CLUSTAL format seed alignment for MF_00834

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

BIOA_ECOLI            --------------------------------------------------------MTTD
Q3IGS5_PSET1          --------MGPVVTNRCKFHSFLLSLFFHNGDIGLVYFLKYHCQRIQAHLSLHMIEKNTI
BIOA_BUCAP            --------------------------------------------------------MSQS
Q8D2A2_WIGBR          --------------------------------------------------------MNIN
BIOA_HAEIN            ------------------------------------------------------MVDEQS
Q4FUW1_PSYA2          -------------------------------------------------------MTTVS
Q8EDK5_SHEON          -------------------------------------------------------MRNLL
F8E3L0_FLESM          -------------------------------------------------------MEFNA
BIOA_MYCTU            ------------------------------------------------MAAATGGLTPEQ
BIOA_STRCO            --------------------------------------------------MPDPALNVAE
Q6A946_CUTAK          ------------------------------------------------------------
A1R3R5_PAEAT          ---------------------------------------------------------MSS
Q6NHE7_CORDI          -------------------------------------------------------MENNS
C4LIG0_CORK4          -------------------------------------------------------MED--
BIOA_CORGL            -------------------------------------------------------MENPS
D5AS68_RHOCB          ---------------------------------------------------------MTD
D9S547_FIBSS          ---------------------------------------------------------MNT
Q1QYE0_CHRSD          ------------------------------------------------------------
Q2G8N6_NOVAD          ---------------------------------------------MAQCARDRTMSDPQ-
Q0APZ8_MARMM          ----------------------------------------------------------M-
Q5FT00_GLUOX          -------------------------------------------------MSRNALSAPH-
Q0C2S8_HYPNA          ------------------------------------------------------MADPKD
Q7UUH3_RHOBA          ------------------------------------------------------------
B9KIG2_ANAMF          ------------------------------------------------------MVGCMY
Q2GKM0_ANAPZ          ------------------------------------------------------MYEHAH
Q3YS86_EHRCJ          ------------------------------------------------MLLNNMYINTCA
Q1MR96_LAWIP          ---------------------------------------------------------MLS
Q2GDE8_NEOSM          ---------------------------------------------------MYQHNKTVN
A0A110AW55_9CYAN      ------------------------------------------------------------
Q7V5Q5_PROMM          ------------------------------------------MATQSHRIMDCFDPLAAP
Q2W3K8_MAGSA          -------------------------------------------------MTLSYDELRAL
Q8DHL4_THEEB          ----------------------------------------------------------MS
Q982F8_RHILO          -------------------------------------------------------MSGRS
C1ABK6_GEMAT          -------------------------------------MYDDGDEDDAAPPGEPADLQRQH
G8TFC7_NIAKG          ---------------------------------------------------------MAT
F4C5P8_SPHS2          ------------------------------------------------------MNHETT
A0A6N4SUR2_CYTH3      --------------------------------------------------------MNND
Q8F499_LEPIN          ------------------------------------------------------------
Q1DFH5_MYXXD          -------------------------------------------------------MKRAD
BIOA_AQUAE            ----------------------------------------------------MWELDPKT
A6UV23_META3          ---------------------------------------------------MNNNLNPKK
BIOA_ANOFW            --------------------------------------------------MEKGMVAMNE
BIOA_STAA8            ------------------------------------------------------MNYTQQ
BIOA_GEOSL            ----------------------------------------------------MPDYDTQT
BIOA_DESVH            MSTSPFNSRVAPMPHDDATAPVLHYAHDAAGAHDAADAAGAHDAADAAGTPPCAASRTAR
A0A0A7V3N7_9ARCH      -----------------------------------------------------------M
A0A2H1EHY1_9ARCH      ------------------------------------------------------------
A0RW95_CENSY          --------------------------------------------------------MEQA
A0A060HGF1_9ARCH      -----------------------------------------------MHLTTMSGRPSLK
A0A2K5ASF4_9ARCH      -----------------------------------------------MHEHYTYKNGNLK
BIOA_HELPJ            ------------------------------------------------------MNFQEN
Q7VGW0_HELHP          ---------------------------------------------------------MLD
Q30R13_SULDN          -------------------------------------------------------MNNEE
BIOA_LYSSH            -----------------------------------------------------MKQVLTE
D3E0W0_METRM          ------------------------------------------------------MNKSKK
Q8RET8_FUSNN          -----------------------------------------------MRGVCIMINNLSE
Q83CU4_COXBU          -------------------------------------------------------MLEND
Q5ZVG9_LEGPH          --------------------------------------MNMIKSLLYLSTKIFKMVNTDQ
Q5NGB1_FRATT          ------------------------------------------------MYNLCQLNILQK
Q7NQD0_CHRVO          -------------------------------------------------------MSNQA
Q0KF89_CUPNH          ----------------MTLPNLSATVAQPGLAGNGARADGQQRRATLDHLSLSPGRDAQA
Q82Y62_NITEU          -------------------------------------------------------MNDKK
Q9PGV9_XYLFA          -------------------------------------MMHHNVHQSEILADPCDLQRAER
                                                                                  

BIOA_ECOLI            DLAFDQRHIWHPYTSM---TSPLPVYPVVSAEGCELILSDGR----RLVDGMSSWWAAIH
Q3IGS5_PSET1          DLNFDRQHIWHPYTSM---TKPIMVYPVTHANHNIIELETGE----QLIDGMASWWSAIH
BIOA_BUCAP            DIFFDHKHIWHPYSSM---VNPLPCYSVISAKGVYLKLKNGK----NIIDGMSSWWSTIH
Q8D2A2_WIGBR          EVNFDRYYIWHPYSSI---TKPLKTYHVVSAKKCKLKLINGK----KLIDGMSSWWTVIH
BIOA_HAEIN            LLAFDTQHIWHPYSSV---SSDMPLYAVERADGVMITLKDGR----RLIDGMSSWWAALH
Q4FUW1_PSYA2          TNDFDQQHLWHPYASL---PPRYPNIMIDHADGIHIVTQDGT----RLIDGMSSWWASVH
Q8EDK5_SHEON          DFDFDSAHIWHPYTSM---TRALPVFGVHSAQGCELELVDGR----KLIDGTSSWWACVH
F8E3L0_FLESM          QLKNDKKLLQHPYDSS---IKPMDAFLIKKAEREFLYLYDNT----SLIDGMSSWWSVIH
BIOA_MYCTU            IIAVDGAHLWHPYSSIG--REAVSPVVAVAAHGAWLTL-IRDGQPIEVLDAMSSWWTAIH
BIOA_STRCO            LLDLDRRHVWHPYGPMP--GRQ-DPLVVESASGVRLRP-ADGSG--ELVDGMSSWWSAIH
Q6A946_CUTAK          ------------------------MLAVTAANGVRLQLHDGE-HHHEVIDAMASWWCQIH
A1R3R5_PAEAT          LIDRDRATLWHPYAPAS--ATL-PLWEVEAADGVALRLRNEQGRTHEVLDAMSSWWSVIH
Q6NHE7_CORDI          FAQFDRDHIWHPYGPM---PATVAPYVVAATNNTDIILDNGT----RLIDGMSSWWAAAF
C4LIG0_CORK4          LARFDQEHIWHPYDPM---PAAVPSIPVTSAEGVTLHLDDDR----NIIDGMSSWWAVAH
BIOA_CORGL            LRELDHRNIWHPYA-----APGVRNRLVTKTDGVFLTLEDGS----TVIDAMSSWWSAIH
D5AS68_RHOCB          DLAFDAAHVWHPYTAR---FTAAPQHKIVAAKGIWLTLEDGR----QMIDAMSSWWCAAF
D9S547_FIBSS          LLNFDSEHLWHPYAAL---KNTPARFLAKSAHGTTIETADGL----KLIDAVSSWWCMAH
Q1QYE0_CHRSD          ----MTSPVWHPYAHL---KTQAPAPKVVGGDGPRFTLDTGE----SLLDATCSWWCMIH
Q2G8N6_NOVAD          WYSTGRDHVWLPYTQM---KTARPPLPVASAEGVKLRLADGR----ELVDGISSWWATVH
Q0APZ8_MARMM          NFDPADHALWRPYAQM---KTTPPALPVLSAEGVRLTLADGR----ELIDGVSSWWTVCH
Q5FT00_GLUOX          LTAADQPNLWLPYTQM---QTAPFPVEAVSTSGSRITLADGR----ELVDGVAAWWTACH
Q0C2S8_HYPNA          WFTAGLEHIWLPYAQM---RTLPAPVAIARTEGSRLYLADGR----ELVDGVGSWWTSIH
Q7UUH3_RHOBA          ----MMNSVWRPYCQM---KTAPPPMKIVATEGCHLIGQNGE----CWIDGMASWWSACH
B9KIG2_ANAMF          NF----ENLWLPYSGV---LSPIDAVKVVSGSGCYLELENGR----KLLDGISSWWSVCH
Q2GKM0_ANAPZ          WFQE--EKVLFPYSSA---VPAVAPMRVVSGQGSYLELEDGK----RLLDGISSWWSVCH
Q3YS86_EHRCJ          WFNKGYQNIWMPYTQM---KNSPLPLSVKSASGCYIILEDGK----RLLDGISSWWSVCH
Q1MR96_LAWIP          LTERDKKIIWHPFTQE---KTADPVISISHAKGSYVFDENGT----AYLDCISSWWVNLH
Q2GDE8_NEOSM          LSVRDKSLIWHPLTQE---KTSSPSIAIIRGEGEYLYDEQNK----KYLDLISSWWVNLH
A0A110AW55_9CYAN      ----MHPHIWYPFTQA---KVALEPLKVKSAQGVWLELETGH----KMIDCISSWWVNTY
Q7V5Q5_PROMM          NANNWHPHLWPPFTQI---ASASPPQRVIAADGALLMLDGAP----PLIDAISSWWVTLH
Q2W3K8_MAGSA          DA----RHVWHPFTQA---GTAQPAILALGARGSTIYAADGR----EYLDLVSSWWVNLH
