CLUSTAL format seed alignment for MF_00836

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PHNN_RHOPA            ----------MTDIAVAEQTTK-LIGPGRLVLVVGPSGAGKDTLINAARTLCAD--DPAI
Q132D6_RHOPS          ----------MTGIATVITQQS-RLGPGRLVLVVGPSGAGKDTLLGIAKAASLG--ESGI
PHNN_BRADU            ----------MSEIATMAQGEAGAIGPGRLVLVVGPSGAGKDTLLQLAQAACID--DHDV
F7QLQ2_9BRAD          ----------MSETVVLPDTSAGLIGPGRLILVVGPSGAGKDTLIGLAMAARTQ--DRAI
PHNN_METRJ            -------------------------MPGCLVLVVGPSGAGKDTLLRLARAALAG--DPRY
B0UIG1_METS4          ------------------------MRPGGFVLIVGPSGAGKDTLIRLARDALAA--EPRY
A7IEW5_XANP2          MNTRETGAGATLDHGPANTRPDALLGPGTLLLVVGPSGAGKDTLIDIARARFAD--NARV
PHNN_ACICJ            -----------------------MPRSGRLVLVVGPSGAGKDTVLREARRRLGH--APDI
PHNN_FRAIE            --------------------MTERIGPGAFVAVVGASGVGKDALMAYARERSE----AVA
A0A2T0VEJ5_9MICO      -------------------------MTGAFVAVVGPSGSGKDSIIEHTRAVLEG--RGAI
Q222Z5_RHOFT          -------------------------MSGLWVFVCGPSGAGKDSVMGWAATQLAA--RQDI
F5XZY7_RAMTT          -------------------MKQGRAPSGCWVMACGPSGAGKDSLLAWAEAALAR--EPRI
I4YSU9_9RHIZ          ----------------------------MFVAIVGPSGAGKDTVIRAVAEALRD--RSGI
RBKTP_CUPTR           -----------------------MNASGTFFFVVGPSGAGKDALMDGARAAL----DDNY
RBKTP_CUPNH           -----------------------MKATGTFFFVVGPSGAGKDSLIDGARAAL----DGDY
RBKTP_CUPPJ           -----------------------MKESGTFFLVVGPSGAGKDSLIDGARATLG---NDEY
RBKTP_AZOC5           ---------------------MSVMGSGLFFFVVGPSGSGKDTLIEGAKAALGP--TGRY
RBKTP_ROSDO           -------------------------MPGTLFLIVGPSGVGKDTLLEGARDRLAT--SRWF
PHNN_BRUAB            --------------------MQADTPKGCFVAVVGPSGAGKDTIMDAARVALSG--DMRF
A0A0F6AQX5_BRUA1      --------------------------------------------MDAARVALSG--DMRF
PHNN_BRUMB            --------------------MQADTPKGCFVAVVGPSGAGKDTIMDAARVALSG--DMRF
A0A0Q3HYG8_9BRAD      --------------------------------------------MEAGRAGLAG--DARF
F2J2Y5_POLGS          -------MTDSATDHRRVPAADGRIGPGRLVLVVGPSGAGKDTLMTALRAHLAG--DPRY
G8PLU0_PSEUV          -----------MTVLDKTSKQADKLGPGALVIVVGPSGAGKDTLIYGYRDRCEG--DANI
PHNN_CHESB            --------MFSASIERAQNEAPFPIRQGVFVAVAGPSGGGKDSVMAYARERLGNL-AGEI
PHNN_RUEST            ----------------MSVPADTSPAKGPVIAVVGPSGVGKDSLMSGLAVAD-----PRL
A0A2I7ITE3_9RHOB      --------------------MNTQPAKAPVIAVVGPSGVGKDSLMDALLERV-----PGL
A0A1G5PLS2_9RHOB      ----------------------MMSELGPVIAVVGPSGVGKDSLMLALAQAE-----PRL
Q5LW68_RUEPO          ------------------------MTQVPVIAVVGPSGVGKDSVMTALATRD-----PRV
A0A1Y5RRB4_9RHOB      ------------------------MTLATVIAVVGPSGVGKDSVMEALAARG-----DGL
Q28NE0_JANSC          ------------------MSSPEPTPKGRLIAVIGPSGAGKDSVMDGLCAAR-----PEL
F7ZHR0_ROSLO          -------------------MTRNATSGGRLIAVVGPSGVGKDSVMAGMRRAI-----PSL
PHNN_AGRFC            -----------------------------MIVIVGPSGAGKDTLMDYAAAQLSG--RPGF
PHNN_RHIE6            --------------MTHEPHPGAGAERGIMVVVVGPSGAGKDTLMNLAARHFSG--RADV
