CLUSTAL format seed alignment for MF_00837

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PAGP_YERPN      -------MNYKDIINACILSGVFLLHSPSALADT--PSVGVSKG----------------
PAGP_YERPA      -------MNYKDIINACILSGVFLLHSPSALADT--PSVGVSKG----------------
PAGP_YERPZ      -------MNYKDIINACILSGVFLLHSPSALADT--PSVGVSKG----------------
PAGP_YERPE      -------MNYKDIINACILSGVFLLHSPSALADT--PSVGVSKG----------------
PAGP_YERPB      -------MNYKDIINACILSGVFLLHSPSALADT--PSVGVSKG----------------
PAGP_YERE8      -------MSYKHLISACIFSSLCLGQVNAVLAEDKLPPSNTSTG----------------
PAGP_PHOAA      -------MKF-DLTTAYTLSIPLLASSGTVLATTADTSSKSSTM----------------
PAGP_PHOLL      -------MKF-DLTAACTLSATLLVSSGTVFATTANTANKSLTT----------------
PAGP_PROMH      ----MSSTYFHSSLLAATLFSVTLTAPAFASENTQNTPQTITTKKP--------------
PAGP_ECOKO      -------MNVSKYVAIFSFVFIQLISVGKVFANA--------------------------
PAGP_ECOLW      -------MNVSKYVAIFSFVFIQLISVGKVFANA--------------------------
PAGP_ECOLI      -------MNVSKYVAIFSFVFIQLISVGKVFANA--------------------------
PAGP_ECO57      -------MNVSKYVAIFSFVFIQLISVGKVFANA--------------------------
PAGP_SHIFL      -------MNVSKYVAIFSFVFIQLISVGKVFANA--------------------------
PAGP_SHIF8      -------MNVSKYVAIFSFVFIQLISVGKVFANA--------------------------
PAGP_SHIF2      -------MNVSKYVAIFSFVFIQLISVGKVFANA--------------------------
PAGP_SHIBS      -------MNVSKYVAIFSFVFIQLISVGKVFANA--------------------------
PAGP_ECOUT      -------MNVSKYVAIFFFVFIQLISVGKVFANA--------------------------
PAGP_ECOL6      -------MNVSKYVAIFFFVFIQLISVGKVFANA--------------------------
PAGP_ECOL5      -------MKVSKYVAIFFFVFIQLISVGKVFANA--------------------------
PAGP_SALPA      ---MYVAMIIRKYFLIIALLVMPWLAIPSVSAAD--------------------------
PAGP_SALTI      ---MYVAMIIRKYFLIIALLVMPWLAIPSVSAAD--------------------------
PAGP_SALTY      ---MYVAMIIRKYFLIIALLLMPWLAIPSVSAAD--------------------------
PAGP_SALPC      MNGMAVVMIIRKYFLIIALLVMPWLAIPSVSAAD--------------------------
PAGP_CITK8      ------MIVAKKYFLVLSFLFVQFALLPQAFSAD--------------------------
PAGP_CITRI      -MVVNVVIVAKKYFLFITLLIIQVSLPAHAGTDE--------------------------