Q8DHL4_THEEB          IATMTDSPIWQPFTQM---KTADPPLKVVRAQGACLELSDGR----QIIDAISSWWVTLH
Q982F8_RHILO          LM----SPVWHPFTQH---ALELAIPEIARTEGAYLHKADGT----RILDAISSWWVVTH
C1ABK6_GEMAT          ILLHDTAHVWHPYTQH---HQAPLPVPIVRAKGSWLYDTHGK----PLLDAISSWWVTTH
G8TFC7_NIAKG          LIERDKKAVWHPYTPQ---KSMPEPIPVAKGDGTYIIDENGK----AYIDAISSWWVTIH
F4C5P8_SPHS2          LSQRDVAAVWHPYSQL---PIDGPPIAIVEGKGVYLYAEDGR----SYIDAISSWWVNLH
A0A6N4SUR2_CYTH3      LIQTDAAHLWHPYTPL---LNTRPYAEVVSAKGMYLHLADGT----SLIDAISSWWVNIH
Q8F499_LEPIN          -------MIWYPFTLQ---FEPDSPLKIERAKGEFLYDELGN----SYIDGISSWWVSIH
Q1DFH5_MYXXD          IVGLDKAHVWHPYTAMEAYIAETDPLVVVRSEGAYLHDADGT----RYLDANGSWWVSTL
BIOA_AQUAE            LEKWDKEYFWHPFTQMKVYREE-ENLIFERGEGVYLWDIYGRK----YIDAISSLWCNVH
A6UV23_META3          IIEMDKKFVWHPYTQMKEYNQNPNNIIIERGEGNYLIDIRNKK----YLDAVSSIWCNLL
BIOA_ANOFW            WIEKSKTYLWLPFTQMKDY-EQ-HPLVIESGEGIFLTDVNGKT----YYDGYSSLWLNVH
BIOA_STAA8            LKQKDSEYVWHPFTQMGVYSKE-EAIIIEKGKGSYLYDTNGNK----YLDGYASLWVNVH
BIOA_GEOSL            LRDWDRRHIWHPFTQMKEWEES-EPVVIVEGEGSWIIDSEGKR----YLDGVAAIWTNVH
BIOA_DESVH            LRSLDAAHVWHPFTQMRDWMGS-EPCIIDAADGNHLIDTDGNR----YLDGVSSLWTNVH
A0A0A7V3N7_9ARCH      IHMKSPSPLWHPNTQMSEWTSF-P--EIVSAKGMWLYDSKGGK----MLDGVASMWCNVW
A0A2H1EHY1_9ARCH      ----MRSFVWHPYTQMGDWKKF-D--VISKGKGMWLYDTDGNS----LMDSVASMWCNVW
A0RW95_CENSY          GEQALSSVVWHPNTQMGEWDEF-G--EIVQGRGMHLIDKKGRK----LLDGVASMWCNVW
A0A060HGF1_9ARCH      DADRDRNFVWHPYTQMKDWERQ-DNRVIVRGEGFYLVDDRGRR----YLDGTASMWCNVW
A0A2K5ASF4_9ARCH      TKDKA--YVWHPYTQMSDWFRI-DAPVIVRGEDFYLIDDRGNR----YLDGVASMWCNVW
BIOA_HELPJ            LAALDLEYLWHPCSQMQEH-QNFPIIPIKKAQGIYLYDFNDNA----YMDLISSWWVNLF
Q7VGW0_HELHP          LKALDLAHIWHPCTQMKDH-ETLPLIPIKSAKGVYLYDFEGKA----FIDGISSWWVNLF
Q30R13_SULDN          LKKRDLAVLWHPCTQMKDH-ETLPLIPIKKAYGVYLEDFDGNL----YIDAISSWWVNIF
BIOA_LYSSH            LQEKDLQHVWHPCSQMKDY-EAFPPIVIKKGEGVWLYDEQNQR----YLDAVSSWWVNLF
D3E0W0_METRM          CAEKDLAHIWHPASQMKDY-EDFPPIVIDHAKGVHLYDVDGKE----YTDIISSWWCNIL
Q8RET8_FUSNN          LQKKDLKYVFHPCAQMKDF-EENPPLVIKKGDGLYLIDENGNK----YMDCISSWWVNLF
Q83CU4_COXBU          MQRLDSQHVWHPCSQMKDY-EQFKPLIIKKAYGSYIELSNGQK----IIDAISSWWCKSL
Q5ZVG9_LEGPH          LIAKDLKHIWHPCSQMKDF-ETFPPIVVNKAQGSYLYTNKGP-----VIDAISSWWCKSL
Q5NGB1_FRATT          VYNMYSSNIWHPCTQMKDF-EKSPPLNVYRTEGRYIYTKDNRK----LFDATSSWWCKSL
Q7NQD0_CHRVO          WLERSFAAVWHPCTQMKRH-ERLPIVPIASADGVWLTDFDGKR----YLDGVSSWWVNLF
Q0KF89_CUPNH          LGQRSRNAVWHPCTRLRPD-DDAVPLAIVRGVGPWLHDADGRR----YFDATSSWWVNLF
Q82Y62_NITEU          SAMRSHRVVWHPCTQMKHH-EEFPPVLITRGEGVWLYDADGQR----YLDTISSWWVNLF
Q9PGV9_XYLFA          WLQRDLRVLWHPCTQMREHPDTLPLVPIVRGEGAWLVGHDGRR----YLDAVSSWWTNLF
                                                         .             *   : *    

BIOA_ECOLI            GYNHPQLNAAMKSQIDAMSHVMF-GGITHAPAIELCRKLVAMTPQP----------LECV
Q3IGS5_PSET1          GYNHPVLNNAMIEQINSMSHIMF-GGFTHKPAVELCKKLVSITPAS----------LTKV
BIOA_BUCAP            GYNHPILNKSLKKQIRKMSHVMF-GGITHPSAILLCRKLLKLTPKK----------LDCV
Q8D2A2_WIGBR          GYNHPKINQAIINQIKKVSHVMF-GGITHSPAIKLCKKIIKLTPKG----------LECV
BIOA_HAEIN            GYNHPRLNAAAQNQLAKMSHIMF-GGFTHDPAVELAQLLVQILPNG----------LDKI
Q4FUW1_PSYA2          GYNHPKLNAAIIEQLGKMAHVMF-GGLTHQPAIDLGKKLLSIVPAG----------IDAI
Q8EDK5_SHEON          GYGHPAILTAMEQQLHQLSHVMF-GGITHEPAIELCKKLLAMTCEP----------LTKV
F8E3L0_FLESM          GYNNTFINNALKEQIDKVSHVMF-GGLTHEPAINLGVNLNNILSGN----------FDRF
BIOA_MYCTU            GHGHPALDQALTTQLRVMNHVMF-GGLTHEPAARLAKLLVDITPAG----------LDTV
BIOA_STRCO            GYNHPVLNAAAREQLERMSHVMF-GGLTHEPAVRLAKLLVDMSPEG----------LEHV
Q6A946_CUTAK          GYRNPVLDEALNRQSSQFSHVMF-GGLTHKAAVDAVMSLVRLAPGP----------LDRI
A1R3R5_PAEAT          GYRNPIMDAAIQRQLSTFSHVMF-GGLTHQPAVELAETLLAMAPGEPGR------RLERV
Q6NHE7_CORDI          GHGNERLKAAAHRQIDVMSHVMF-GGLTHVPAIKLARQLCELTDEP----------LTKV
C4LIG0_CORK4          GHRHPHLVEAAHRQINQMPHVMF-GGLTHKPAVDLAEWLVDITPEG----------LDLV
BIOA_CORGL            GHGHPRLKAAAQKQIDTMSHVMF-GGLTHEPAIKLTHKLLNLTGNS----------FDHV
D5AS68_RHOCB          GHAPEPLVRALQAQAATLPHVMF-GGLTHRPAIELTRRLVRALPEG----------LDQV
D9S547_FIBSS          GHNAPEIVEAIRKQSEKMCHVMF-GGFTHEPAIELGEKLVNFLPEG----------LNKI
Q1QYE0_CHRSD          GYRHPRLVRAIQQQADELCHVML-GGLTHAPADRLARELVRVTPAG----------LNHV
Q2G8N6_NOVAD          GYRHPHIEEAIRRQLETLPHVML-GGLAHEQAYTLARRLAGMLPGD----------LDHV
Q0APZ8_MARMM          GYRHPHIINAVKRQLDAVPHVML-GGLTHDPAECLARRLAAIAPGD----------LNHA
Q5FT00_GLUOX          GYSHPHIHEALVRQAERMPHVMF-GGMVHEPAIRLAARLAAMLPGD----------LERV
Q0C2S8_HYPNA          GYNRPELLDAARDQMAKMPHIML-GGLAHEPAYRLATRLAEITPGD----------LSRV
Q7UUH3_RHOBA          GYNHPQVRDAVTEQLHRMPHVMF-GGITHEPAERLANRLAELAPDD----------LNHV
B9KIG2_ANAMF          GYSHPHIVAKMREQVEKLSHVMLCSGLVHEGACELASRLVGLAPPG----------LQKV
Q2GKM0_ANAPZ          GYSHPYIVGKMQEQLAKLSHVMFCRDLIHEGAYVLASRIAKLMPPG----------LDRV
Q3YS86_EHRCJ          GYSHPHIVQKVQDQVAKLSHVMF-SGLAHEQSYVLASRLVKISPE-----------QKKV
Q1MR96_LAWIP          GHSHPDIAQAIYEQALKLEHIIF-AKFTHSPAVELCEQLTSILPLT----------LTKC
Q2GDE8_NEOSM          GHANPAIAHAIYEQALKLEQVIF-AGFTHDQAIQLCENLKVELPEN----------LTRF
A0A110AW55_9CYAN      GHCHPKIAEAIYQQAQQLEQVIF-AGFTHDPAEQLAEKLVEKLGAP----------FNRV
Q7V5Q5_PROMM          GHANPSIAAAIATQAQQLEQVIF-ADFIHPQAEQLAERLSAVTG------------LQRL
Q2W3K8_MAGSA          GHANPAIAQAVADQAGRLEQVIF-ADFTHEPAARLAHRVCKRLPGD----------LNRV
Q8DHL4_THEEB          GHSHPVLAKALYGQAQTLEHVIF-AGFTHEPAEQLAQLLCAHTPGG----------LQRV
Q982F8_RHILO          CHRHPRIIKAIETTAASLDQIIF-AGFTHEPAERLARALVGLAPAG----------LDWV
C1ABK6_GEMAT          GHCQPEIVQAITDQAASLDQVIF-AGFTHEPATALAAELVGRLPRG----------LTRI
G8TFC7_NIAKG          GHANPYIAEKIYEQAKNLEQVIF-AGFTHEPAVRLAERLLEILPGD----------FAKI
F4C5P8_SPHS2          GHAHPYIAEQLYKQLHKLEHVIF-AGFTHSPAIELAERLLSILPDN----------QRKI
A0A6N4SUR2_CYTH3      GHANEVLAETIKNQILQLDHTLF-AGFTHKPAVDFATTFLRVLGCN----------QQRV
Q8F499_LEPIN          GHNHPKIVQAVKNQLEKLDHVLL-AGFTHDPAEKLAAELLKITDGL----------FQKV
Q1DFH5_MYXXD          GHRHPRLMRALAEQAAALPHVSL-AGITHEPAALLASELAAIAPGSDRPGLPSSERLSRV
BIOA_AQUAE            GHNHPKLNNAVMKQLCKVAHTTT-LGSSNVPAILLAKKLVEISPEG----------LNKV
A6UV23_META3          GHSEKRIINAIKEQADKICHSTL-LGCGNVPSTILAEKVINITPPH----------LKKV
BIOA_ANOFW            GHRKKEIDDAIRAQLERIAHSTL-LGAANIPAIALAEKLIEWTPSH----------LTRV
BIOA_STAA8            GHNNKYLNKVIKKQLNKIAHSTL-LGSSNIPSIELAEKLIEITPSN----------LRKV
BIOA_GEOSL            GHCRREINEALKAQVDRLEHSTL-LGLTNDRAVVLAKRLAEIAPPG----------LCKV
BIOA_DESVH            GHRHPHIDEAIRRQLDRVAHSTL-LGLGGTPSIELAARLTAIAPAG----------LTRV
A0A0A7V3N7_9ARCH      GHSKSELVSEIIKQTKILQHTPL-FNLTHPSAEKLSKKLLQLNPK-----------MKSV
A0A2H1EHY1_9ARCH      GHSNKELTKAMIKQTKTLQHSSL-FNLTNDKAESLARELITLAPQ-----------MHKV
A0RW95_CENSY          GHSRPELVRAITRQAARLQHSPL-FNLTNGPAEELARMLIETIPG-----------MHRV
A0A060HGF1_9ARCH      GHGQNEVVEAMREQLKHLQHSTL-FGLASEPSARLAERLIKLARGS----------MDRV
A0A2K5ASF4_9ARCH      GHSRKEIVDAIVEQAKVLQHSTL-FGLCNEPSIVLAELLVKMTKG-----------MGKV
BIOA_HELPJ            GHNNAYISQQLKNQIDNLEHVLL-ASFSHKPIITLSQRLCQL------------TGMDKC
Q7VGW0_HELHP          GHCNPFINAAITKQLQQLEHIIL-AGFSHEGIIRYSEKLCALLP----------QSLQKC
Q30R13_SULDN          GHTNSYINEKIKEQLDTLEHVIL-AGFTHEQVVRLSERLVKLTP----------DGLEKC
BIOA_LYSSH            GHANPRISQALSEQAFTLEHTIF-ANFSHEPAIKLAQKLVALTP----------QSLQKV
D3E0W0_METRM          GHCNEEVSQALKDQLDELDHVLF-ANFSHKTIIELSERLIKVMP----------KGLNRF
Q8RET8_FUSNN          GHCNKRINRIITEQVNNLEHVIF-ANFTHEPAAELCEELTKVLP----------KGINKF
Q83CU4_COXBU          GHNHPKLKEALKQQLEKFEHVIF-ANTTNEIIVALSQQLAALL-----------PGLNKV
Q5ZVG9_LEGPH          GHGHPAVIAAIKNQLDCFEHVIS-ANTTHPAAVELAEKLSEI------------TGKQHV
Q5NGB1_FRATT          GHRHPYIIDKLKKQLDKYEHTIF-ANATNDEIDRFSQRICNL------------TGMDKT
Q7NQD0_CHRVO          GHGHPRIKQAVRKQLDSLEHVML-AGFTHRPVVELSERLAALSG------------LGHA
Q0KF89_CUPNH          GHANPRINAALASQLETLEHVML-AGCTHAPAVELAERLSALTGG----------ALGNV
Q82Y62_NITEU          GHCNPRINAAIIDQLGRLEHTML-AGLTHEPVVELSERLSTITPG----------SLSHC
Q9PGV9_XYLFA          GHADPRISAAIAAQARTLEQVML-AGFSHEPAVRLAEALLRLAPRQDGR-----EPLSKV
                       :    :            :                  .                     