F7XGB4_SINMM          -------------------MTTADRVSGTLIVVVGPSGAGKDSVMGFAARHFAQ--RPDI
PHNN_PSEA7            -------------------------MTGRLIYLMGPSGSGKDSLLQAAREPLALRG---C
PHNN_PSEFS            -------------------------MAGRLIYLIGPSGSGKDSLLDAARPRLAERG---C
PHNN_AZOVD            -------------------------MGGRLIYLMGASGSGKDSLLEAVRERVLAAG---G
F4GUN2_PUSST          -------------------------MAGRLFYIMGPSGAGKDAVLQGLMGLMVDDD---C
PHNN_PSYIN            ---------------MPNSIIKKYPSKGKLFYVIGASGVGKDSLLHYARQRLANE---SL
Q31DU5_HYDCU          ---------------MPNQAHLK-PAPGTLFYVMGASGCGKDSLLHYARQQLASE---AV
PHNN_THIDA            ------------------------MSEGKLFYVIGPSGSGKDSLMRYGRERLAGDP--GV
PHNN_DESBD            --------------------------MSKLIYIMGPSGSGKDSLMAEARLRLAAEA--PV
B6WT50_9DELT          -------------------------MRGTLIYVMGPSGSGKDSLLSALRPRLRGL---PV
A1U7M6_MARHV          -------------------------MKGRLIYVIGASGSGKDTLIKAAATALAEHS--DI
PHNN_PANVC            --------------------------MARLIWLTGPSGSGKDSLLDALRAAPPPR----L
PHNN_DICZ5            --------------------------MARLIWLTGASGSGKDTLLDALRQTEPVR----L
PHNN_ECOLI            -------------------------MMGKLIWLMGPSGSGKDSLLAELRLREQTQ----L
PHNN_ECO57            -------------------------MMGKLIWLMGPSGSGKDSLLAELRLREQTQ----L
PHNN_SHIDS            -------------------------MTGKLIWLMGPSGSGKDSLLAELRLREQTQ----L
PHNN_ECOSM            -------------------------MTGKLIWLMGASGSGKDSLLTELRQREQTQ----L
PHNN_SALAR            --------------------------MGKLIWLMGPSGSGKDSLLAELRQQEHEQ----L
PHNN_ENTLS            -------------------------MTGKLIWLVGPSGSGKDSLLEALRKQEHPQ----M
PHNN_KLEP7            -------------------------MPGKLIWLVGPSGSGKDSLLAALRQREHPQ----L
PHNN_PECAS            --------------------------MTKLIYLIGPSGAGKDSLLRAIRQLPLPR----L
PHNN_PECPW            --------------------------MTKLIYLIGPSGAGKDSLLRAIRQLSLPH----L
PHNN_YERPE            --------------------------MARLIYLMGPSGAGKDCLLSALRNATPQN----R
U4K136_9VIBR          --------------------------MATLFYVMGASGSGKDSVIQAIREDARLS----V
Q1ZN04_PHOAS          -------------------------MLARLFYVLGASGAGKDSLINAVRESLSER----L
B1KFH5_SHEWM          --------------------------MGRLFYVIGPSGSGKDTFIQAVRETWPDS----I
PHNN_LARHH            ---------------------<MRTETGQLIYVMGPSGAGKDSLLGYARERLAGQP---L
PHNN_CHRVO            ----------------------MADKTGTLWYVMGPSGAGKDSLLAYARQRLPGG----V
PHNN_BURPS            ------------------------MSAERLVYVMGPSGAGKDSLLAYARKHVREP---RI
PHNN_BURMS            ------------------------MSAERLVYVMGPSGAGKDSLLAYARKHVREP---RI
F3LJG8_9GAMM          ------------------------MSTVKLFYLVGASGSGKDSILRYLRQHLIEQCSQPV
PHNN_ACHXA            ------------------MTPSVPADGARLIYLMGASGSGKDTLLRLLRAELRGD--EPV
B9MFL0_ACIET          -------------------------MTGQLVYVIGPSGAGKDSVLAALRARWPQDI--PV
A1WM33_VEREI          -------------------------MTARLVYFMGPSGAGKDSLLAWLRAQQPAAQG-RI
C5D164_VARPS          ------------MSAAPSHAPVNAARAGRLVYVVGPSGAGKDSVIDWLRQQLPQDA--RV
PHNN_JANMA            ------------------------<HSGRIFFCVGPSGVGKDSLLNWVREHSAGDE--KL