PAGP_CROS8      ------MTVVNKSFLTILIFFCQILFPLNASALEA-------------------------
PAGP_CROSK      ------MTVVNKSFLTILIFFCQILFPLNASALEA-------------------------
PAGP_CROTZ      ------MTVVNKSFLTFLVFFCQILFPLNASALEA-------------------------
PAGP_KLEP7      --------MLRRFSLFSLGFLGWLLVSGNASASFS-------------------------
PAGP_ENTLS      ------MLKVNKYVILIIAFVSQMMFSTTAQASFS-------------------------
PAGP_EDWTF      --------MKTHNDILAALAALPLFLTGAAFAAE--------------------------
PAGP_EDWTE      --------MKTHNDILAALAALPLFLTGAAFAAE--------------------------
PAGP_ERWAE      ---------MKLKSVLYLLMLLNCLGLKSAHAATL-------------------------
PAGP_ERWAC      ---------MKLKSVLYLLMLLNCLGLKSAHAATL-------------------------
PAGP_ERWP6      ---------MKLKPVLYLLMLLGCLGLKSAHAATL-------------------------
PAGP_ERWPE      ---------MKLKPVLYLLMLLGCLGLKSAHAATL-------------------------
PAGP_ERWSE      ---------MKLKPVLYLLMLLGCLGLKSAHAATL-------------------------
PAGP_ERWT9      ---------MRLKLILYFLILSCYLGIGSARAATL-------------------------
PAGP_PANAA      --------MNRYLLTTLSAPLLALFFSFSLQAAML-------------------------
PAGP_PANAM      --------MNRYLLTTLSAPLLALFFSFSLQAAML-------------------------
PAGP_PECCP      -------MYLKRTLITLSLITLPIVPFLSYAAESI-----NNTSSTENLAPVTVDSSD--
PAGP_PECAS      -------MYLKRILITLSLITLPIVPCLSYAAESISNVGINNTGSTANLAPAAADANV--
PAGP_PECPW      -------MHLKRALITLSLITLPIIPFSSYAVESI-----NNTGSMESPASVAADST---
PAGP_DICD3      -------MRLKLTSHTCLFALSSLLVTPAFAAPSG-----DNTASDAVE-----------
PAGP_DICC1      -------MRLTLTSRSRLFVLSSLLFISTFDVLS----------AQAAP-----------
PAGP_DICZ5      -------MRLILISHSRLFALSALFLIPTFDSLSA-----ENTLTDSTTLIDRTTQSD--
PAGP_DICP7      -------MWLRFCAPA-LMAWYWVFFPSTSQAATM-----EN------------------
PAGP_SERP5      --------MMFFKRTILACTVALLFPALPSYAEVG------AENGNS-------------
PAGP_SODGM      -------MRLFYQRISLLISLCGFFSA--------------AWASDV-------------
PAGP_ENTCL      -----MQRLFPALWVVLFLVVSPLHAEPKVYGEQR-------------------------
PAGP_LARHH      ------MKQMVCWLTAGLLTLGGLPARAGDTVPAVPETPAAPAAPAV-------------
PAGP_LEGPN      ---------MKRLISCLTIICALNRSAAAETTSSP-------------------------
PAGP_LEGPL      ---------MKRLISCLTIICALNASAAAETTSSP-------------------------
