALVSFDCRIDQRVSVGTHDILFCH
RUTF_KLEVT       GQEALSTLFGGKTAMDERFAAADWQTGATGCPRLEAALVSFDCRIDQRVSVGTHDILFCH
RUTF_KLEP7       GQEALSTLFGGKTAMDERFAAADWQTGATGCPRLEAALVSFDCRIDQRVSVGTHDILFCH
RUTF_CROTZ       GHEALSGLFGGKTPMEERFAAARWRRGVTGSPQLDGAVVSFDCRVEQVVPVSTHDVLLCR
RUTF_CROS8       GHEALSGLFGGKTPMEERFAAARWRRGVTGSPQLDGAVVSFDCRVEQVVPVSTHDVLLCR
RUTF_SERP5       EHESLSNLFGGKTPMELRFSAARWSTLATGSPILHGAVVSFDCQIGQIVSVGTHDIFFCQ
RUTF_YERE8       EHESLSNLFGGKTPMEMRFSAARWSTLVTGCPVLSGAVASFDCHITQVISVGTHDILFCQ
RUTF_PANAM       SHESLSNLFGGKTPMEQRFDAAEWTDLATGSPILTNALVSFDCKVTQITRVGTHDIMFCE
RUTF_ACIAD       HQAHLSNIFGGKTPMVDRFAHGEWRTLATQAPVLTDALVSFDCEVVQSLSVGSHDVFFCQ
RUTF_PSE14       GQQDLSNLFGGKRSQQERFDGGQWESGVTGAPILNSAKLALDCKVTQSVSVGTHDILFCQ
RUTF_PSEU2       GQQDLSNLFGGKSSQQERFAGGQWEAGVTGAPVLDSAKLALDCKVSQSVSVGTHDILFCE
RUTF_PSEU5       AQRDLSNLFGGKTPMAERFAAAQWSTGVTGSPLLDGATVSFDCRISHSASVGTHDILYCE
RUTF_BRADU       RHEPLSRLFGGKVPADERFAAAAWSTLATGAPVLADCSAAFDCRIADTVNVGTHDVLFCR
RUTF_STAND       GHEALSNLFGGRTPPEERFAAGQWHTSATGAPILVGAVVAFDCRIVKTVEVGTHDVLFCE
RUTF_METEA       GHETVAGLFGGRTPVDERFAAGTWRRLRSGALALTDALVSFDCRIVGRHAVGSHDVLYCA
RUTF_METED       GHETVASLFGGRTPVDERFAAGTWRRLPSGAPALTDALVSFDCRIVGRHAVGSHDVLYCA
RUTF1_METC4      GHETVASLFGGRTPVDERFAAGTWRRLRSGAPALADALVSFDCRIVGRHAVGSHDVLYCA
RUTF1_METEP      GHETVASLFGGRTPVDERFAAGTWRRLRSGAPALADALVSFDCRIVGRHAVGSHDVLYCA
RUTF_METPB       GHETVAGLFGGRTPMDERFAAGTWRRLRSGAPALTDALVSFDCRIVERHAVGSHDVLYCA
RUTF2_METEP      AHEGLATDFAGRVPQAERFAGPDWGRLQTGAPVLAGALVAFDCRIVDRHEVGTHDVLICA
RUTF2_METC4      AHEGLATDFAGRVPQAERFAGPDWGRLQTGAPVLAGALVAFDCRIVDRHEVGTHDVLICA
                  :  ::  *.*: .   **    *    : .  *  .  ::**.:      .:**:: * 

RUTF2_AGRRK      VVAIRENDGGQALIYFDRRYHAI-----------------------------------
RUTF_AGRFC       VVDMKINAGDEALMYFNRRYRVL-----------------------------------
RUTF1_AGRRK      VDAIRQRDGGQGLVYFDRNYHPAGQAE-------------------------------
RUTF_VARPS       ALAIAIGGAAQSLIYFDRRYHEIAAPPH------------------------------
RUTF_ECOK1       IEAIHRHATPYGLVWFDRSYHALMRPAC------------------------------
RUTF_ECOUT       IEAIHRHATPYGLVWFDRSYHALMRPAC------------------------------
RUTF_ECOKI       IEAIHRHATPYGLVWFDRSYHALMRPAC------------------------------
RUTF_ECO45       IEAIHRHATPYGLVWFDRSYHALMRPAC------------------------------
RUTF_ECOBR       IEAIHRHATPYGLVWFDRSYHALMRPAC------------------------------
RUTF_ECO24       IEAIHRHATPYGLVWFDRSYHALMRPAC------------------------------
RUTF_ECOLU       IEAIHRHATPYGLVWFDRSYHALMRPAC------------------------------
RUTF_ECO7I       IEAIHRHATPYGLVWFDRSYHALMRPAC------------------------------
RUTF_ECO5E       IEAIHRHATPYGLVWFDRSYHALMRPAC------------------------------
RUTF_ECO5T       IEAIHRHATPYGLVWFDRSYHALMRPAC------------------------------
RUTF_ECO57       IEAIHRHATPYGLVWFDRSYHALMRPAC------------------------------
RUTF_ECOL5       IEAIHRHATPYGLVWFDRSYHALMRPAC------------------------------
RUTF_ECOL6       IEAIHRHATPYGLVWFDRSYHALMRPAC------------------------------
RUTF_ECO27       IEAIHRHATPYGLVWFDRSYHALMRPAC------------------------------
RUTF_ECOS5       IEAIHRHATPYGLVWFDRSYHALMRPAC------------------------------
RUTF_ECO10       IEAIHRHATPYGLVWFDRSYHALMRPAC------------------------------
RUTF_ECOSM       IEAIHRHATPYGLVWFDRSYHALMRPAC------------------------------