                                                                  :               

PHNN_RHOPA            VFARRVVTR-EASAAEDNLQVTPDDFSRLEAAGDFALHWRAHGHAYGLPR-GLDDDIRAG
Q132D6_RHOPS          AFARRVVTR-EPSLAEDNLQSTPEAFRNMVSADEFALHWQAHGHSYGLLR-TIDSDIRSG
PHNN_BRADU            VFPRRVVTR-ESSAAEDNIAMSPDEFRRGIDHGDFAVHWDAHGHSYALPL-EINDDIRAG
F7QLQ2_9BRAD          VFPQRVVTR-EASSFENNEAVSAIVFGQMLGRGDFAFQWEAHGLRYGIPR-TIVDDIRAG
PHNN_METRJ            VFPRRLVTR-PPSADEDNDEIDEAAFAEGCAAGRFTLSWRAHGLGYALPE-AVGRRVAEG
B0UIG1_METS4          VFPRRLVTR-PPSAHEDNREIGEADFAAGEAQGRFALAWRAHGLGYALPA-ACLSLAETG
A7IEW5_XANP2          LFARRLVTR-PAGAGEAHGTLSEAEFEALRVKGRFPLFWRAHGLCYALGP-EVAQAIAEG
PHNN_ACICJ            VFPRRVITR-PPDPAEDHEPVSDDEFQRRA----FALSWSAHGLSYGIPA-SIVGDLDAG
PHNN_FRAIE            HFPRRVITR-PSGPGEDHEPVTEEQFTAARERGELAVWWPAHGLRYGIPA-SADVAVGAG
A0A2T0VEJ5_9MICO      VFPRRQITR-PSGAGEDHIPVSESEFDTADRLGEFALTWRAHDLAYGIPA-NVFDVVEAG
Q222Z5_RHOFT          VFARRMVTR-PALPGSDHDPVTVRQFEHSMAAGGLVWRWEAHGFHYGIEA-RYAAQVAAG
F5XZY7_RAMTT          VFARRLVTR-ATHPGSDHDEVSPAAMRALGESGGLAWHWEAHGHQYGVRA-AYADLVAQG
I4YSU9_9RHIZ          TFVRRVITRLSDGVTEDHDTMTPDAFEAGRAAGMFCLSWGAHGLFYGLPL-SALDAVGQG
RBKTP_CUPTR           VFARRVITRPEGAVGEAHEAVSEAEFARRQRSGEFLVTWDAHDLRYGLPC-SLMSELERG
RBKTP_CUPNH           VFARRVITRPDGSAGEEHEGVTEAEFARRQRSGEFLVTWDAHDLRYGLPK-SLMCELERG
RBKTP_CUPPJ           VFARRIITRPSGSPGEDHESVAEAEFAERERNGEFLVTWHAHGLRYGLPQ-WLVGLLETG
RBKTP_AZOC5           VFARRAITRPADAGGEAHEALSVDQFDAVLAQGGFLIHWEAHGLKYGLRA-TLLDDMAAG
RBKTP_ROSDO           SFPQRVVTRAADAGGEDYIPVTPSEFEQQLAAGAFWHQWHAHGLSYGIPM-QVARDLDNG
PHNN_BRUAB            HFVRRIITRTQMPGTEDHDSLDEADFARAAGEGRFALHWQAHGLRYGLPK-TLDDEIAGG
A0A0F6AQX5_BRUA1      HFVRRIITRTQMPGTEDHDSLDEADFARAAGEGRFALHWQAHGLRYGLPK-TLDDEIAGG
PHNN_BRUMB            HFVRRIITRTQMPGTEDHDSLDEADFARAAGEGRFALHWQAHGLRYGLPK-TLDDEIAGG
A0A0Q3HYG8_9BRAD      RFARRLITRPAMAGAEDHDSCDEAAFRTAEAQGELALSWRAHGLSYGIPA-TELSGIAMG
F2J2Y5_POLGS          MFARRLITRTPDAAAEDHDTLSSEDFERLVAAGDVGLAWRAHGLGYVLPR-TIDATILAG
G8PLU0_PSEUV          MFARRLITRPADAGSEPHEAICNEEMSQLIDQGRVALSWPAHGLTYALPE-CVDNHITKG
PHNN_CHESB            VFARRIITRPFAPGGEEHDTRDVPTFEREEAAGAFALSWRANGLCYALPA-ALDEEMRSG
PHNN_RUEST            RSMRRVITRAPEAGGEDYQPVSEAEFQALVEADVFALHWNAHGLRYGIPR-DIEKLREGA
A0A2I7ITE3_9RHOB      VRQRRIITRAPELGGEDYDAVTEDRFATLCSAPGFALHWQAHGLRYAIPR-DIDELRNRA
A0A1G5PLS2_9RHOB      SLLKRVITRTPDAGGEEYQAVSEAVFQDLQETGAFALHWQAHGLYYGLPAADLQRQRCEG
Q5LW68_RUEPO          HLIRRVITRPEDAGGEAFTGVSRQEFEAMRAAGAFALSWEAHGLCYGVPM-PSEVKQADA
A0A1Y5RRB4_9RHOB      QLVRRVITRPLGEEGETFTRANDTEFDTALAAGDFLLYWTAHGLRYGIPV-TIHEQRRAA
Q28NE0_JANSC          QSARRVITRASTAGGEAFDAVSEATFAMKAARGDFALHWQAHGLNYGIPT-GVQEALDRG
F7ZHR0_ROSLO          HVVRRVITRAPGLGGEDYDAASVAQFETMVEDGAFALHWGAHGLHYGIPV-TVKHHLGQG
PHNN_AGRFC            HFTRRVITRSCDAGGENHDAVSMHEFNQLEDAGAFAVSWQAHGLKYGIPA-AVYRHLEAG
PHNN_RHIE6            HFTRRVITRHRGAGGEDHLSVSLQGFAAMEQSGSFAVWWEAHGLKYGIPA-EVSVALSKG
F7XGB4_SINMM          LFVRRAITRPSDAGGEVHESVSDAEFEEMSRSGAFAVSWQAHGLSYAIPA-EIAEKIAKG