PAGP_LEGPC      ---------MKRLISCLTIICALNASAAAETTSNP-------------------------
PAGP_LEGP2      ---------MKRLISCLTIICALNASAAAETTSNP-------------------------
PAGP_LEGPH      ---------MKRLISCLTIICALNASAAAETTSNP-------------------------
PAGP_LEGPA      ---------MKRLISCLTIICALNASAAAETTSNP-------------------------
PAGP_LEGLN      ----MNKLTVRNFIVGLLIVFSLNSFSSPPSISNSSSNSIDENSPINTFKISPDNQTSKK
PAGP_BORBR      ---------MTQYFRALAFFLLLVPATAMA------------------------------
PAGP_BORPA      ---------MTQYFRALAFFLLLVPATAMA------------------------------
PAGP_BORPE      ---------MTQYFRSLAFFLLPVPATAMA------------------------------
PAGP_BORPC      ---------MTQYFRSLAFFLLPVPATAMA------------------------------
PAGP_METFK      -------MNIRHGIIAMSSTMLVPLAAEAA------------------------------
                                                                            

PAGP_YERPN      -QESLQPAAEGN----LWQRLIRNVSLAWNSP-HQELYIPVNTWHNRWTYDDEKI--ASY
PAGP_YERPA      -QESLQPAAEGN----LWQRLIRNVSLAWNSP-HQELYIPVNTWHNRWTYDDEKI--ASY
PAGP_YERPZ      -QESLQPAAEGN----LWQRLIRNVSLAWNSP-HQELYIPVNTWHNRWTYDDEKI--ASY
PAGP_YERPE      -QESLQPAAEGN----LWQRLIRNVSLAWNSP-HQELYIPVNTWHNRWTYDDEKI--ASY
PAGP_YERPB      -QESLQPAAEGN----LWQRLIRNVSLAWNSP-HQELYIPVNTWHNRWTYDDEKI--ASY
PAGP_YERE8      -QHSELSVDNDN----LWQRLLRNISLAWDSP-NQELYIPLNTWHNRWTYDDDKI--ESY
PAGP_PHOAA      -TAIHTSTGYNNHSDSLWATFNNNVALTWDAP-NNEFYLPVITWHNRYTYDKEKT--DKY
PAGP_PHOLL      -IESHTPISYGNNSSSLWEKFNNNVALTWDAP-NNELYLPVITWHNRHTYDKEKT--DRY
PAGP_PROMH      -QPAENTFSEKNE-ESYWGKFKRNLTQTWDND-QYNYYLPVWTWHNRFTYDKEKT--NRY
PAGP_ECOKO      --------------DEWMTTFRENIAQTRQQPEHYDLYIPAITWHARFAYDKEKT--DRY
PAGP_ECOLW      --------------DEWMTTFRENIAQTRQQPEHYDLYIPAITWHARFAYDKEKT--DRY
PAGP_ECOLI      --------------DEWMTTFRENIAQTWQQPEHYDLYIPAITWHARFAYDKEKT--DRY
PAGP_ECO57      --------------DEWMTTFRENIVQTWQQPEHYDLYIPAITWHARFAYDKEKT--DRY
PAGP_SHIFL      --------------DERMTTFRENIAQTWQQPEHYDLYIPAITWHARFAYDKEKT--DRY
PAGP_SHIF8      --------------DERMTTFRENIAQTWQQPEHYDLYIPAITWHARFAYDKEKT--DRY
PAGP_SHIF2      --------------DERMTTFRENIAQTWQQPEHYDLYIPAITWHARFAYDKEKT--DRY
PAGP_SHIBS      --------------DEWMTTFRENIAPTWQQPEHYDLYIPAITWHARFAYDKEKT--DRY