RUTF_ECOBD       IEAIHRHATPYGLVWFDRSYHALMRPAC------------------------------
RUTF_ECO44       IEAIHRHATPYGLVWFDRSYHALMRPAC------------------------------
RUTF_ECO81       IEAIHRHATPYGLVWFDRSYHALMRPAC------------------------------
RUTF_ECO1A       IEAIHRHATPYGLVWFDRSYHALMRPAC------------------------------
RUTF_ECOCB       IEAIHRHATPYGLVWFDRSYHALMRPAC------------------------------
RUTF_ECO26       IEAIHRHATPYGLVWFDRSYHALMRPAC------------------------------
RUTF_ECOLC       IEAIHRHATPYGLVWFDRSYHALMRPAC------------------------------
RUTF_ECOHS       IEAIHRHATPYGLVWFDRSYHALMRPAC------------------------------
RUTF_SHIDS       IEAIHRHATPYGLVWFDRSYHALMRPAC------------------------------
RUTF_ECOLI       IEAIHRHTTPYGLVWFDRSYHALMRPAC------------------------------
RUTF_ECOBW       IEAIHRHTTPYGLVWFDRSYHALMRPAC------------------------------
RUTF_ECOD1       IEAIHRHTTPYGLVWFDRSYHALMRPAC------------------------------
RUTF_ECODH       IEAIHRHTTPYGLVWFDRSYHALMRPAC------------------------------
RUTF_ECO8A       IEAIHRHTTPYGLVWFDRSYHALMRPAC------------------------------
RUTF_ECO55       IEAIHRHTTPYGLVWFDRSYHALMRPAC------------------------------
RUTF_SHIF2       IEAIHRHTTPYGLVWFDRSYHALMRPAC------------------------------
RUTF_SHIF8       IEAIHRHTTPYGLVWFDRSYHALMRPAC------------------------------
RUTF_ECOSE       IEAIHRHTTPYGLVWFDRSYHALMRPAC------------------------------
RUTF_SHIFL       IEAIHRHTTPYGLVWFDRSYHALMRPAC------------------------------
RUTF_SHISS       IEAIHRHTTPYGLVWFDRSYHALMRPAC------------------------------
RUTF_ENT38       IESITRHPAPQGLVWFDRGYHALLRPAC------------------------------
RUTF_ENTCC       IVSIIRHPAPQGLVWFDRGYHALMRPAC------------------------------
RUTF_KLEP3       VVAITRHPEPRGLMWFGRGYHTLMRPAC------------------------------
RUTF_KLEVT       VVAITRHPEPRGLMWFDRGYHTLMRPAC------------------------------
RUTF_KLEP7       VVAITRHPEPRGLMWFDRGYHTLMRPAC------------------------------
RUTF_CROTZ       VLEITRNDDTHGLVWFDRHYHALSRPVCGLAS--------------------------
RUTF_CROS8       VLEISRNDDTHGLVWFDRRYHALSRPVCGLAS--------------------------
RUTF_SERP5       ALALTRNDDSHGLAYFDRRYHSLLKQ--------------------------------
RUTF_YERE8       AAAVIHNDDQHGLAYFDRCYHPLMRQSR------------------------------
RUTF_PANAM       VVALRCNDDCHGLAYFDRRYHPLMRQIAC-----------------------------
RUTF_ACIAD       VKAIQHCQGQNALMYFNRNYCEPHCVA-------------------------------
RUTF_PSE14       VLDIRDQGESDALVYFARQYHHLPGAAPAA----------------------------
RUTF_PSEU2       VVDIRHQSGADALVYFGRRYHHLPSETPAA----------------------------
RUTF_PSEU5       VLAVYRRDSSDALVYFGRNYHGLSSS--------------------------------
RUTF_BRADU       VVALQRFGCTDNLIYFGRAYHTVGVTDPAEAGPESALDAS------------------
RUTF_STAND       VVGLAEGGGREGLIYFSRRYHAVAGTPEG-----------------------------
RUTF_METEA       VEAVAASGQADALLYSERRYRTLPRAPRSGAAPAEPARAARALGARPAEGPALALRSA
RUTF_METED       VEAVAASGQADALLYSERRYRTLPRAPRSGSAPAEPARAARALGARPAEGPALALRSA
RUTF1_METC4      VEAVAASGQADALLYSERRYRTLPRAPRSGSAPAEPARAARAVGARPAEGPALALRSA
RUTF1_METEP      VEAVAASGEADALLYSERRYRTLPRTPRSGSAPAEPARAPRAVGARPAEGPALALRSA
RUTF_METPB       VEAVAAAGQADALLYSERRYRTLPRAPRGGSAPAEPARGARAIGARPPEGPVLALRSA
RUTF2_METEP      VEALAEISGAESLLYAGRHYRVLPRPDSESD---------------------------
RUTF2_METC4      VEALAEISGAESLLYAGRHYRVLPRTESKGD---------------------------
                    :        * :  * *