PHNN_PSEA7            RIVRRVITRSAEAVGEDAQAVTPAQFDTLERASAFAMSWRANGLCYGIPV-QIDEWLAQG
PHNN_PSEFS            RIVRRVITRSAEAVGEAAQGVSPEQFATMQAEGAFALSWQANGLSYGIPR-EIDDWLAAG
PHNN_AZOVD            RIVRRVVTRSPEAVGEDALGVSPERFEQLLAEGAFALHWRANGLAYGIPR-QIDDWLVDG
F4GUN2_PUSST          YWAPRLVTRPTMHKEACSVSVSLPEFERLEANGSLALAWRAHGLAYGVPR-QIDDRLQAG
PHNN_PSYIN            VFAHRYITRPVELKGENHIQLTKEEFNNRLQRGCFKFNWHSHELDYGIGV-EVDRWLMQG
Q31DU5_HYDCU          VFTHRYITRPVELTGENHIQLSTAEFTNRLKHHCFKFHWHSHDLDYGIGI-EVDHWLNQG
PHNN_THIDA            VFAHRYITRPVELHGENHVALTEDEFDARLATGLFALHWDSHGLRYGIGR-EINLWLAKG
PHNN_DESBD            VFAHRYITRPADAGGENHVALSRAEFQLRLSRGLFALSWESHGFAYGIGR-EIDIWMESG
B6WT50_9DELT          AFARRYISRPACAGGEQHMALSAGSILSLEAQGRLAMRWSSHGCQYGIGR-SIDGSLEHD
A1U7M6_MARHV          RFARRCITRPADPDGENHLPISREAFNARAQQGLFAMQWSGNGHDYGIGV-EINTWLKNG
PHNN_PANVC            LIAHRYITRAADAGGENHVALTETEFDRRAALGLFAVSWEAHGFRYGIGC-ETEQWLLRG
PHNN_DICZ5            LVAHRYITRPAQAGGENHIALSEAEFAYRREHNLFALHWQAHQYQYGIGI-EVDHWLSAG
PHNN_ECOLI            LVAHRYITRDASAGSENHIALSEQEFFTRAGQNLLALSWHANGLYYGVGV-EIDLWLHAG
PHNN_ECO57            LVAHRYITRDASAGSENHIALSEQEFFTRAGQNLLALSWHANGLYYGVGV-EIDLWLHAG
PHNN_SHIDS            LVAHRYITRDASAGSENHIALSEQEFFTRAGQNLLALSWHANGLYYGVGV-EIDLWLHAG
PHNN_ECOSM            LVAHRYITRAASAGSENHIALSEQEFFTRAGQNLLALSWHANGLYYGVGV-EIDLWLHAG
PHNN_SALAR            LIAHRYITRAANAGNENHIALSQQEFFIRAKQNLLALSWYANGFYYGLGI-EIDLWLHAG
PHNN_ENTLS            LVAHRYITRPAGAGCENHVALSEHEFFTRAAQHLFALSWHANNLYYGVGM-EIDLWLHAG
PHNN_KLEP7            LVAHRYITRPFNAGSENHIALSEHEFFTRAEQHLFALSWHANNTYYGIGV-EIDLWLHAG
PHNN_PECAS            LVAHRYITRPAEIQGENHIALTPEEFAIRQQLGIFALDWQAHQCHYGIGI-EIDYWLQRG
PHNN_PECPW            LVAHRYITRPAEIQGENHIALTPEEFAIRQQLGIFALNWQAHQCHYGIGI-EIDYWLQRG
PHNN_YERPE            VVAHRYITRPADAGAENHVALSKQEFIQRAEQGLFALHWQAHQHCYAIGI-EINLWLQHG
U4K136_9VIBR          QVAHRYITRHADSGSENHVALTPEEFQQRIQSELFAMHWQANGLFYGVGK-EIEHWLSQG
Q1ZN04_PHOAS          MIAHRYITRPAFMGNENHISLLDTEFDLRIHRGLFVMHWQANGCRYGVGN-EVDDWLNKG
B1KFH5_SHEWM          LYAHRYITRCATAGGENHIELSQREFLYRKQKGLFSIDWQAHQHHYALGA-EIDTWLNLG
PHNN_LARHH            VFAHRYITRPATAGSENHVALSEAEFALREAHGCFALSWRRNGLAYGLGC-EVTDWLAAG
PHNN_CHRVO            MFAHRYITRPADAGGENHVALSREEFDAREAGGCFALVWRRHGLAYGLGV-ETELWLGQG
PHNN_BURPS            AFAHRYITRKSD-GHENHVELTRDEFAARAQLGFFALEWSSHGFRYGVGV-EIDAWLAAG
PHNN_BURMS            AFAHRYITRKSD-GHENHVELTRDEFAARAQLGFFALEWSSHGFRYGVGV-EIDAWLAAG
F3LJG8_9GAMM          AIAHRYITRTSD-ENEQAICLSTEEFNLRQQHQLFALHWQANGFDYGIGK-EIDQWLAAG
PHNN_ACHXA            LVAHRYITRDSG-DTEDALRLTEDEFGRRAALGCFALRWASHGLQYGIGI-EIDAWLSCG
B9MFL0_ACIET          HWARRTISRPSAAQGEQHEAVDAQAFRQLSATQAFALQWSANGLHYGVRH-AELAPLRQG
A1WM33_VEREI          HWARRTISRNATPGAEEHESVSPETFAALRQAQAFALHWQANGLGYGIRH-AQLAPLAAG
C5D164_VARPS          HFARRTITRAVQPGGEQHDSVDVAAFMRLREAGAFAMHWEANALHYGVVR-EELAARCDG
PHNN_JANMA            VFAQRTITRATQAN-EAHEAVDTASFWRLAAGGQFAMVWQANDLCYGIRR-GIEADLKAG