BIOA_ECOLI            FLADSGSVAVEVAMKMALQYWQA-----KGEA----------RQRFLTFRNGYHGDTFGA
Q3IGS5_PSET1          FLADSGSVSVEVAIKMALQYWLS-----QGISN---------KQKLMTPYKGYHGDTFAA
BIOA_BUCAP            FLSDSGSIAIEVAIKMLIQYWEA-----LGQ-K---------RTQILTIKNGYHGDTFSA
Q8D2A2_WIGBR          FLSDSGSVSIEVALKMALHYWFS-----KNERK---------KVKFLSLRGGYHGDTFGA
BIOA_HAEIN            FFADSGSVAVEVAMKMAIQYQHA-----KGEVQ---------RQKFATIRSGYHGDTWNA
Q4FUW1_PSYA2          FYADSGSIAVEVALKMALQYQIA-----AKRPN---------KQQFASTHSGYYGDTWHA
Q8EDK5_SHEON          FLCDSGSIAVEVAIKMALQYWQGQDLPLAQKAQ---------KQRILTVKKGYHGDTFAA
F8E3L0_FLESM          FYCDSGSVAVEVAVKMAFQYYMG-----KGLNN---------KNKILSFEGAYHGDTFMA
BIOA_MYCTU            FFSDSGSVSVEVAAKMALQYWRG-----RGLPG---------KRRLMTWRGGYHGDTFLA
BIOA_STRCO            FLADSGSVSVEVAVKMCLQYWRS-----LGRPG---------KHRLLTWRGGYHGDTWQP
Q6A946_CUTAK          FLADSGSVGVEVSLKLARQVQIA-----RTAARGGT----LTRTRVAALRGAYHGDTLGA
A1R3R5_PAEAT          FLADSGSISVEVALKLAVQFQTA-----SGLPK---------RQRFLTIRGGYHGDTFAA
Q6NHE7_CORDI          FFSDSGSVAVEVALKMVYQYQLG-----QGHPE---------RRRMLTWRGGYHGDTFAT
C4LIG0_CORK4          FYSDSGSVSVEVAIKMALQYQMG-----NGHPE---------RNRLVTWRRGYHGDTQGP
BIOA_CORGL            FYSDSGSVSVEVAIKMALQASKG-----QGHPE---------RTKLLTWRSGYHGDTFTA
D5AS68_RHOCB          FYSDSGSVAVEVAVKMAVQAQLA-----QGRRG---------RTRLATARGGYHGDTWTA
D9S547_FIBSS          FFADSGSIAVECAAKMAVQYQHS-----LGRPE---------RCKLVALKGGYHGDTAGA
Q1QYE0_CHRSD          FFSDSGSVGMEVAMKMAVQYHHL-----RGKPA---------KRRMLTLMKAYHGDTAGC
Q2G8N6_NOVAD          FFSDSGSVAVEVAMKMAAQFWLN-----QGHR----------RVKFLCFRGGYHGDTFAT
Q0APZ8_MARMM          FFSESGSVSVEIAMKVAVQSFIN-----RGLRG---------RTRFLAFRGGYHGDTLAT
Q5FT00_GLUOX          FFTDSGSVAMEVAIKMAVQYHIN-----RGTSG---------RTKILSFRGGYHGDTLGM
Q0C2S8_HYPNA          FFTESGSVAVEVAMKIAIQYFRN-----TAGVT---------RTKFVSFLGGYHGDTLAT
Q7UUH3_RHOBA          FFSDSGSVAVEVAMKMAIGHWRR-----HDRPG---------RTRFLAFDNAYHGDTTGA
B9KIG2_ANAMF          FFSDSGSMAVEVAMKIAVQYWHI-----VGRPQ---------KTGFVAFKNAYHGDSMGC
Q2GKM0_ANAPZ          FFADSGSMAVEVALKLAVQYWYS-----MGKRE---------KHSFIYFKNSYHGDSMGC
Q3YS86_EHRCJ          FFSDSGSTAVEVAMKMAVQYHQN-----LGNKN---------KYNFVSFVNGYHGDTMGC
Q1MR96_LAWIP          FFSDNGSTSVEIALKMAYQYWYNKKH--------------PEKTLFLSFEGAYHGDTFGT
Q2GDE8_NEOSM          FFSDNGSTSVEVALKIALQFWKNSGE--------------KQRDIFISFDKGYHGDTVGA
A0A110AW55_9CYAN      FFSDNGSTAVEVGLKIAYQYWVNQGQ--------------A-RSTFLAFDGAYHGDTFGA
Q7V5Q5_PROMM          FFSDNGSTAVEVALKIACQCWHNRGE--------------P-RQQLIAFNGAYHGDTFGA
Q2W3K8_MAGSA          FYSDDGSTAVEVALKLAHQYWRNHGQ--------------H-RSTYIAFEGGYHGDTAGA
Q8DHL4_THEEB          FFSDNGSTAVEVALKMAYQYWQRRDQ--------------PQRSRFIGFAGGYHGDTLGA
Q982F8_RHILO          FYSDSGSTSVEVALKMALGYFRNIG---------------APRSRIVVMEHSYHGDTIGT
C1ABK6_GEMAT          FYSDDGSTAVEVAIKLSVQSFANRG---------------QSRRLIAALDHAYHGDTFGA
G8TFC7_NIAKG          FYSDNGSTAVEVGVKMALQYWWNKGN--------------GKRNKILALNHSYHGDTFGT
F4C5P8_SPHS2          FYSDNGSTAVEIALKMCLQYWHNTGQ--------------CKK-KIIALKDAYHGDTFGT
A0A6N4SUR2_CYTH3      IYSENGSTAVEVAMKLAVQYWKSKG---------------RQKTTFLALEGAFHGDTFGA
Q8F499_LEPIN          LYSDNGSTAVEIMIKLAYQYFQNIGE--------------VDRKIFIKWNSSYHGDTIGT
Q1DFH5_MYXXD          FYSDNGSTAVEVAIKMAAQYWAQNGQ--------------PRRTRFITLSGAFHGETMGA
BIOA_AQUAE            FYSEDGAEAVEIAIKMAYHYWKNKGVKG--------------KNVFITLSEAYHGDTVGA
A6UV23_META3          FYSEDGSEAVEIAVKMAFEYCQLKDSKNNKDNNNNNQTAQPQRTKFVSVKEGYHGDTIGT
BIOA_ANOFW            FYSDSGAEAVEIALKIAFQYWRNIGEN--------------KKQKFVTLANGYHGDTVGA
BIOA_STAA8            FYSDTGSASVEIAIKMAYQYWKNIDREKY-----------AKKNKFITLNHGYHGDTIGA
BIOA_GEOSL            FYSDNGSTAVEVGVKMAFQFWRHE--GKP------------EKSRFISFTSAYHGDTLGA
BIOA_DESVH            FYSDSGSTAVEAALKIAFQYHRQAPEGDA------------RRTRVMAFSNAYHGDTIGS
A0A0A7V3N7_9ARCH      FFSDNGSTAMEIAIKIALQYWRNV-GEN-------------KKTNVATLENGYHGDTFGA
A0A2H1EHY1_9ARCH      FYSDDGSTAMEISAKMALQYWHNI-DK--------------KKTKFVSLENGYHGDTIGT
A0RW95_CENSY          FYSDNGSTAMEVAFKMAIQYWSNE-GDS-------------GRNRIAALSNGYHGDTFGA
A0A060HGF1_9ARCH      FYTDNGSTAIEAALKMALQYWQNR-GKP-------------EKKLFVSLEGGYHGDTVGA
A0A2K5ASF4_9ARCH      FYSDDGSTAMEVAIKMAIQYWYNKLGSN-------------KRREIIALENGYHGDTIGA
BIOA_HELPJ            FYADNGSSCIEIALKMSYHAHFLKNQTRR-------------KKLFLSLSNSYHGETLGA
Q7VGW0_HELHP          FYADNGSSAIEVALKMSFHSHYNAGNKD--------------KNAFLSLSNAYHGETLGA
Q30R13_SULDN          FYADNGSSGVEVALKMSFHTH--KNNQKE-------------KNIFVSLTNSYHGETIGA
BIOA_LYSSH            FFADNGSSAIEVALKMSFQYHMQTGKTQ--------------KKRFLALTDAYHGETLGA
D3E0W0_METRM          SFVDNGSASVECALKMAFQYCAQTGRAQ--------------KKRFMCFTDAYHGETLGA
Q8RET8_FUSNN          LFSDNGSSCIEMALKLSFQYHLQTGNPQ--------------KTKFISLENAYHGETIGA
Q83CU4_COXBU          FYAGDGSCAVEIAMKMSLHSRIIQGNKK--------------RKKFIALKNSYHGETVGA
Q5ZVG9_LEGPH          FFASDGSSAVEIAMKLAIHASQIKGHKN--------------KNQFIALKNGYHGETIGT
Q5NGB1_FRATT          LYASDGSCAVEIALKMTIHLRSFQNQTK--------------KIKFVCLENSYHGETLAT
Q7NQD0_CHRVO          FYGSDGASATEIALKMSFHYWKNVGRPQ--------------KTRFVSLENSYHGETVGA
Q0KF89_CUPNH          FYASDGASAVEIALKMSFHYWRNTGLPA--------------KREFVCLRHGYHGETVGA
Q82Y62_NITEU          FYASDGASANEIALKMSFHYWQQSGFPE--------------KTQFINLQNGYHGETLGA
Q9PGV9_XYLFA          FYADNGSAGVEVALKMAFHYFRNRGEEQ--------------RTRFIALHNGYHGETIGA
                           *:   *   *:                          :        .::*::   

BIOA_ECOLI            MSVCDPDNSMHSLWKGYLPENLFAPAPQSR---------------MDGEWDERDMVGFAR
Q3IGS5_PSET1          MSVCDPVNSMHSLYSGFLPEHIFVPAPVSQ---------------FNSEFNQAEATELEA
BIOA_BUCAP            MSISDPNNSMHKIYNKFLPKNLFAETPTSS---------------FHKEWNSIDIQSFKK
Q8D2A2_WIGBR          LSVCDPKNSMHNIYQGYLPNQEFTNTFDRK---------------FNEKWESGDDLNLVK
BIOA_HAEIN            MSVCDPTTGMHHLFHHSLPVQYFLPQPNIP---------------FNESWNDCAIEPLAD
Q4FUW1_PSYA2          MSVCDPINGMHSLYGKQLPMQHFVAAPPMG---------------FERDITQNERDELTA
Q8EDK5_SHEON          MSVCDPEGGMHTMFGEAVIKQCFVDAPQTP---------------FGESLHQDDLAPMQR
F8E3L0_FLESM          MSLCDPVNSMHKDFGNILHTNIFAPKPKSG---------------FFESYED-DHLDIAY
BIOA_MYCTU            MSICDPHGGMHSLWTDVLAAQVFAPQVPR-------------------DYDPAYSAAFEA
BIOA_STRCO            MSVCDPEGGMHELWSGVLPRQVFADAPPA-------------------EYEETYADHLRS
Q6A946_CUTAK          MSVCDPIGGMHAMFSDSIPQQIFLPRPPS--------------FAADEADVETWCSEADE
A1R3R5_PAEAT          MGVCDPVDGMHSSFPGLLAGNVFAPRPPAA-------------ATATAAAMEQWRAAVEE
Q6NHE7_CORDI          MSLCDPEGGMHAMWEGRVMDNVFASRPP-----------------LWGAASNEISAYIDH
C4LIG0_CORK4          MSVCDPEGGMHSLWRGTLVEQVFAPEPPADPRCDVGHLADDDGSGGARLSDDELESYLRE
BIOA_CORGL            MSVCDPENGMHSLWKGTLPEQIFAPAPP-----------------VRGSSPQAISEYLRS