PAGP_ECOUT      --------------DEWMTTFRENIAQTWQQPEHYDLYIPAITWHARFAYDKEKT--DRY
PAGP_ECOL6      --------------DEWMTTFRENIAQTWQQPEHYDLYIPAITWHARFAYDKEKT--DRY
PAGP_ECOL5      --------------DEWMTTFRENIAQTWQQPEHYDLYIPAITWHARFAYDKEKT--DRY
PAGP_SALPA      --------------KGWFNTFTDNVAETWRQPEHYDLYVPAITWHARFAYDKEKT--DRY
PAGP_SALTI      --------------KGWFNTFTDNVAETWRQPEYYDLYVPAITWHARFAYDKEKT--DRY
PAGP_SALTY      --------------KGGFNTFTDNVAETWRQPEHYDLYVPAITWHARFAYDKEKT--DRY
PAGP_SALPC      --------------KGGFNTFTDNVAETWRQPEHYDLYVPAITWHARFAYDKEKT--DRY
PAGP_CITK8      --------------KGWFDTLKDNVSETWQQPEHYDLYVPAITWHARFAYDKEKT--DRY
PAGP_CITRI      --------------KGWFNTFTDNVAETWREPEHYDLYIPAITWHARFAYDKRKT--DRY
PAGP_CROS8      ----------PRTVKAWASVLGDNIAETWNEPQHVDLYVPAITWHARFAYDKEKT--DRY
PAGP_CROSK      ----------PRTVKAWASVLGDNIAETWNEPQHVDLYVPAITWHARFAYDKEKT--DRY
PAGP_CROTZ      ----------PRTVKAWASVLGDNIAETWNEPQHVDLYVPAITWHARFAYDKEKT--DRY
PAGP_KLEP7      ----------S-TLSEGYHTLSNNVAQTWNEPEHYDLYVPAITWHARFAYDKEKT--DKY
PAGP_ENTLS      ----------A-TVSDAWSTLSNNVTQTWQAPEHYDLYVPVITWHARFAYDQEKI--DNY
PAGP_EDWTF      --------------PGMLDTLRNNIVQTWEQPQHYDLYLPAITWHARFAYSQEKI--DSY
PAGP_EDWTE      --------------PGMLDTLRNNIVQTWEQPQHYDLYLPAITWHARFAYSQEKI--DSY
PAGP_ERWAE      ----------VHGISTSWHSFSNSVSQTWNEPQTFDLYMPALTWHNRWTYDADKI--DRY
PAGP_ERWAC      ----------VHGISTSWHSFSNSVSQTWNEPQTFDLYMPALTWHNRWTYDADKI--DRY
PAGP_ERWP6      ----------AHGISASWHSFS----QTWNEPQTFDPYIPSIIWHNRWTYDADKI--DKY
PAGP_ERWPE      ----------AHGISASWHSFS----QTWNEPQTFDPYIPSIIWHNRWTYDADKI--DKY
PAGP_ERWSE      ----------AHGISASWHSFS----QKWNEPQTFDPYIPSIIWHNRWTYDADKI--DKY
PAGP_ERWT9      ----------MHGVANTWNSFSDNVSQTWNDPQTFDLYVPAVTWHNRWTYDSDKI--DKY
PAGP_PANAA      ----------SQEIKSGWDTFTGNVQQTWQQPDAIDVYVPAITWHNRWTYDEEHI--HRY
PAGP_PANAM      ----------SQEIKSGWDTFTGNVQQTWQQPDAIDVYVPAITWHNRWTYDEEHI--HRY
PAGP_PECCP      PV-------SDKQGESWWQRSKNNLSTTWNAPQSHDIYIPAITWHNRWTYDKEKT--DRY
PAGP_PECAS      SA-------SDKHEESWWQRSKNNLSTTWNAPQSHDIYIPTITWHNRWTYDKEKT--DRY
PAGP_PECPW      ---------SNKQDESWWQRSKHNLSATWNTSQSHDIYIPAITWHNRWTYDKEKT--DKY