                          * ::*                :        .   *  :   * :            

PHNN_RHOPA            RTVVANVSRMVIDPARSAYAN-VVVVLITAPAEVLAARIAARARASDGSITDRVGRSV--
Q132D6_RHOPS          RTVVANVSRTVIAQARQAYEN-VIVVLVTAPADVLASRIAMRARSSDGTIADRVSRTVD-
PHNN_BRADU            RAVVVNVSRTVIAALRQAYAN-VVVVAITAPPDVLAQRLAARARHSDGNIAERLSRSVED
F7QLQ2_9BRAD          RTVVINASRTIIDFARRSYAR-VTVVAVIAPPDILAQRVAARGRVSDGRIDDRLRRAIN-
PHNN_METRJ            HVVVCNVSRRVVAGARESGRR-VSVVEITAPPEILARRIAARGRAQDGDLAARLAR---E
B0UIG1_METS4          HVVTANISRRAVAEARARLPR-VSVVSVTAPPEVLARRLAARGRPEDGDLAARLAR---R
A7IEW5_XANP2          GVVVANGSRATLPEARARFQR-VRVVEVTAPVAVRAGRLAARGREDAADIEERLSRAP-E
PHNN_ACICJ            RIVVVNVSRAIVADARRRFP--CFVVAVTAAPAILAARLAVRRRETAAEIGARLARAA--
PHNN_FRAIE            RVVVANVSRAVLDELAGRYQR-LVVVRVTVSDEVRAQRLRARGREPEPGIGQRLARPDPA
A0A2T0VEJ5_9MICO      GVVVANVSRGVLAQLPNLFAN-VRVVRVTVSEEVRLERIVARGREDAIAAASRVARLDPA
Q222Z5_RHOFT          KIVVVNGSRAHASGLDAT-AQ-VRVVQIVADAAQLASRLEQRGRDAPHEVSRRLARNALF
F5XZY7_RAMTT          RIVVVNGSREHVAGLAGR-AD-VRSVLITAPAEALRQRLLARGREPAQAVAGRLHRNAAL
I4YSU9_9RHIZ          NVVVANVSRSVLAEAVKTFGR-VAVVEITADPEILLGRILARGRESAEEARRRIARSADT
RBKTP_CUPTR           RHVVANGSRAVIAELAQRLPR-FVVVLVTAPQDVLARRIAARGRESGEQIARRVARTGAA
RBKTP_CUPNH           RNVVANGSRGVIAELAARLPR-FVVVLVTAPHDVLARRIAARGRESGDQVASRVARAGAP
RBKTP_CUPPJ           KHVVANGSRGVIAMLARQLPR-FVVVNVTAPQDVLAQRIAARGRESGDDVMRRVARQAPP
RBKTP_AZOC5           RHVIANGSRAMVAALAERVPH-LVVVEITAPEAVLAERLKGRGREGAENIAARLERKVPP
RBKTP_ROSDO           INVVLNASRNEIGAFRDKATH-VVTIGISAPPGIVEERLHERGRESEEEIKRRLARLVEQ
PHNN_BRUAB            AVVIANVSRRVLSDIRRLYTS-RSVVVISARTEVLAQRLASRGRESREEIAARLAREVGF
A0A0F6AQX5_BRUA1      AVVIANVSRRVLSDIRRLYTS-RSVVVISARTEVLAQRLASRGRESREEIAARLAREVGF
PHNN_BRUMB            AVVIANVSRRVLSDIRRLYTS-RSVVVISARTEVLAQRLASRGRESREEIAARLAREVGF
A0A0Q3HYG8_9BRAD      AVVIVNISRRAIAAAEELAER-VVVLNITAPVPVLAQRLAARGRESEAEIAARLAREAPL
F2J2Y5_POLGS          GTVIANGSRGVLSQAFTKYAD-VRVLLVTAPRSVLAERLAARGRESREEIERRLDRADLD
G8PLU0_PSEUV          GIAIANGSRKALAEAVEKYEK-LLVVHITAPIHVLAQRLSMRGRETAEDIEQRLRRADLS
PHNN_CHESB            GVVVANVSRAIIPALGERYAH-IFPVIVTAPRGVLAERLSRRGRETRDEVLSRLARSEAG
PHNN_RUEST            TGVLVNLSRAVLLQAQEVFDD-FRVISVTARPEVLAARLAGRGREDAAEVERRLARASLA
A0A2I7ITE3_9RHOB      SGVLVNLSRKVLLEAEAAFGT-LIVLSVTAAPEALAARLSARGREDSAEVERRLARASTP
A0A1G5PLS2_9RHOB      GGVLVNFSRAVLLEAQALFDP-FVVFSVTATPDVLAARLKMRDRETKSEQLLRLARATKP
Q5LW68_RUEPO          RALLVNLSRGVLLRAQEVFHP-FAVLSLTARPEVLAARLAARGREDAAEQARRLGRAGMA
A0A1Y5RRB4_9RHOB      RGLLVNLSRSVLLDAQELFDD-FAVVSLTASPEVLAARLDSRARESVEDRQRRLDRARLK
Q28NE0_JANSC          LDVLANLSRGALAEAEGVFEN-MVVLHITAPPDVLAQRVARRGREMGRDAAARLTRPAPA
F7ZHR0_ROSLO          TDCLVNFSRKALAQAGGMFPR-LVVLNITAKPETLAQRLAARARETEEEISKRLAEADKP
PHNN_AGRFC            DVVIANGSRSALPHFGTAFSR-LKVVNIVARPDVLARRLEQRGRESRDDILRRLERSSLA
PHNN_RHIE6            HIVVANGSRSALHRFQAAFPR-LKVINVTASAEVLAGRLEARGRETHEDIMARLARGPLT
F7XGB4_SINMM          MTAIVNGSRAALPAIRQAFGT-IAVAVITAEPPVLAKRLAERGRESEEDVLRRLTRQAPD