D5AS68_RHOCB          MSLCDPEAGMHAHFGSAIAPQHFVARPPVA-----------YGADWPEDDRRNGLAEVEA
D9S547_FIBSS          MALSDP-DGMHVLFRGIMPHHYFAERPNCR---------------FDSAWDDSDFASMER
Q1QYE0_CHRSD          MAVCDPEEGMHSLFAGFLPQHHFAPAPTAG-------------FEASREEVQADLDALRA
Q2G8N6_NOVAD          MSVCDPDEGMHSLFRGALLEQVVVDLPRDA----------------------EGEAALGA
Q0APZ8_MARMM          MSVCDPEEGMHTMFAGAIARQLIADLPTDA----------------------DRIDSLDA
Q5FT00_GLUOX          MSICDPEEGMHSLFAGVLPEQALADLPVDG----------------------DSLARLEA
Q0C2S8_HYPNA          MSVCDPDEGMHHMFRGALAEQYVVALPETR----------------------DQIRALET
Q7UUH3_RHOBA          MSLCDPQRSMHARYSGAITQQYHVALPRDA----------------------TTEAVLER
B9KIG2_ANAMF          MSVSDPMAIHGPWFSGYYPAQHLFDLPVDE----------------------RDFELLRR
Q2GKM0_ANAPZ          ISISDPAAIHGDSFTRYCPKQYLLDIPASE----------------------EDVVLLQQ
Q3YS86_EHRCJ          MSISDPTKIHGTKFKKYHPSQFILPLPSTE----------------------EEIKNFAN
Q1MR96_LAWIP          MSIG-SSGFHNIFSSFFFNVLRIPYPD------------TWDGDNEIEKKEAHALHVLDK
Q2GDE8_NEOSM          MSLGASSGFFDQYKKILFETVHVPFPA------------TWENDPDVEIKEEASLNTIQN
A0A110AW55_9CYAN      MSVGARSLFSAVFSNLLFNVEFVPFPS------------THWGDRTAEETEAKVLSILEK
Q7V5Q5_PROMM          MAVGERNLFSAPFEEMLFPVARVPWPA------------TWWGDEEVETRERIALTELER
Q2W3K8_MAGSA          MSAGHSSGYFGAWKEMLFPVETVPFPA------------TWNGDETVEDKEQAALDALDL
Q8DHL4_THEEB          MTVGQSSPWWQPFQPLLPPLTILPYPA------------TYPEDPEVDTKEAQAIAQLET
Q982F8_RHILO          MSVGARGVFNAAYEPLLFEVDTIPFPA------------AGQEQETLDRFEAVSRDR---
C1ABK6_GEMAT          MAAGARSVFTNMYEPLLFDVARLPDPS------------EGDTLAALDALIAA-RGK---
G8TFC7_NIAKG          MSLSNRSVFTLAFQDKLFDVIFTDAPT------------KDS-----PLYDGPWDE----
F4C5P8_SPHS2          MSVSARSNWTKPFENYLFEVIFLEAPN------------ELSLKTIKEKLYAIRQE----
A0A6N4SUR2_CYTH3      MSVSARGLFTEAFESLLNPVKFIPFPD------------GTNDAFVLESMEKHIREN---
Q8F499_LEPIN          MSVGGNSVFNRVFQGLMFPTKEFQTPNCN----------FCPMGKKPESCKVECIDPIEK
Q1DFH5_MYXXD          TSVGGVPLFREVFGPLLFDVVHVPSPAEEG-------------------GWARAFEQVQS
BIOA_AQUAE            VSVGGIELFHGTYKDLLFKTIKLPSPYLYCKEKYGELCPE---------CTADLLKQLED
A6UV23_META3          MSVGGSSTFHGMFKPLLFNGYFANTPYCYRCQYHNFKDTDDRNK---CGCEMDCLKEMLN
BIOA_ANOFW            ISVGAIDIFHTVYEPLMFTSYKAPFPLVYRHPSNDPNVVR-----------DEALGALEA
BIOA_STAA8            VSVGGIKTFHKIFKDLIFENIQVESPSFYRSNYDTENEMM-----------TAILTNIEQ
BIOA_GEOSL            VSVGGIDLFHGVFRPLLFPTIQAPAPYCYRCPMGRDTPAAC---------GMECLTELER
BIOA_DESVH            VSLGGMSLFHGIYGPLLFDPVRAPAPHCYRCPADL-RPETC---------GMACLGEVER
A0A0A7V3N7_9ARCH      MSVGYVPEFFSKFRSKLFSTIQFPVPRTVIIGSNTKKSSKE--------YAEYCLSKIED
A0A2H1EHY1_9ARCH      MSLGYVPLFFSKFKSVLFPVLRTPSPNRYRMPKGY--SYED--------FQEHCIDSIEK
A0RW95_CENSY          MSVGYMPGFFGAFKGQLFPAVRFDAPGGREAPGGP--TDKE--------IEEECLGNMEE
A0A060HGF1_9ARCH      MSVGYIEQFFGAYKPLLAKVSRVPSPLFYG---SKFESVQD--------LVEHCMEQTEK
A0A2K5ASF4_9ARCH      MSIGYIEHFFKPYKPLLFKVRHVPSPYLYRK--SREMSDAD--------YVQYCIDMLEH
BIOA_HELPJ            LSVGDVKLYKDTYTPLLLKNLITPVPKN---------DSEIE----------NSLNALKR
Q7VGW0_HELHP          LSVGDVALYKSTYQPLLLECLSAPVPRGIWNPDDGTISGDYH----------MELEALEE
Q30R13_SULDN          LSVGDVKLYKDTYKPLLIQSIQTPVPKDM-------SIEAAR----------EAACEFEK
BIOA_LYSSH            LSVGGVDLYNEVYQPLLLDTVRAQGPDCFRCPFKHHPDSCHA----------QCISFVED
D3E0W0_METRM          LSVGALDEYSSVFEPIMIDTIKIEAPDCYRCPYGKTRNDCDC----------QCFEHAER
Q8RET8_FUSNN          LGVGDVDIFTETYRPLIKEGRKVKVPYIDSKLSNDEFVKLED----------ECIKELED
Q83CU4_COXBU          LSVSDVGLYRAPYSTMLFEPYFIESIPYVLNT-QAPEWNDCS----------AHWDTVER
Q5ZVG9_LEGPH          MSVSDLGLYKTPYASFGVQCHYIDDIPYVSGL-KDPLWTNCD----------AYWNKVVQ
Q5NGB1_FRATT          MSVSDCGLYSDPYKPLLFDSFKLKNIPYVTGK-NDPLWANAE----------RYWNKSQQ
Q7NQD0_CHRVO          LAVTDVPLFSSTYAELLKPGLRAPSPDARQAVPGERAADVAL----------RAARSLEN
Q0KF89_CUPNH          LAVTDVEVFRDAYDPLIRRAHVVMSPDARQAAPGESAADVAA----------RALAELET
Q82Y62_NITEU          LSVTDVPIFRQVYAPLLRPAHPVLTPDWRFAEAGETPEAHAL----------KAAAALES
Q9PGV9_XYLFA          LAVGDIPLYRRVYAPLLTEVLFAPSPDAYLAEPGQSAAEYAL----------QAAEALEV
                                                                                  

BIOA_ECOLI            LMAAHRHEIAAVIIEPIVQGAGGMRMYHPEWLKRIRKICDREGILLIADEIATGFGRTG-
Q3IGS5_PSET1          YFKAHHQSVAAFIIEPIVQNAGGMNFYHPEYLACVRKLCTQYKVLLICDEIATGFGRTG-
BIOA_BUCAP            IIEKKSKKIAGVILEPIVQGVGGMNFYHPTYLKEIKKLCKAYSIPLVFDEIATGFGRTG-
Q8D2A2_WIGBR          LIEKHHKKLAAVIIEPIVQGVGGMNFYHKQYLISIKKLCKFYKILLIVDEIATGFGRTG-
BIOA_HAEIN            LLKKKGNEIAALILEPVVQGAGGMYFYSPTYLVKAQALCKQYGILLIFDEIATGFGRTG-
Q4FUW1_PSYA2          FFAKNSHQLAGFIIEPIIQGAGGMRFYSPEYLQLLRQLCCEHDVLLIADEIATGFGRSG-
Q8EDK5_SHEON          ILREQHQDIAAVIIEPIMQGAGGMRFYSSEYLRGLRALCDEYNVLLILDEIATGFGRTG-
F8E3L0_FLESM          LLEKYAEDIAAIIIEPVVQGAGGMWFYHPEFLNKLKNMCAYYDILLIFDEIATGFGRTG-
BIOA_MYCTU            QLAQHAGELAAVVVEPVVQGAGGMRFHDPRYLHDLRDICRRYEVLLIFDEIATGFGRTG-
BIOA_STRCO            MVERHAGELAAVIVEPVVQGAGGMRFHSPAYLRVLREACDAHDVLLVFDEIATGFGRTG-
Q6A946_CUTAK          ILDTHRDDLAGIIVEPILQGAGGMWPWSPSCLKHLRRRADELDLVLIADEVATGFGRTG-
A1R3R5_PAEAT          LARLHSNELAAIIVEPMLQGAGGMFMYPAECVRILRGIADHHGLLLILDEIATGFGRTG-
Q6NHE7_CORDI          LDSLIDSTIAGIIVEPVVQGAGGMRFHAPEILKGIRQLCDQHGILFIADEIATGFGRTG-
C4LIG0_CORK4          FETYIDDTIAGVIIEPVVQGAGGMRFHDPRLVAGLRRVCDDHDILLIADEIATGFGRTG-
BIOA_CORGL            MELLIDETVSAIIIEPIVQGAGGMRFHDVALIEGVATLCKKHDRFLIVDEIATGFGRTG-
D5AS68_RHOCB          LFERHGAQIAAFILEPIVQGASGMHFHHPAYLRGLRALCDRHDIALIFDEIATGFSRTG-
D9S547_FIBSS          VVEEHKDEIAAVICEPVFQGGNGMWLYNAGYLRRLRELCDRYGILLILDEIASGFYRTG-
Q1QYE0_CHRSD          VLEAHHEEIGALLMEPLLQAAGGLNMTSPHYLRGARELCDEFDVLLVFDEVATGFGRTG-
Q2G8N6_NOVAD          LIEQHRGELAGIVVEPLVQGAGGMVFHDPFTLQALRRLADEHELLLIFDEIFVGLGRLGD
Q0APZ8_MARMM          LVSDHIDTLAGVVVEPLVQGAGGMRFHDAATLQALRDLCDRHGLPLIFDEIMTGFGRLG-
Q5FT00_GLUOX          LLAERGDSIAAMVTEPLVQGAGGMLFHDPEVLRHLRELCDRHGILLILDEIFTGFGRTG-
Q0C2S8_HYPNA          LLSTDK-KIAAVMIEPLIQGAGGMRMHSPQVLKTLRRLCDQAGVLLIFDEIFTGFGRTG-
Q7UUH3_RHOBA          TLAAHSDSIAGVFVEPLVQGAGGMRFHDVITLRRIRDACKRHDVLLIADEIATGFQRTG-
B9KIG2_ANAMF          KIEQIAHEAAAIIVEPILQAAGGMRLYPPEVLASLLKLAREANILFIVDEVATGFGRIG-
Q2GKM0_ANAPZ          KIESIADKVAAIIVEPLLQAAGGMVIYPPHVLSTLRKIAKENEILFIADEVATGFYRLG-
Q3YS86_EHRCJ          TIYSIRDQVAAVILEPILQAAGGMLIHSANILKKIYDIAKANNILFIADEVATGFGRTG-
Q1MR96_LAWIP          YLLEYKNTIAAIVIEPLIQAARGMRICRPAFLNSIIKKVRNAGILVIFDEVMTGFGRTG-
Q2GDE8_NEOSM          FLEQNLNRVAGFIAEPLVQGAGGMRMCRYKYLEQCVKLFKEYGILTIFDEIMTGFYRTG-
A0A110AW55_9CYAN      VLDERGDRIAGIIIEPLVQGAGGMRMCRPQFLQKLRAIAQSFNTLLIFDEVMTGFGRTG-
Q7V5Q5_PROMM          CLQ---TPTAAVILEPLVQGAGGMAMVRAEFLQGVEQRVRAAGALLIADEVLTGFGRCG-