PAGP_DICD3      ----------RGSEPGIWQRAGNNLSDTWHHWQSQELYVPAMTWHNRWTYDKAKT--DRY
PAGP_DICC1      ----------ANTAPSFWQRAGDNLSDTWHHWQSQDLYVPVMTWHNRWTYDKEKT--DRY
PAGP_DICZ5      STTQRDSKTRRDPAPSFWQRASNNLSETWQHPQSQDLYVPAITWHNRWTYDRAKT--DKY
PAGP_DICP7      -----------DGQDGFWQRAKNNLSETWHNGQSQDLYVPAMTWHNRWTYSRQKI--DKY
PAGP_SERP5      ---------AQAEKPGLWKRFTSNVAETWNNSPNKDLYVPAITWHNRLTYSQEKI--DSY
PAGP_SODGM      ---------QPASSTGLWQRFTQNVAETWHHSPHQDLYVPAITWHNRFTYDDEHI--RRY
PAGP_ENTCL      -------------IHRWWDAVTDDIAQTWEQPDRYDLYLPFLSWHARFMYDKEKT--DNY
PAGP_LARHH      -----QETPASSAAPGFWQRSWDNVETTWRSD-RYELYLPAITWHNRAFYDRDKI--DEY
PAGP_LEGPN      ----------CSRWISLLKPVCQRIHQTWTEG-HDDMYFSGYAWHNRYTYRPEKI--KSY
PAGP_LEGPL      ----------CSRWISFLKPVCQRIHQTWTEG-HDDMYFSGYAWHNRYTYRPEKI--KSY
PAGP_LEGPC      ----------CSRWISFLKPVCQRIHQTWAEG-HDDMYFSGYAWHNRYVYSNEKI--KSY
PAGP_LEGP2      ----------CSRWISFLKPVCQRIHQTWAEG-HDDMYFSGYAWHNRYVYSNEKI--KSY
PAGP_LEGPH      ----------CSRWISFLKPVCQRIHQTWTEG-HDDMYFSGYAWHNRYVYSNEKI--KSY
PAGP_LEGPA      ----------CSRWISFLKPVCQRFHQTWTEG-HDDMYFSGYAWHNRYVYSNEKI--KSY
PAGP_LEGLN      SDLATEEPKGCKYWLSLFKPVCHRLHQVWTEG-HTDLYLSGYAWHNRFTYSAERIREKKY
PAGP_BORBR      ----------CDGWPSWARGACQRVDQIWNEG-GNDLYLTGYSWHNRAMYSSDKI--RSF
PAGP_BORPA      ----------CDDWPSWARGACQRVDQIWNEG-GNDLYLTGYSWHNRAMYSSDKI--RSF
PAGP_BORPE      ----------CDGWPSWARGACQRVDQIWNEG-GNDLYLTGYSWHNRAMYSSDKI--RSF
PAGP_BORPC      ----------CDGWPSWARGACQRVDQIWNEG-GNDLYLTGYSWHNRAMYSSDKI--RSF
PAGP_METFK      ----------CNTDYSWIDKSCERISDTWKNG-DHDLYIPLWTHHLRFAYDNDKI--DSF
                                                   : *..    * *  *   :     :

PAGP_YERPN      NERPWGVGYGKYRYDEDNNWHSVYAMAFMDSHNRVEPILGYGYQKMWIPG-EREGWRFGA
PAGP_YERPA      NERPWGVGYGKYRYDEDNNWHSVYAMAFMDSHNRVEPILGYGYQKMWIPG-EREGWRFGA
PAGP_YERPZ      NERPWGVGYGKYRYDEDNNWHSVYAMAFMDSHNRVEPILGYGYQKMWIPG-EREGWRFGA
PAGP_YERPE      NERPWGVGYGKYRYDEDNNWHSVYAMAFMDSHNRVEPILGYGYQKMWIPG-EREGWRFGA
PAGP_YERPB      NERPWGVGYGKYRYDEDNNWHSVYAMAFMDSHNRVEPILGYGYQKMWIPG-EREGWRFGA
PAGP_YERE8      NERPWGIGYGKYRYDENNNWHAVYAMAFMDSHNEVEPIIGYGYQKMWIPA-EMDGWRFGV
PAGP_PHOAA      NERPWGFGYGKYRYDKDNDWHSLYAMAFMDSHNRLEPIIGYGFQKMWIPG-DLDGFRLGV