PHNN_PSEA7            YDVLVNGSRGYLAQARRRYPD-LLAVLLGVQPEVLRQRLLARGRESPEEIEARLARNAEF
PHNN_PSEFS            DDVLVNGSRAHLAQTRERYPT-LLVLLLTVDQAVLRQRLIARGREALADIEARLARNARF
PHNN_AZOVD            RDVLINGSRGHLAAARRRYPE-LCAVLLTVEPQVLRQRLLARGRETIEEIEARLARNARL
F4GUN2_PUSST          CDVLINGSRAYLPEACRRYRD-LLPVLLTVDNALLHQRLSSRGREGSEQITARLERNKQL
PHNN_PSYIN            SNVVINGSRGYLNTAVALHPG-LVPVLIQVDSNLLHERLIKRGRETLEQIEKRIQRAQAF
Q31DU5_HYDCU          LNVVMNGSRGYLETAIQKQPD-LVPVLIEVDVNVLRERLINRGRETLAQIEKRVQRAETF
PHNN_THIDA            CNVVLNGSREYLPEARRRYPG-LTAILVNVSPEVLAERLRARGRETEDQISRRVARAKQF
PHNN_DESBD            LSVVVNGSRGALSAALQAYPE-LLPVLIDVPEHILRERLGARGREDAGEIEARLVRARMA
B6WT50_9DELT          ICVIVNGSREYLPEALRRYPD-LIPVLVEVEPAILRQRLLARGREQGKDLEERLQRALAP
A1U7M6_MARHV          NTVVVNGSRQWLGQAFVRYPG-LVPVLIEVSPSVLRQRLQKRGRESAAEIEARLWRHQQI
PHNN_PANVC            QNVVVNGSRLHLAQAQARFGSQLLPVCLQVTPAVLAARLRQRGREDEAEIARRLARAAQP
PHNN_DICZ5            LDVVVNGSRSHHQQAQQRYGSRLLPVCLQVSAAVLAQRLRQRGREDEAQIALRLQRADAM
PHNN_ECOLI            FDVLVNGSRAHLPQARARYQSALLPVCLQVSPEILRQRLENRGRENASEINARLARAARY
PHNN_ECO57            FDVLVNGSRAHLPQARARYQSALLPICLQVSPEILRQRLENRGRENASEINARLARAARY
PHNN_SHIDS            FDVLVNGSRAHLPQARARYQSALLPICLQVSPEILRQRLENRGRENASEINARLVRAARY
PHNN_ECOSM            FDVVVNGSRAHLPQARARYQSALLPVCLQVSPEILRQRLENRGRENASEINARLARAARY
PHNN_SALAR            FDVVVNGSRAHLSQAQARYGTSLLPVCLTVSPDILRQRLQTRGRENDAEIAARLERAAHY
PHNN_ENTLS            LDVVVNGSRAHLPQAKARYGESLLPVCLQVSPDILRQRLEQRGRENALEIAQRLERAARY
PHNN_KLEP7            FDVVANGSRAHLALARERYGEVLVPICLAVSPPVLRQRLEQRGRENALEIAQRLDRAARY
PHNN_PECAS            SYVIVNGSRAYLTQARERYGNTLFPICLTVSESALRQRLRARGRESEQQIATRLQRAEDE
PHNN_PECPW            SDVIVNGSRAYLTQARERYGNTLFPICLTVSESALRQRLRARGRESEQQIAMRLQRAEEE
PHNN_YERPE            LDVLVNGSRAYLPEAQRRYRHQLLPLCLTVSPAILAQRLRQRGRENSEQIDARLQRAQHY
U4K136_9VIBR          QDVFLNGSRAYYPEALKRFATCIQPVWIDVNTHQLKQRLQARGRESEAEINARIDRAIQY
Q1ZN04_PHOAS          LDVMVNGSRAYLETAKARFGEQLQVVWISVSPEVLEQRLQLRGRESEEEITQRLERAVAY
B1KFH5_SHEWM          LDVVLNGSREYLGKMQDKFADRLFPVLMQVDDITLAERLRMRGRESEAQIIKRLARAQAH
PHNN_LARHH            LVVVVNGSRAALPQARQCFPG-LKPLWITASPAVLAARLAARGRESADDIAARLAASAGF
PHNN_CHRVO            MDVVVNGSRSSLPLAMARFPT-LRPLWITASPEVLAVRLRQRARECGEVIERRLAEAASF
PHNN_BURPS            SVVVVSGSRAHLPAALERYPQ-MCVVHIDAAPHVLAERLATRGRETADEIRARLAR-SVR
PHNN_BURMS            SVVVVSGSRAHLPAALERYPQ-MCVVHIDAAPHVLAERLATRGRETADEIRARLAR-SVR
F3LJG8_9GAMM          VSVIVNGSRGYMNAAKSRYPKNFHSVHIDVADHVLQQRLESRSRETEAAIKDRMLR-HQK
PHNN_ACHXA            AAVIINGSRAHLEQAHSRYPA-LTAVEVTVDPGQLARRLAGRGRESAEQIAQRLARATQP
B9MFL0_ACIET          HWVFVNGSRKHLPTLLREWPA-AQVVHIGASADILRRRLIARGRETAEAVEARLAREVQL
A1WM33_VEREI          QWVLVNGSRAYLADALARWPD-LLAVHITASPAVLRARLLARGRESAAMVESRVQRALQL
C5D164_VARPS          RTVIVNGSRAYLTQAARLFPE-LVVAHITADAQTLRRRLLARERETPQMVDARVRRALDF
PHNN_JANMA            RDVVINGSRAYVPQLLQAFPD-AIVIWIDASENLLRERLEARQREQGPALLKRLKRAKEF