Q2W3K8_MAGSA          LFAANPDHVAAVIIEPLIQGASGMRMCRPDFLRKLEAKVRDNGSLLILDEVMTGFGRTG-
Q8DHL4_THEEB          TLKTDPDAYAALFIEPLVQGAGGMRMCRPQFLRAVSEVAKAYGVLVVYDEVMTGFGRTG-
Q982F8_RHILO          -------RAAALIVEPLVLGAGGMQMYPAWVLAELKKITEASGTLLITDEVMTGWGRTG-
C1ABK6_GEMAT          -------ELAAVIVEPLLIGAGGMRVWDESVLQGIRERTSAAGVHLIADEVLTGFGRTG-
G8TFC7_NIAKG          --------IACFIYEPLLQGVGSMNIYDASALNKLLQQCHAQDVICIADEVMTGFGRTG-
F4C5P8_SPHS2          --------VACFIYEPLVQGSAGMKMYEASHLSELLCFCKELGILLIQDEVFTGFGRTG-
A0A6N4SUR2_CYTH3      -------AVAAFIYEPLIQGTGGMRTYTAEMLDKMITVCKQNDVLCIADEVMTGFGRTG-
Q8F499_LEPIN          FFQKSPKAVAGIVIEPLILGSGGMIFYKEEVLQRLETISKKYGSLLLLDEVFTGFGRTG-
Q1DFH5_MYXXD          TLRAHPEVIAGVILEPVLQGAAGMVMYSPDFVRAVREATSEVDTFLIADEVFTGLGRTG-
BIOA_AQUAE            ILKS-REDIVAVIMEAGIQAAAGMLPFPPGFLKGVRELTKKYDTLMIVDEVATGFGRTG-
A6UV23_META3          LIESHKEELFCVILEAGVMGSAGIIPYPDGYIEKVAELCKKHNIILILDEVAT-YGRLG-
BIOA_ANOFW            LFAEHHEEIAAMIVEGMIQGAGGMHVMPKGYLKGVEQLCRQYNILFIVDEVATGFGRTG-
BIOA_STAA8            ILIERNDEIAGFILEPLIQGATGLFVHPKGFLKEVEKLCKKYDVLLICDEVAVGFGRTG-
BIOA_GEOSL            IMESHAGEVAGLVIEPLVQGAGGMIVQPEGFLKGVRELCDRHDILMIADEVAVGFGRTG-
BIOA_DESVH            LMRHHGHELCAVVVEPLVQGAAGMLVQPRGWLRGLRDLCDRHGVFMVADEVAVGFGKTG-
A0A0A7V3N7_9ARCH      KLEK-DNSIAAFVMESGAQMAGGVIIYPKNFQKRISQICKKNDVLFVLDEIATGFGRLG-
A0A2H1EHY1_9ARCH      IFVK-NSDIAAFVMESGAQLAGGVVVYPKDFQKKVSKLCKKHDVLFILDEIATGFGRLG-
A0RW95_CENSY          RFA--DGTIAALAMESGAQVAGGVRIYPRGFQRRVSRICKRHGVLLILDEVATGLGRLG-
A0A060HGF1_9ARCH      TLKKLDGKCAGLVMESGAQIAGGVVIYPQKYQQKISELCKKYDTLLILDEIATGFGRLG-
A0A2K5ASF4_9ARCH      ELKRGEGRVAAVVMESGAQIAGGVIVYPDGYQREVSRLCKRYDTLLVLDEVATGLGRLG-
BIOA_HELPJ            LLDKHGEEICAFIAEPLLQCAGNMHIYSAKYLKQAVLWCKQKNIHIIFDEIATGFGRTG-
Q7VGW0_HELHP          ILKHHAHRICAFILEPLLQCAGGMNMYPAAYIKEACALARKHNIHIIFDEIAVGFGRTG-
Q30R13_SULDN          LCEKRAKEISAIILEPLIQGAGYMHMYHKEFLILVREICNRYDIHLITDEVMVGFGRSG-
BIOA_LYSSH            QLRMHHKEITAVIIEPLIQAAAGMKMYPAIYLRRLRELCTQYDVHLIADEIAVGFGRTG-
D3E0W0_METRM          AFEEHGHETCAMIIEPLIQGSAGMKIYPPLYLKKLRELCDKHDVLLIADEIATGFGRTG-
Q8RET8_FUSNN          LIIKNHNEIACMIVEPMVQGAAGIKIYSAKFLKAARDLTKKYNIHLIDDEIAMGFGRTG-
Q83CU4_COXBU          LFEPHAETATAILVEPIVQGASGMKIYSQDFLARLFQWAKNNHIHFIADEIMTGIGRTG-
Q5ZVG9_LEGPH          QLNKICDKVCAILLEPIIQGAGGMLCYSADFLSKISSWAKEKDIYLIADEIMTGIGRTG-
Q5NGB1_FRATT          YLEQHKEFINALIVEPICQGAGGMLIYSKDYLNILCKWCKENDIYIIFDEIMTGLGRLG-
Q7NQD0_CHRVO          LLAKHGGEIAAVIVEPLVQGAAGMAMHDPIYLTELRRLCDQYQVHLIADEIAVGFGRTG-
Q0KF89_CUPNH          LLRERAGQIAALIVEPLVQGAAGMAMYDPSYLDGARALCDRYRIHLIADEIAVGCGRTG-
Q82Y62_NITEU          YLTQHHASTAALILEPLVQGAAGMGMYHPVYLQKAREICDTYRIHLITDEIAVGFGRTG-
Q9PGV9_XYLFA          LFKRYSGQICALILEPLLQCAGGMRMHHPVYLHRVRELCDAHGALLICDEIATGFGRTG-
                                 .  *        :                      : **:     : * 

BIOA_ECOLI            KLFACEHAE-------------IAPDILCLGKALTGGTMTLSATLTTREVAETISN-GE-
Q3IGS5_PSET1          KLFAVEHAN-------------IQPDIMCIGKALTGGAMTLSATLTSDKIATGISE-GE-
BIOA_BUCAP            KFFAFQHAN-------------VIPDILCLGKAMTGGTITLAATLTSRNIAHTISS-SK-
Q8D2A2_WIGBR          KLFACNYSK-------------ITPDILCIGKALTGGAITLAATITKRKVSETICN-KK-
BIOA_HAEIN            KLFAAEHAG-------------ISPDIMCIGKALTGGYLTLSASITTTEIAQTICS-GE-
Q4FUW1_PSYA2          KLFACEHAN-------------ISPDIMTIGKALTGGYMTFAATLCTRSIADTISQ-SD-
Q8EDK5_SHEON          KLFAYEHTD-------------ITPDILCLGKALTGGYISLAATLCTDNVAQGISQ-SP-
F8E3L0_FLESM          KMFAFEYSD-------------IAPDIICLGKAITGGYMSFAAVGTTKNIMDVICN-SKS
BIOA_MYCTU            ALFAADHAG-------------VSPDIMCVGKALTGGYLSLAATLCTADVAHTISA-GAA
BIOA_STRCO            ALFAAEHAA-------------VTPDVMCVGKALTGGYLTMAATLCTSRVAEGISR-GEV
Q6A946_CUTAK          KLFACEWAD-------------IVPDIMVVGKSMTGGYLTQSAVLCSDELASEVSR-GPG
A1R3R5_PAEAT          KLFAAQHAG-------------VVPDILCVGKALTGGYLTLAATLCTGDVARTVSA-GEA
Q6NHE7_CORDI          NLFATQAAK-------------VTPDILCVGKSLTGGFMSLAATITTDAVAESISS-AAG
C4LIG0_CORK4          SLFTCEAAT-------------ITPDIMCVGKALTGGMMSFAATLTTRHVGDVIST-PQG
BIOA_CORGL            ELFATLSNG-------------LQPDIMCVGKALTGGFMSFAATLCTDKVAQLIST-PNG
D5AS68_RHOCB          SDFALHRAG-------------VVPDILCLGKALTGGMMSLAATVATRDLAGRV------
D9S547_FIBSS          PRFAMMHTATQ------DCADFIKPDIMCVGKALTGGSITMAACVASEKVADTITN-SK-
Q1QYE0_CHRSD          RMFAADHAD-------------VTPDIMVLSKGLTGGYLGHAATLATDRVHSAFIG-DSP
Q2G8N6_NOVAD          AMFACQ-------------IAGVQPDIVTLSKALTGGNLPLAATIASGRIYDAFLS-DDP
Q0APZ8_MARMM          TMFAAE-------------KAGVTPDIMTVSKALTGGTLPLAATLVSTRLFELFWD-EDP
Q5FT00_GLUOX          TMFACE-------------QAGIVPDIVALSKALTGGTMALAATVARRGVFEAFLS-DSA
Q0C2S8_HYPNA          EMFAAA-------------RAGVTPDIMCLGKAITGGITPLAATLASSKVYAAFHS-ENP
Q7UUH3_RHOBA          KMFAVDHTA--------DLQSPVVPDILCLGKALTAGTMSMAVTIARSHVFDSFYS-DDP
B9KIG2_ANAMF          TMFACEQAQ-------------ISPDIMVLGKAMTGGMCPLSATLVSSEICGPFKL-CG-
Q2GKM0_ANAPZ          TSFACEQAS-------------IQPDIMVIGKALSGGTCPLSAAVVSSNISELFIS-GG-
Q3YS86_EHRCJ          TMFGCNQAN-------------IVPDIIVIGKALTGGFCTLAATLTTQEVYDAFLS-DNI
Q1MR96_LAWIP          TYFAFEKLD-------------VIPDFLCLSKGLTGGFLPLALTITTDEIYNAFLH-EEW
Q2GDE8_NEOSM          KMFASDYIL-------------SKPDILCLSKGLTGGFLPLSLTITTERVYNAFLS-DNF
A0A110AW55_9CYAN      DWFACHKAG-------------VSPDILCLSKGITGGFLPFAVTVCSEEIYHAFYD-DEP
Q7V5Q5_PROMM          ALFAFKRAG-------------LAPDLIALSKGLTGGFLPMGVTMAREEVFEAFLG-DDP
Q2W3K8_MAGSA          EIFACVKAG-------------ITPDLICLSKGLTGGFLPLSVTVARDGIFEAFLG-QDL
Q8DHL4_THEEB          ALFACEKAG-------------TQPDLLCLSKGLSGGCLPIAVTLTTEEIYQAFYA-DDP
Q982F8_RHILO          TMFACEQAS-------------ISPDILCTSKGLTGGTIPLAATLATDAIFQAHYS-EDR
C1ABK6_GEMAT          PLFACDRAD-------------VRPDLLCMSKGLTGGLLPLGATAATEDIFDAFSS-TDR
G8TFC7_NIAKG          KLFSSLYAE-------------EKPDIICLSKGITGGTMALGVTACTDKIHAAYVD-DDR
F4C5P8_SPHS2          KLFAADYLH-------------TQPDIMCLSKGLTGGTLPLGVTSCTEPIYHAFLS-NDR
A0A6N4SUR2_CYTH3      NAFASQYCT-------------TTPDIMCFSKAITGGLLPLGVTTCSREVEAPFLS-GEL
Q8F499_LEPIN          SVFAYQRAK-------------IRPDFIALAKGLSAGVSAVAVTLTTDRIHSAFVT-ADP
Q1DFH5_MYXXD          ARFAVDLAG-------------VVPDMLCLAKALSGGILPFGATLASERVFSGFLG-AS-
BIOA_AQUAE            TMFYCEQEG-------------VSPDFMCLGKGITGGYLPLAATLTTDEVFNAFLGEFGE
A6UV23_META3          KYLFSDNETLK---------KLNKPDIICIGKGITGGYLPLALTITTEEIYNEFLGDFKD
BIOA_ANOFW            KRFAIEHED-------------VQPDIMTVAKGITGGYLPIAATLTTEAIYEAFYGDYTE
BIOA_STAA8            KMFACNHED-------------VQPDIMCLGKAITGGYLPLAATLTSKKIYNAFLSDSHG
BIOA_GEOSL            AMFACGREG-------------ITPDIMALSKGITAGYMPLAATLATQQVYDAFLGEYRE
BIOA_DESVH            TMFACEQEG-------------VVPDMLCLAKGITGGYLPLAATLVTEHIHDGFLGGYAD