PAGP_PHOLL      NERPWGFGYGKYRYDEDNDWHSLYAMAFMDSHNRLEPIVGYGFQKMWIPG-DLEGFRMGI
PAGP_PROMH      NETPWGFGMGKYRYDNEGDWHGLYAMAFMDSNNRVQPIMGYGFEKMWYPGGDREGFRMGA
PAGP_ECOKO      NERPWGGGFGLSRWDEKGNWHGLYAMAFKDSWNKWEPIAGYGWESTWRPLA-DENFHLGL
PAGP_ECOLW      NERPWGGGFGLSRWDEKGNWHGLYAMAFKDSWNKWEPIAGYGWESTWRPLA-DENFHLGL
PAGP_ECOLI      NERPWGGGFGLSRWDEKGNWHGLYAMAFKDSWNKWEPIAGYGWESTWRPLA-DENFHLGL
PAGP_ECO57      NERPWGGGFGLSRWDEKGNWHGLYAMAFKDSWNKWEPIAGYGWESTWRPLA-DENFHLGL
PAGP_SHIFL      NERPWGGGFGLSRWDEKGNWHGLYAMAFKDSWNKWEPIAGYGWESTWRPLA-DENFHLGL
PAGP_SHIF8      NERPWGGGFGLSRWDEKGNWHGLYAMAFKDSWNKWEPIAGYGWESTWRPLA-DENFHLGL
PAGP_SHIF2      NERPWGGGFGLSRWDEKGNWHGLYAMAFKDSWNKWEPIAGYGWESTWRPLA-DENFHLGL
PAGP_SHIBS      NERPWGVGFGLSRWDEKGNWHGLYAMAFKDSWNKWEPIAGYGWESTWRPLA-DENFHLGL
PAGP_ECOUT      NERPWGGGFGQSRWDEKGNWHGLYAMAFKDSWNKWEPIAGYGWESTRRPLA-DENFHLGL
PAGP_ECOL6      NERPWGGGFGQSRWDEKGNWHGLYAMAFKDSWNKWEPIAGYGWESTWRPLA-DENFHLGL
PAGP_ECOL5      NERPWGGGFGQSRWDEKGNWHGLYAMAFKDSWNKWEPIAGYGWESTWRPLA-DENFHLGL
PAGP_SALPA      NERPWGVGFGQSRWDDKGNWHGLYMMAFKDSFNKWEPIGGYGWEKTWRPLE-DDNFRLGL
PAGP_SALTI      NERPWGVGFGQSRWDDKGNWHGLYMMAFKDSFNKWEPIGGYGWEKTWRPLE-DDNFRLGL
PAGP_SALTY      NERPWGVGFGQSRWDDKGNWHGLYMMAFKDSFNKWEPIGGYGWEKTWRPLE-DDNFRLGL
PAGP_SALPC      NERPWGVGFGQSRWDDKGNWHGLYMMAFKDSFNKWEPIGGYGWEKTWRPLE-DDNFRLGL
PAGP_CITK8      NERPWGAGFGQSRWDDKGNWHGLYIMAFKDSFNKWEPIGGYGWEKTWRPLA-DENFHMGL
PAGP_CITRI      NERPWGGGFGQSRWDEKGNWHGLYVMAFKDSWNKWEPIGGYGWESTWRPLP-DDNFHLGL
PAGP_CROS8      NERPWGAGMGKSRWDEKGNWHGLYVMAFKDSYNKWEPIAGYGWEATWRPLT-DDAFHVGL
PAGP_CROSK      NERPWGAGMGKSRWDEKGNWHGLYVMAFKDSYNKWEPIAGYGWEATWRPLT-DDAFHVGL
PAGP_CROTZ      NERPWGAGIGKSRWDEKGNWHGLYVMAFKDSYNKWEPIAGYGWEATWRPLP-DDAFHVGL
PAGP_KLEP7      NERPWGAGFGVSRWDEKGNWHGLYLMAFKDSFNKWEPIGGYGWEKTWRPLT-DQNFHLGL
PAGP_ENTLS      NERPWGAGFGMSRWDEKGNWNGLYLMAFKDSFNKWEPIVGYGWEKTWRPLA-DDNFHLGL
PAGP_EDWTF      NERPWGAGFGQSRWDEKGNWHGLYLMAFKDSFNKWEPIGGYGWEATWRPLE-GSDFHWGA
PAGP_EDWTE      NERPWGAGFGQSRWDEKGNWHGLYLMAFKDSFNKWEPIGGYGWEATWRPLE-GSDFHWGA
PAGP_ERWAE      NERPWGAGGGMSRYDEKGNWNGIYLMAFKDSFNKWEPIGGYGWEKTWRPLN-DPDFHFGL
PAGP_ERWAC      NERPWGAGGGMSRYDEKGNWNGIYLMAFKDSFNKWEPIGGYGWEKTWRPLN-DPDFHFGL