                           . **                  : .       *:  * *        *:      

PHNN_RHOPA            -AAHPD-------VTISNVGDPIAHARDLLEIIRHGRPQP--------------------
Q132D6_RHOPS          GSNDAD-------YTIMNVAGRDDHARELLKIIRDQEPGKK-------------------
PHNN_BRADU            ASAQAD-------VTILNAGSADYHSRQLVRVIRNESWRE--------------------
F7QLQ2_9BRAD          -SPEPD-------ATIDNVGPADAHAAELLKFIDGA------------------------
PHNN_METRJ            GGVTAD-------LTILNTGAADEAAARLVAHLRAC------------------------
B0UIG1_METS4          APDAAD-------LTILNDGPPEAGAAALVAHLRAR------------------------
A7IEW5_XANP2          VDVAPD-------LVIDNVGTPADGGQRLSAFIAAELAAG--------------------
PHNN_ACICJ            APVEAD-------AVVANETTPEAAGAAFLGILLRCRDLPCLP-----------------
PHNN_FRAIE            PGHQAD-------TVIQNDGTLADGGDQLLRVILDAAGAPLATG----------------
A0A2T0VEJ5_9MICO      PDYPAD-------LEIVNDGTIEDASAQLAAFLTSMRDAARAAL----------------
Q222Z5_RHOFT          KDLRAD-------HTILNQGALADAGRQLVDYLVAGALSSAWR-----------------
F5XZY7_RAMTT          PALAAD-------LVLVNDGPLERAAGALRDWLRELAA----------------------
I4YSU9_9RHIZ          NLPHAT----CSYVQIDNSGPVEIARDQLTKVLSASILSDLEREPPLRA-----------
RBKTP_CUPTR           LPPEVR----C--LTVLNDSTLEVGRARFVEALRHGTR>---------------------
RBKTP_CUPNH           VPPHVP----C--ITVSNHSTLEAGTARFVEALRTGTR>---------------------
RBKTP_CUPPJ           MPDGVH----C--VTVTNDSTLDLGVARFTDALRNGAN>---------------------
RBKTP_AZOC5           FPESVT----V--IQVPNDSTPRAGIEKFVAALVAQTARLRLVRMAIETGRRNVAFLAR>
RBKTP_ROSDO           APLTGY----A--LEIVNDRTIEEGITALVDLIAGACDLNAEITRFPVTIGSKQVCLVH>
PHNN_BRUAB            DDGSG------DVVTIDNSGEVGASTKAFLYHLHEIAVKTIA------------------
A0A0F6AQX5_BRUA1      DDGSG------DVVTIDNSGEVGASTKAFLYHLHEIAVKTIA------------------
PHNN_BRUMB            DDGSG------DVVTIDNSGEVGASTKAFLHHLHEIAVKTIA------------------
A0A0Q3HYG8_9BRAD      TAERA------EVVTIMNDRSVAEAAEELVTVLRGLGRSPV-------------------
F2J2Y5_POLGS          LPDVP------HVARVDNTGTIADGVARMIAALD--------------------------
G8PLU0_PSEUV          LPELP------HLVEIQNTNDPQVGIDQLEQAIAAFMR----------------------
PHNN_CHESB            ELDVP------GALVIDNSGPLEQAGERFLEALRKAAAWSDVCDMV--------------
PHNN_RUEST            LPEGLR-----QVHEVDNSGALSAAIVEAQAII----QAERA------------------
A0A2I7ITE3_9RHOB      VPAGLS-----QVFDIDNSGQLEEAIKAAETALMPWLQPERA------------------
A0A1G5PLS2_9RHOB      LPDGLL-----QVIEIDNSGSLDAAVMAAQHAL----YPPRG------------------
Q5LW68_RUEPO          LPEGVR-----RVITVDNSGPLERTVDAVLAHL----QRESA------------------
A0A1Y5RRB4_9RHOB      LPEGLR-----RVIEVDNSGALDQTVETILSRL----QRESA------------------
Q28NE0_JANSC          LPDGL------KVIEIDNSGSLADSIATALDAL----YPDRG------------------
F7ZHR0_ROSLO          LPAGL------EVIHLANDGPLSQTIARAADLL----QPVSV------------------
PHNN_AGRFC            VAGDF------DVTTVDNSGAIEDAGKTIMQVLQQSAGSSQP------------------
PHNN_RHIE6            VRGDY------DVTELDNSGSIEEAEQKMIAILDGLLAEVH-------------------
F7XGB4_SINMM          VIADA------DVTVIDNSGRLDVAGRQFVALVERHSAKRHHPA----------------