A0A0A7V3N7_9ARCH      SMIEYQSQN-------------STPDIVSFGKMLTGGYQTFAATLTTKKINDSFLGEFSQ
A0A2H1EHY1_9ARCH      SMIEYQAQQ-------------SIPDIVSYGKMLSGGYLPLAATLANKKVYDSFLGEYKD
A0RW95_CENSY          SMAEYEAQG-------------GRPDIAAYGKMLTGGYLTMSATLATKKVYDSFLGGYDE
A0A060HGF1_9ARCH      NMVEYLAQN-------------SKPDIVCMGKALAAGYFPLAVTLAHEKIYDAFLGSYEK
A0A2K5ASF4_9ARCH      SMVEYIAQD-------------SMPDIVAFGKMLTAGYLPLAATLASDEIFNAFLGKYDE
BIOA_HELPJ            SMFAYEQ-------------CGIKPDFLCLSKGISGGYLPLSALLTHNEIYNQFYAPYEE
Q7VGW0_HELHP          SMFALEQ-------------CDVTPDFLCLSKGITGGYLPLSVVVTSNNIYEGFYAPYEE
Q30R13_SULDN          DMFACKS-------------ANITPDFLILSKGLTGGYLPLSVVLTTDEIYTSFYCDYSE
BIOA_LYSSH            TLFACEQ-------------ANISPDFMCLSKGLTGGYLPLSVVMTTNDVYQAFYDDYAT
D3E0W0_METRM          KFFAVDH-------------ANITPDIMCVSKGLTNGYMAMAVACTTDEIYNAFYGDYED
Q8RET8_FUSNN          KMFACEH-------------AGIEPDMMCIAKGLSSGYYPIAMLCITTDIFNAFYADYKE
Q83CU4_COXBU          KMLACEH-------------AGIIPDFVCLSKGLTSGYLPFSAVLTSDEIYQLFYDDYQT
Q5ZVG9_LEGPH          EWLACDH-------------ARIQPDLICLSKGLTSGSIPFSCVMIDSTLFDLFYDDYHT
Q5NGB1_FRATT          KLFAYEY-------------LDITPDFLCVSKGLTSGIIPFSIVLTKNQYYEMFYDDQLT
Q7NQD0_CHRVO          SFFAYQQ-------------AGITPDFLCLSKGITGGFLPLSCVLTRDEIYQAFYHDDVA
Q0KF89_CUPNH          TFFAWEQSRAGEAPLP----AHLWPDFLCLSKGISGGYLPLSLVLSRPEIQRAFVADELA
Q82Y62_NITEU          TLFACEQ-------------AAITPDIMCLAKGLSGGYLPLSVVLTNDTIYRAFYSDQTS
Q9PGV9_XYLFA          TLFACEQACPVILTDTDDKQLGIMPDLLCLSKGLTGGFLPLAAVLTTQQLYEEFLDDSRE
                                              **.   .* :: *    .                  

BIOA_ECOLI            AGCFMHGPTFMGNPLACAAANASLAILESGDWQQQVADIEVQLREQLAPARDA-----EM
Q3IGS5_PSET1          AGVLMHGPTFMGNPLACAVACASIDLLLEQNWQQRIANLNSQL-QQLNKCKEL-----DD
BIOA_BUCAP            VSCFMHGPTYMGNPLACAVANANIKILEKNEWKKQVINIEKQLCQSLLPLIHH-----PR
Q8D2A2_WIGBR          TPEFMHGPTFMANPLSCAASCANLSLIEEGKWIQQVKFIYQEMCKYLYPLIEH-----SY
BIOA_HAEIN            AKCFMHGPTFMANPLACAIAAESIRLLLESPWQQNIQRIESSLKQQLSPLSEK-----DY
Q4FUW1_PSYA2          YSALMHGPTFMGNPLACAVACASIDLILSYDIEARTENMHALMVEQLASAAKL-----EG
Q8EDK5_SHEON          AGVFMHGPTFMGNPLACAAACASLDLINQQEWPAQVAAIEQQMQRELADAIDI-----PS
F8E3L0_FLESM          VGAFMHGPTFMANPLACECANASINLLQKTDLTKTLIGIQKIISDYFAEAAEF-----PF
BIOA_MYCTU            G-ALMHGPTFMANPLACAVSVASVELLLGQDWRTRITELAAGLTAGLDTARAL-----PA
BIOA_STRCO            P-VLAHGPTFMGNPLAAAVACASIGLLLGQDWLAEVKRIETGLGEGLAPAAGL-----PG
Q6A946_CUTAK          G-SLMHGPTFMGNPLASAVAAASLAIISQGQWNDDVTRIADVMSRELASLRNV-----PG
A1R3R5_PAEAT          G-ALLHGPTFMANPLACAAANASLGILAAGGWSADVARVGAALMAGLAPAVKL-----DA
Q6NHE7_CORDI          GGALMHGPTFMGNPLACAVASEALSIIAEGDWKQQVAEIESELKKGLVPLASN-----PA
C4LIG0_CORK4          GGALMHGPTFMGNPLACSVARAAGDLIDDGYWRSTVPRIEQELRHGLAPLADA-----EQ
BIOA_CORGL            GGALMHGPTFMANPLACAVSHASLEIIETGMWQKQVKRIEAELIAGLSPLQHL-----PG
D5AS68_RHOCB          -GALMHGPTFMANPLACAVAAAAMDLWQGHDWSAEARRIEAQLTQELAPARGF-----AG
D9S547_FIBSS          IPAFMHGPTYMANPLACAAGIASLSLFESRDYASSVARIEKRLKANLEPLRSL-----EN
Q1QYE0_CHRSD          EHAFMHGPTFMGNPLACRVALESLAVFEEDDYLGRIQTLNGVLREELRDDAALRAH--PA
Q2G8N6_NOVAD          MHALMHGPTYMGNALGCAAANASLDLFESEPRLEQAQAIGRGLEQALEVLRGL-----PG
Q0APZ8_MARMM          GKALMHGPTYMGNPAACAAANASLDLFEHEPRLAQVHAIEAMFAALLPTARDF-----PG
Q5FT00_GLUOX          GHALMHGPTFMANPLACAVANASLDLFETEPRLEQVATISAQLARELEPCRTL-----PG
Q0C2S8_HYPNA          DHALMHGPTYTGHALACAVANAGLDLFADGSLIKRVKKLEASLTSALAPAKDM-----DS
Q7UUH3_RHOBA          GAALMHGPTFMANPLACSAANASLDLFEGNP--YDVEKIETILRERLSVLRDI-----DN
B9KIG2_ANAMF          -ERLMHGNTFAANPLACAAANASLDLFEDGSLMRRVQVIEERMSRGLEPLKGL-----KY
Q2GKM0_ANAPZ          -ETFMHGNTFMAHPLSCAAANASLDLFAGESYTQKVSGIERILKAELEELHAL-----DY
Q3YS86_EHRCJ          DDAFMHGPTFMANALACAAANASLDIFESQDLIRNIGLIENQLKSELGVFKQL-----DC
Q1MR96_LAWIP          KYALAHGHSFTANPLGCAAALASLKLLLHEKTTLAMQSIHQAHIDG---ISFLQKSCSNV
Q2GDE8_NEOSM          SSALIHSHSYTGNPLGCAAAIASLELLKSTSTLDKIAKIEQLHRSF---ICDLKLTLPEI
A0A110AW55_9CYAN      LKTLYHGHSYTANPLGCAAALAGLELMTEY--EPQFRSMEAKHYA----QLAQLKDHPAV
Q7V5Q5_PROMM          SLTLWHGHSFTANPLGCAAANASLDLLEAN--PESYENFEARHRP----HLEALAEHPKV
Q2W3K8_MAGSA          SRAFLHGHSYTANPLGCAAGLTSIDLLESAACQQRIGAIEAIHRR----RLDGLKGLSNV
Q8DHL4_THEEB          ARAFFHSHSYTGNPLACAVSVASFQLLLAH--PEAYQGLEARHWQC---QQRYLADVSHL
Q982F8_RHILO          KKTFFHSSSYTANPIACGAALANVEIWRDEPVAERIAALSAMQ----AAGLRRFGDNPRF
C1ABK6_GEMAT          RKTFFHGHSYTANPIACAAALASLQLFDEDSEDER-VRIEVAH----MRHLATLEGTKGV
G8TFC7_NIAKG          TKTFFHGHSFTANPLACAAALASMDLLLKPDCQQQIARISEQQQQFVLQLSTDKRFETQV
F4C5P8_SPHS2          TKTLFHGHSYTANPLACVAALASLDLLLKEETRLCIQRITTRH----IDFARSIRGHRNV
A0A6N4SUR2_CYTH3      RRAFFHGHSYTANPTICQLALASLKLFESETCQNNIKRIGAAH----QAFVLTHVNHRHI
Q8F499_LEPIN          EKGFYHGHTMTGNPIACSAALASLKIFFEENRLEQILRLESKLNVG---LKKIAKEFPKA
Q1DFH5_MYXXD          NRALYYGHSYCGNPLGAAIAREVLAVYRDEDVMGQVARKAPRVKAAFERMAASI----PG
BIOA_AQUAE            AKHFYHGHTYTGNNLACSVALANLEVFEEERTLEKLQPKIK----LLKERLQEFWEL-KH
A6UV23_META3          CVQFFHGHTYTGNQLLCASAIATLDVLEDDKIFENTKDKIK----YLHNSMDKLKEL-NN
BIOA_ANOFW            FKTFFHGHSYTGNQLGCAAALANIQIFERERLIEQIQQKAT----FVAEQLASFNEL-NH
BIOA_STAA8            VNTFFHGHTYTGNQIVCTVALENIRLYEKRKLLSHIETTSS----TLEKQLHALKRH-RN
BIOA_GEOSL            MKTFFHGHTFTGNPLGCAVALASLDLFESDRLLGKLPNKIK----LLQEKLKGLIEL-EH
BIOA_DESVH            FRTFFHGHTYTGNALACAAALASLDVFEEERTLETLRPRIE----RLATLLAPLNDL-PH
A0A0A7V3N7_9ARCH      FKHLFHGHTYTGNPTAAALSLKNLELYKKYHLIEKIQKTSK----IFKDRLDDISNL-DL
A0A2H1EHY1_9ARCH      MKHFFHGHTFTGNPLACATALSNISLYKKYNLIYKIKKRAA----QMQSYIDTISGL-KL
A0RW95_CENSY          NRHLFHGHTYTGNPLAAAAAIENLRMYKRRNLLDKVAKGAR----VLGGYTEEISGM-GR
A0A060HGF1_9ARCH      NKHFYHGHTFTGHPVGCAAALANLELYEKRNLMQQIKKNAQ----YIKQRLGEFEEI-GV
A0A2K5ASF4_9ARCH      GKHLFHGHTFTGNPIACACAVANLRLYEQERLISKVKSSSA----LLAERLEEFRGY-PI
BIOA_HELPJ            NKAFLHSHSYTGNALACACANATLDIFEKENVIEKNKALSEFIFSALQNALKPLIER-QV
Q7VGW0_HELHP          QKAFLHSHSYTGNALAIAAANAVLDIFEQDDIIFSNHSLS----VAIVKRWSMLAKH-KK
Q30R13_SULDN          NRAFLHSHSYTGNALACAAANATLDIFENENIIEKNQEIA----NYMAEELLKFKTL-KN
BIOA_LYSSH            MKAFLHSHSYTGNTLACRVALEVLAIFEEEQYIDVVQDKGE---RMRKLALEAFSDL-PF
D3E0W0_METRM          NIAFMHSHTYAGNPLAASVANATLKIMERDRIIENNQEKAI---WLNKRFHNTFDEH-PN
Q8RET8_FUSNN          GKSFLHSHTYSGNPLGCRIALEVLRIFKEENILKTINEKGT---YLRNKMKEIFEDK-SY
Q83CU4_COXBU          GKAFLHSHTYSGNALAAAVALATLKVFSEEKICARAHKLGK---FMLEKMTQVAQET-GQ
Q5ZVG9_LEGPH          GKSFLHSHTYSGNPLAIVAALATIKTIEQDNLLMHSQELGK---IMFSYLQDIARDS-RK
Q5NGB1_FRATT          -KAFLHSHTHSGNVLGAVVANAVLDIFEEENILTNVKDLEK---QFSESFLELQEQL-PI
Q7NQD0_CHRVO          -RGFLHSHSYTGNALACAAALAVLDIFDDEDVLEANRVKAE----GFTRQMRPLAER-PE