PAGP_ERWP6      NERPWGAGGGVSHFDKKGNWNGIYLMAFKDSFNKWELISGYGWEKTWRPLR-DPDFHLGL
PAGP_ERWPE      NERPWGAGGGVSHFDKKGNWNGIYLMAFKDSFNKWELISGYGWEKTWRPLR-DPDFHLGL
PAGP_ERWSE      NERPWGAGGGVSHFDKKGNWNGIYLMAFKDSFNKWELISGYGWEKTWRPLS-DPDFHLGL
PAGP_ERWT9      NERPWGAGGGISHYDEKGNWNGIYLMAFKDSFNKWEPIGGYGWEKTWRPLA-DPDFHLGL
PAGP_PANAA      NERPWGAGGGVSRYDEKGNWHGLYLMAFKDSFNKWEPFGGYGWEATWRPLQ-DQNFHYGL
PAGP_PANAM      NERPWGAGGGVSRYDEKGNWHGLYLMAFKDSFNKWEPFGGYGWEATWRPLQ-DQNFHYGL
PAGP_PECCP      NERPWGAGYGVSRLDKDGDWHGLYIMAFKDSFNKWEPIGGYGYEKRWRPTS-DQDFQLGL
PAGP_PECAS      NEKPWGAGYGVSRLDKDGDWHGLYIMAFKDSYNKWEPIGGYGYEKRWRPTS-DQDFQLGL
PAGP_PECPW      NERPWGAGYGVSRLDQDGDWHGLYIMAFKDSFNKWEPIGGYGYEKRWRPTH-DQDFQLGL
PAGP_DICD3      NERPWGAGYGVSRLDRDGDWHSLYLMAFKDSFNKWEPIGGYGYEKRWRPLE-NQDVQLGL
PAGP_DICC1      NERPWGAGYGVSRLDCDGDWHSLYMMAFKDSFNKWEPIGGYGYEKRWRPLE-DQDFQLGL
PAGP_DICZ5      NERPWGAGFGVSRLDSDGDWHALYVMAFKDSFNKWEPIGGYGYEKRWRPLE-NQDIQFGL
PAGP_DICP7      NERPWGAGYGVSRLDSDGDWHGIYLMAFKDSFNKWEPIGGYGYEKRWKPVAGNDDFQLGL
PAGP_SERP5      NERPWGGGYGISRYDSDGDWHGLYMMVFKDSFNKWEPIGGYAYEKIWRPLED-KDFRLGL
PAGP_SODGM      NERPWGAGYGISRYDEKGNWHAIYLIAFKDSFNKWEPFGGYAWEKQWRPFDRYQDIHFGA
PAGP_ENTCL      NEMPWGGGLGVSRYNDEGNWSALFAMMFKDSHNEWQPAMGYGWEKGWYLDN-AKDFRLGL
PAGP_LARHH      NEHPWGLGLGRYRYDSDGNWHALYAMFFLDSHDKVEPFAGYAWQKIWRPAD---DVRLGA
PAGP_LEGPN      NEAAWGGGLGKSLFDEKGNWHGLYAIAFLDSHRHIEPAVGYAYLKTASVNK---DIKAGL
PAGP_LEGPL      NEAAWGGGLGKSLFDEKGNWHGLYAIAFLDSHRHIEPAVGYAYLKTASVNK---DIKAGL
PAGP_LEGPC      NETAWGGGLGKSLFDEKGNWHGLYAIAFLDSHRHFEPAVGYAYLKTASVNK---DLKAGL
PAGP_LEGP2      NETAWGGGLGKSLFDEKGNWHGLYAIAFLDSHRHLEPAVGYAYLKTASVNK---DLKAGL
PAGP_LEGPH      NETAWGGGLGKSLFDEKGNWHGLYAIAFLDSHRHLEPAVGYAYLKTASVNK---DLKAGL
PAGP_LEGPA      NETAWGGGLGKSLFDEKGNWHGLYAIAFLDSHRHLEPAVGYAYLKTASVNK---DLKAGL
PAGP_LEGLN      NELAWGGGLGKGFFDEKGNWHGLYAFAFLDSHRNVEPTAGYAYLRVANITK---EFKAGL
PAGP_BORBR      NELAWGGGLGKSIYDEDGDWQGLYAMAFLDSHSDIEPIAGYGFQKIGRIGA---DTRLGI
PAGP_BORPA      NELAWGGGLGKSIYDEDGDWQGLYAMAFLDSHSDIEPIAGYGFQKIGRIGA---DTRLGI
PAGP_BORPE      NELAWGGGLGKSIYDEDGDWQGLYAMAFLDSHSDIEPIAGYGFQKIGRIGA---DTRLGI