PHNN_PSEA7            AAGL----EG-PLFQLDNSGELDDTVRALLAWLG-----GDRACA---------------
PHNN_PSEFS            TADLIAGHGA-GLFVLDNSGPLAHTVERLLCCLDH----GHSACA---------------
PHNN_AZOVD            PLDG-----E-DCQRLDNSASLAQTAEALLRLIR------KRACA---------------
F4GUN2_PUSST          SALPSHAGAN-PVITVDNSGPIDHAVTMLYTHLRQSKTRRKDSCD---------------
PHNN_PSYIN            VG-L---TSP-NMQIIENNSELSVAGEQLVSLLRNQAVKIL-------------------
Q31DU5_HYDCU          VN-L---RAP-NLQRIENNTELSVSGERLVNLLKTKDLKSP-------------------
PHNN_THIDA            MH-P---EG--RLEVIANDAELHVAGERLVQLLSDADASKRAFA----------------
PHNN_DESBD            V--V---EAP-ELVRFDNSGPLAERGQALAGLILETTISGRKS-----------------
B6WT50_9DELT          LPAI---SLE-RLVRIDNSGKLPAAVDALENVVRAALPVRGMAHTLQGTQGSAA------
A1U7M6_MARHV          QP-----PIE-HCIVINNDGALSEASRAFIEAVRQPVRDTALCR----------------
PHNN_PANVC            Q-------PD-GCLILNNDGALAETVCQLRQILELHQ-----------------------
PHNN_DICZ5            DI-----LPA-TCRRLNNDGPLAQTLQAFHTLLAAEKSDFWQISL---------------
PHNN_ECOLI            T-------PQ-DCHTLNNDGSLRQSVDTLLTLIHQKEKHHACL-----------------
PHNN_ECO57            T-------PQ-DCHTLNNDGSLRQSVDTLLTLIHQKEKHHACL-----------------
PHNN_SHIDS            T-------PQ-DCHTLNNDGSLCQSVDTLLTLIHQKEKHHACL-----------------
PHNN_ECOSM            T-------PQ-DCLTLNNDGSLRQSVDKLLTLIHQKEKHHACL-----------------
PHNN_SALAR            P-------PF-NCHTVNNDGSLLQSVERLLILMGRKEEHYASL-----------------
PHNN_ENTLS            T-------PQ-QCVMLNNDGSLLQSVEMFLHLIRTHGNHKESQHACL-------------
PHNN_KLEP7            K-------PD-NCLTLNNDGSLRQSVDEFFRLLRSHAAREADQLV---------------
PHNN_PECAS            QS-R---LQS-DCILLNNDGDLQRTLSTFQSLLPFDRACAAHRE----------------
PHNN_PECPW            QN-R---LQS-DCVLLNNDGDLQHTLSTFQSLLPLDRACTAHRE----------------
PHNN_YERPE            QQ-Q---LPS-HCLQLCNDGELQHTLNQLQQLLTLDTPLSDPVEDKPCN-----------
U4K136_9VIBR          QQ-K---MPS-NALVIDNSDTLQSSVEQFILKFKHIKQWQKETRLCS-------------
Q1ZN04_PHOAS          DA-V---RPP-CAIVVDNSGSLQSSTEQFLAQMKYAVYESQSKSVVG-------------
B1KFH5_SHEWM          PL-S---LPE-RSITIDNSGSLEASLTQFSNYYQRLIRDSIPAE----------------
PHNN_LARHH            RP------PA-DCRVLCNDGELAVAGDELVAWLSSHCHQPITAL----------------
PHNN_CHRVO            AP------PA-GCEVLVNDGALAQAGDTLLRWLRGGRRVC--------------------
PHNN_BURPS            WAVP---DGV-ALTAIDNSGTLDDAGRVLVALLEGLARS---------------------
PHNN_BURMS            WAVP---DGI-ALTAIDNSGTLDDAGRVLVALLEGLARS---------------------
F3LJG8_9GAMM          LK-E---MFV-SDSVIVNETTIDNAARQFKNIIDNVQRYAK-------------------
PHNN_ACHXA            FPVP---LQC-QLLRVSNDAAPETAAATLLDIARGKLAA---------------------
B9MFL0_ACIET          QL----PQGS---IRIRNDGALEDAAAQLLAELRARSQAAAAPLERLDQ-----------
A1WM33_VEREI          QP----PGGS-VPIELHNDGALDDAGQRLLSALRQCPGWPE-------------------
C5D164_VARPS          QL----PPGI-AAIEVRNDAALADAGAQLQQALKAWQCL---------------------
PHNN_JANMA            AP----SEQA-QVIRLDNSGALEAGGQKLLDILRQAK-----------------------
                                     . *