Q0KF89_CUPNH          -RSFLHSHSYTGNPLACRAALATLDLFAQDDVLARNRERAH----WLADGMAALAAD-AR
Q82Y62_NITEU          -QAFLHSHSHSGNALACRAALATLDIIEQDNVIETNRHKTK----FLNQCLQSVRTH-PN
Q9PGV9_XYLFA          -RAFLHSHSYTGNPLACIAALTTLDIFENDCIIERNQVTAA----RMTQLAASLSGH-PH
                         : :. :  .:      .                                        

BIOA_ECOLI            VADVRVLGAIGVVETTHP-----------------------VNMAALQKFFVEQGVWIRP
Q3IGS5_PSET1          VADVRTLGAIGVVELTAEAG--------------------NVDVAKIQAYFVAQGVWIRP
BIOA_BUCAP            VVDVRVLGAIGVVECFHF-----------------------VNMALIQKFFVKNGVWIRP
Q8D2A2_WIGBR          VKDVRILGAIGVVETKFF-----------------------VNLENIQNWFVRHGAWIRP
BIOA_HAEIN            VKEVRALGAIGVVEMKSA-----------------------VNMKTLVPRFVEQGVWIRP
Q4FUW1_PSYA2          VKEVRCLGAVAVIELDDA-----------------------VDMPTFQSLLIEHGIWVRP
Q8EDK5_SHEON          VKAVRVLGAVGVLEMHQA-----------------------VNTAALQQQFVDLGVWVRP
F8E3L0_FLESM          VKDVRVLGGIGVIETFNN-----------------------VDSNSLTDKFVKKGVWVRP
BIOA_MYCTU            VTDVRVCGAIGVIECDRP-----------------------VDLAVATPAALDRGVWLRP
BIOA_STRCO            VRDVRVLGAIGVVQLDHA-----------------------VDMRAATKAAVREGVWLRP
Q6A946_CUTAK          VIDVRVFGAIAAVQVDTP-----------------------IVMRRATRTAVENGVWLRP
A1R3R5_PAEAT          VADVRTFGAVGVIELTDA-----------------------VDVTAVTRAAVKHGVWVRP
Q6NHE7_CORDI          VRDVRVLGAIGVVEMKEP-----------------------VDMKRATHAAVNAGVWLRP
C4LIG0_CORK4          VSSVRVLGAIGVVELAHP-----------------------VDMKVATKVAVESGVWLRP
BIOA_CORGL            VADVRVLGAIGVIEMEQN-----------------------VNVEEATQAALDHGVWIRP
D5AS68_RHOCB          VADVRCLGGIGVIEMKAP-----------------------LPLAPIHRFCAQTGVWLRP
D9S547_FIBSS          AADVRVLGAIGVLELKAK-----------------------PSADDILRVIRETGVWLRP
Q1QYE0_CHRSD          VADVRVLGATAVIEVHDA-----------------------AALAGVADFARERGVWLRP
Q2G8N6_NOVAD          VRDVRVRGAIGVIQLDRT-----------------------APADRLSAACIDRGVWLRP
Q0APZ8_MARMM          VVDVRWQGAIGVIEMASL-----------------------PELDVLKACFVDAGVWVRP
Q5FT00_GLUOX          VKDVRVLGAIGVVELETL-----------------------DDPDALRRAFVERGVWIRP
Q0C2S8_HYPNA          VVDVRVLGAVAAVELADP-----------------------FPIEAARKWFIDEGTFIRP
Q7UUH3_RHOBA          VADVRCFGAIGVVQFRDP-----------------------PKMQMVQDELVRRGVWLRP
B9KIG2_ANAMF          VHNIRVKGAVAAMEIAAGNF--------------------DHLQENFLRKLIDCEIWIRP
Q2GKM0_ANAPZ          VCNVRIKGAMAAFNIKNECV--------------------EKLKNGMTQKLLDLGIWIRP
Q3YS86_EHRCJ          VTDIRVKGATGVIELKDGLI--------------------D--KHDIINKGVELNIWIRP
Q1MR96_LAWIP          TKT-RVLGTISAFEL-----------------------HDTTHIKQIESSFLANGLLLRP
Q2GDE8_NEOSM          IKAERVCGTIVAFNLFSEEC-----------------NYNHTIAVKLREIFMKEGLLIRP
A0A110AW55_9CYAN      EKL-RVTGTIAAMDLVTQERS----------------GYLNTISLEIRQRAIAKGLLLRP
Q7V5Q5_PROMM          QQP-RLTGTIAAFDLAIDGTH----------------GYLNPAGRIVKQQAINNGVFLRP
Q2W3K8_MAGSA          AHT-RLTGTVAALDVIGGGK-----------------GYEAGIGPKLKAAFLERGLLLRP
Q8DHL4_THEEB          KQF-RTCGTIAAMELETEAS------------------YFSDLVPQLRRRFIELGVLLRP
Q982F8_RHILO          TDS-RVTGTIAALDLR-TSSA----------------GYLADIGPKLRAFFLERGLLVRP
C1ABK6_GEMAT          RAV-RQIGTVAAVEL--DAPD----------------GYLSDIGRELAAFSLEQGILLRP
G8TFC7_NIAKG          KNV-RSIGTIMAFEIESG-RD----------------GYLNTIGMDVTRKALAQGVYLRP
F4C5P8_SPHS2          QTI-RFLGTILAIEWRSDDVT----------------NYFNPLRDQLYDYFLQKGILMRP
A0A6N4SUR2_CYTH3      KRI-ESLGTILSVEIKTGQQA----------------NYEHDIRHFLYDFFIKKGILLRP
Q8F499_LEPIN          VKNCRVLGAVGVLELEVGKAS----------------GYHYPGNKILKKKFLEKGVLLRP
Q1DFH5_MYXXD          LVRPRAVGMVGAVDLGGG-------------------GYLARGGWRVYEAARRRGLYLRP
BIOA_AQUAE            VGDVRQLGFMAGIELVKD------------KEKGEPFPYGERTGFKVAYKCREKGVFLRP
A6UV23_META3          VGDIRKKGFMIGIELVKD------------KETKEPFPYEFKAGYKVADKLLEKGIYMRP
BIOA_ANOFW            VGDVRQLGLMCGIELVRD------------RRTHEPYPWTERMGYRTTLTMREKGMLTRP
BIOA_STAA8            VGDVRGRGLMFGVELVTD------------K--DSKTPLEIEKVERIVRNCKENGLMIRN
BIOA_GEOSL            VGDVRQCGMIAAVELVRD------------RATKEPFDWEERVGVRVCLEARTHGVFLRP
BIOA_DESVH            VGDIRRVGVMTGIELVAD------------RETRTPYRPEERIGHRVTLEARRRGVIVRP
A0A0A7V3N7_9ARCH      VGEIRHQGMVMGIELVQN------------KNSNKPLSSNISINKLVFEEGRKHQIYFRT
A0A2H1EHY1_9ARCH      VGDVRHKGMMMGIELVTD------------KSKKTPISPDKKIPQKIFTEAKKHGIYQRT
A0RW95_CENSY          VSDVRHAGMLMGIELSRG------------APKGGP-----STNKIIFEAGRRNGVYLRT
A0A060HGF1_9ARCH      VADVRHSGMLAGIELAR-----NGK-------PLMHLKSKERIDYFVARESLAMGVHLRA
A0A2K5ASF4_9ARCH      VGDVRHKGMLAAIELVKGNSNSNSKSNSKSKDPLLTLSDGRRINYAIMEEALKRGLFIRP
BIOA_HELPJ            VSDLRHLGMVFAFEVFLQ--------------------TKERLSLAVFKKALKKGLLLRP
Q7VGW0_HELHP          VGNLRVCGMVFAFDLQGC--------------------KLKRAGLYVYENALAKGVLLRP
Q30R13_SULDN          VLSIRQTGMVCAVELKGYD-------------------SKDRIGLKVYEYGLKNGVLLRP
BIOA_LYSSH            VGEYRQVGFVGAIELVANRDTK------------EPLPSEERIGYQIYKRALAKGLLIRP
D3E0W0_METRM          VGEIRQMGLINAIELVEDKESK------------KGFDSSLRIGYKIYREALKDGLMLRP
Q8RET8_FUSNN          IKDIRNIGLIGAIELKDN------------------LLPNVRIGKEIYNFALKKGAFLRP
Q83CU4_COXBU          LENVRGIGALVAADLIPQPG-------------------RLRLGYEVYQEAVKQGVLLRP
Q5ZVG9_LEGPH          LVNVRGVGAVVAADFIESS--------------------QARIGFKIYQEAIKQGALIRP
Q5NGB1_FRATT          IKNVRGIGAVIAADLNIDK---------------------KRAGLDVYREAIKLGALLRP
Q7NQD0_CHRVO          IRHFRQRGMIWAFDV--DTAR-------------------SDFALAYFSAMLNRGCLLRP
Q0KF89_CUPNH          LRHVRQRGLIWAADVRDDVAG-------------------ADFAARFHHAARERELLVRP
Q82Y62_NITEU          VRHFRNCGMIWAFEV--DNPR-------------------PDFTNRFAQMGLERQLLIRP
Q9PGV9_XYLFA          VADVRQAGMVVAFELTRDGNKR------------TPFPLQARLGLHVYRAALARGVILRP
                          .  *     :                                            * 

BIOA_ECOLI            FGKLIYLMPPYIILPQQLQRLTAAVNRAVQ------DETFFCQ-----------------
Q3IGS5_PSET1          FGKLIYLMPPYISDQSSIKTLCDAIYNAIK------GKHYA-------------------
BIOA_BUCAP            FKKIIYIVPPYIISMNCLKKLINVIEKSLD------NDTLFNVENI--------------
Q8D2A2_WIGBR          FRKLIYLIPPYIISSYELKFLIKLISLSLN------DDKNFLYIKN--------------
BIOA_HAEIN            FGKLVYVMPPFVIKDDELQKLTEGMILALT------QEYEH-------------------
Q4FUW1_PSYA2          FGKLVYIMPPYIITDSELITLCQALLKVVS------IYLTQTSLSAKG------------
Q8EDK5_SHEON          FANLIYIMPPYVISSAQLSQLTQAMKQVAA------TITPPNITPPNTTPELASQGWHTD
F8E3L0_FLESM          FKNLIYIMPPYIISEESLRKLCKAVLEGLW------EELSKK------------------
BIOA_MYCTU            FRNLVYAMPPYICTPAEITQITSAMVEVA-------RLVGSLP-----------------
BIOA_STRCO            FRDLVYTMPPYVTGDADVARIARAVCAAA-------REG---------------------
Q6A946_CUTAK          FRDLVYAMPPYICTNDDLEAMAAGMRAVVIDQLDAAQDNTDYRKES--------------
A1R3R5_PAEAT          FRNLVYAMPPYVSTAAEVGMMAAAMVAAV-------EETSNQRVAA--------------
Q6NHE7_CORDI          FGRLVYTMPPFVCTHKQIQKISCAIASIV--------HTEQERFER--------------
C4LIG0_CORK4          FGKLVYSMPPFISTSSDIEKICAAMRNIV--------AASA-------------------
BIOA_CORGL            FGRLLYVMPPYITTSEQCAQICTALHAAV--------KGK--------------------
D5AS68_RHOCB          FGRVLYAMPPLTIGPDDLSRVTAAMRTIAGGL----------------------------
D9S547_FIBSS          FCNYVYTMPPFITSDAEVERICEAIKMIGKCEPAPIVDGEDEFHE---------------
Q1QYE0_CHRSD          FGRWLYTMPAYVTSTHDLRRITEVMKHWFI-------DRRAP------------------
Q2G8N6_NOVAD          FRDILYTTPPLVTGEEDLARITSAMVEAVT-------EWSRETHV---------------
Q0APZ8_MARMM          FNNIIYLMPPYVISAEDLTVLIDTTLRVTE-------GWARRHFS---------------
Q5FT00_GLUOX          FRNIVYLTPAFTIMPEELTRLTTAIVDVLR-------EGA--------------------
Q0C2S8_HYPNA          LGRTVYLSPAYGISDDDLARLTGAILKFAK-------TGISDIG----------------
Q7UUH3_RHOBA          FGDCLYTTPPLCINEDALHRICDAMIEATR-------ATMPRSDSPMCNQLR--------
B9KIG2_ANAMF          IGNTVYLMPPLIISDAELEHLLTAVCTLVHSCRERLELVV--------------------
Q2GKM0_ANAPZ          IKTVMYVMPPLTIAEDELLALLSALKTLVYECRR--------------------------
Q3YS86_EHRCJ          LNNVIYVMPPFIINSNELTQLITSIYKILKSNI---------------------------
Q1MR96_LAWIP          LHNVIYIIPPYSTNYKELMDAYNKICKIL-------------------------------
Q2GDE8_NEOSM          LGNTIYLMPPYCISEKALKEAHCKVMELISSIAGSFT-----------------------
A0A110AW55_9CYAN      LGNVLYILPPYCIRDAELSQIYQGIEEILTDLSKDFLI----------------------
Q7V5Q5_PROMM          LGQVVYLLPPLCLNDAQLEQCYAAINLGLEAL----------------------------
Q2W3K8_MAGSA          LGNVLYLLPPYCITDAELERAWDAVDEVLRSLAK--------------------------
Q8DHL4_THEEB          LGNTLYILPPYCISDAELATVYRAIRQVAIEVAEGYFA----------------------
Q982F8_RHILO          LGNVLDLMPPYCITGDELDGLYDAIEEAAERFGSRP------------------------
C1ABK6_GEMAT          LGNVAYCLPPYCTTDREIDAVYAVLQRFLDGERAAPIGTGGPFDD---------------
G8TFC7_NIAKG          LGNTVYIMPPFCITAEQLDKVHNAIINILATIE---------------------------
F4C5P8_SPHS2          LGNVIYLLPPYCIKDEELDYIYATIRLALEEVG---------------------------
A0A6N4SUR2_CYTH3      LGNIIYVFPPYIITDQELEKIYSAIVEMLGKLDDYLKNPGMN------------------
Q8F499_LEPIN          LGNVIYLTPPYNIENSSLEKIFSAIRETLSEISFGN------------------------
Q1DFH5_MYXXD          MGDTVYIAPALTISDEALEELLSGVEASLQEVAGG-------------------------
BIOA_AQUAE            LGDVMVLMMPLVIEEDEMNYVIDTLKWAIKELEKEV------------------------
A6UV23_META3          IFNTIIIVPPLTITAEEISFLVDGLYNSIKEIFE--------------------------
BIOA_ANOFW            LGDVIVFMPPLASTFEQLEAMIAMMKEAIIETTEKRG-----------------------
BIOA_STAA8            LENVITFVPVLSMSNKEVKTMVRIFKKAVHNILDRKC-----------------------
BIOA_GEOSL            LGNVIVIFPPLAITAEEIDFLVDGLEKSIHTVTGG-------------------------
BIOA_DESVH            LGDVMVLMPPLSITETELETLVHTVRGAIIAVTEHGADGGLWTKRPDGPDNPDKANTPDT
A0A0A7V3N7_9ARCH      LGNIIMLVPPLDISQKDLNFLIDGTISTIKSLSRKL------------------------
A0A2H1EHY1_9ARCH      LGNIIMIVPPLAISEQELDYMMRGIIKTIKNVTHLA------------------------
A0RW95_CENSY          LGDVVMLVPPLAMGPADLRRLVEGTVRAVREAPLDG------------------------
A0A060HGF1_9ARCH      LGNVMVVIPPLAIGRNDLEKMMDAHLELAKKAEKL-------------------------
A0A2K5ASF4_9ARCH      LGHIMLIVPPLAIGREELNMLIDKALEVVGTISKLV------------------------
BIOA_HELPJ            LNNTIYLMPPYIITHEEIKKAIAGLVEAIDELKKAENK----------------------
Q7VGW0_HELHP          LGNTIYFMPPYVINLE-IAEYVCNVLDAILEDDF--------------------------
Q30R13_SULDN          LGHVVYFMPPYIITNDEIKKMMQVAYEAIKELS---------------------------
BIOA_LYSSH            LGNVLYFMPPYIITDDEMQFMIQTTKDTIVQFFEEREG----------------------
D3E0W0_METRM          LGNVMYFNPPLVITKEELDESLAICKKAIDKVLLD-------------------------
Q8RET8_FUSNN          IGNSVYFMPPYVITYEEIDKMLHVCKESIEELLKI-------------------------
Q83CU4_COXBU          IGNTLYWLPPLNIDFDLIEVLQKVTKNAIKIL---SLGF---------------------
Q5ZVG9_LEGPH          IGNTLYWLPPLNTDKEIIGKLAEITLNSIEKAYNKAQGYE--------------------
Q5NGB1_FRATT          LGNTIYWLPPFNSTYQEIDLLKQITKQSIINAFK--------------------------
Q7NQD0_CHRVO          IGKSVYFMPPYTLKSEEMDWLASASVDALDEVLAGESVGGDPTALP--------------
Q0KF89_CUPNH          IGNTLYVMPPYVFDAAQARWLGEQMMATLDDVTTDVTTSGEVRHAA--------------
Q82Y62_NITEU          MGNSVYIMPPYIINEEEMEFMAQAILNILNEI----------------------------
Q9PGV9_XYLFA          LGDVVYWMPPYCVDEEQLHLLAETTRVAIDEAIACV------------------------
                      :                                                           

BIOA_ECOLI            -----------
Q3IGS5_PSET1          -----------
BIOA_BUCAP            -----------
Q8D2A2_WIGBR          -----------
BIOA_HAEIN            -----------
Q4FUW1_PSYA2          -----------
Q8EDK5_SHEON          QNISISHG---
F8E3L0_FLESM          -----------
BIOA_MYCTU            -----------
BIOA_STRCO            -----------
Q6A946_CUTAK          -----------
A1R3R5_PAEAT          -----------
Q6NHE7_CORDI          -----------
C4LIG0_CORK4          -----------
BIOA_CORGL            -----------
D5AS68_RHOCB          -----------
D9S547_FIBSS          -----------
Q1QYE0_CHRSD          -----------
Q2G8N6_NOVAD          -----------
Q0APZ8_MARMM          -----------
Q5FT00_GLUOX          -----------
Q0C2S8_HYPNA          -----------
Q7UUH3_RHOBA          -----------
B9KIG2_ANAMF          -----------
Q2GKM0_ANAPZ          -----------
Q3YS86_EHRCJ          -----------
Q1MR96_LAWIP          -----------
Q2GDE8_NEOSM          -----------
A0A110AW55_9CYAN      -----------
Q7V5Q5_PROMM          -----------
Q2W3K8_MAGSA          -----------
Q8DHL4_THEEB          -----------
Q982F8_RHILO          -----------
C1ABK6_GEMAT          -----------
G8TFC7_NIAKG          -----------
F4C5P8_SPHS2          -----------
A0A6N4SUR2_CYTH3      -----------
Q8F499_LEPIN          -----------
Q1DFH5_MYXXD          -----------
BIOA_AQUAE            -----------
A6UV23_META3          -----------
BIOA_ANOFW            -----------
BIOA_STAA8            -----------
BIOA_GEOSL            -----------
BIOA_DESVH            PDGARTGETVV
A0A0A7V3N7_9ARCH      -----------
A0A2H1EHY1_9ARCH      -----------
A0RW95_CENSY          -----------
A0A060HGF1_9ARCH      -----------
A0A2K5ASF4_9ARCH      -----------
BIOA_HELPJ            -----------
Q7VGW0_HELHP          -----------
Q30R13_SULDN          -----------
BIOA_LYSSH            -----------
D3E0W0_METRM          -----------
Q8RET8_FUSNN          -----------
Q83CU4_COXBU          -----------
Q5ZVG9_LEGPH          -----------
Q5NGB1_FRATT          -----------
Q7NQD0_CHRVO          -----------
Q0KF89_CUPNH          -----------
Q82Y62_NITEU          -----------
Q9PGV9_XYLFA          -----------