PAGP_BORPC      NELAWGGGLGKSIYDEDGDWQGLYAMAFLDSHSDIEPIAGYGFQKIGRIGA---DTRLGI
PAGP_METFK      REFTWGLGYGRSRYNAAGNWEGVYLMAFSDSHSNVQPMLGYGHQWMMGPRS---GLHAGV
                .* .** * *    :  .:* .:: : * **    :   **.              : * 

PAGP_YERPN      GFTASITARYEY-HYIPLPLPLPLISIEYNRLSLQTTYIPGTYNN----GNVLFTWIR--
PAGP_YERPA      GFTASITARYEY-HYIPLPLPLPLISIEYNRLSLQTTYIPGTYNN----GNVLFTWIR--
PAGP_YERPZ      GFTASITARYEY-HYIPLPLPLPLISIEYNRLSLQTTYIPGTYNN----GNVLFTWIR--
PAGP_YERPE      GFTASITARYEY-HYIPLPLPLPLISIEYNRLSLQTTYIPGTYNN----GNVLFTWIR--
PAGP_YERPB      GFTASITARYEY-HYIPLPLPLPLISIEYNRLSLQTTYIPGTYNN----GNVLFTWIRWQ
PAGP_YERE8      GFTASITARHEY-HYIPIPLPLPLISIEYNKFSLQTTYIPGTYNN----GNVLFTWMRWQ
PAGP_PHOAA      GFTLSVTARHDY-YYVPIPLPLPLFSVEYDQLSFQGTYIPGTYNN----GNVFFAWLRWQ
PAGP_PHOLL      GFTLSVTARHDY-YYVPIPLPLPLFSIEYDRLSFQGTYIPGTYNN----GNVLFAWLRWQ
PAGP_PROMH      GFTLSVTARHEY-NYIPMPLPLPLVSVGYEHLSLQATYVPGTYNN----GNVLFAWLRWQ
PAGP_ECOKO      GFTAGVTARDNW-NYIPLPVLLPLASVGYGPVTFQMTYIPGTYNN----GNVYFAWMRFQ
PAGP_ECOLW      GFTAGVTARDNW-NYIPLPVLLPLASVGYGPVTFQMTYIPGTYNN----GNVYFAWMRFQ
PAGP_ECOLI      GFTAGVTARDNW-NYIPLPVLLPLASVGYGPVTFQMTYIPGTYNN----GNVYFAWMRFQ
PAGP_ECO57      GFTAGVTARDNW-NYIPLPVLLPLASVGYGPVTFQMTYIPGTYNN----GNVYFAWMRFQ
PAGP_SHIFL      GFTAGVTARDNW-NYIPLPVLLPLASVGYGPVTFQMTYIPGTYNN----GNVYFAWMRFQ
PAGP_SHIF8      GFTAGVTARDNW-NYIPLPVLLPLASVGYGPVTFQMTYIPGTYNN----GNVYFAWMRFQ
PAGP_SHIF2      GFTAGVTARDNW-NYIPLPVLLPLASVGYGPVTFQMTYIPGTYNN----GNVYFAWMRFQ
PAGP_SHIBS      GFTAGVTARDNW-NYIPLPVLLPLASVGYGPVTFQMTYIPGTYNN----GNVYFAWMRFQ
PAGP_ECOUT      GFTAGVTARDNW-NYIPLPVLLPLASVGYGPATFQMTYIPGTYNN----GNVYFAWMRFQ
PAGP_ECOL6      GFTAGVTARDNW-NYIPLPVLLPLASVGYGPATFQMTYIPGTYNN----GNVYFAWMRFQ
PAGP_ECOL5      GFTAGVTARDNW-NYIPLPVLLPLASVGYGPATFQMTYIPGTYNN----GNVYFAWMRFQ
PAGP_SALPA      GFTAGVTARDNW-NYIPIPVLLPLASIGYGPATFQMTYIPGSYNN----GNVYFAWMRFQ
PAGP_SALTI      GFTAGVTARDNW-NYIPIPVLLPLASIGYGPATFQMTYIPGSYNN----GNVYFAWMRFQ
PAGP_SALTY      GFTAGVTARDNW-NYIPIPVLLPLASIGYGPATFQMTYIPGSYNN----GNVYFAWMRFQ
PAGP_SALPC      GFTAGVTARDNW-NYIPIPVLLPLASIGYGPATFQMTYIPGSYNN----GNVYFAWMRFQ
PAGP_CITK8      GFTAGATARDNW-KYIPVPVLLPLASIGYGPATFQMTYIPGTYNN----GNVYFAWMRFQ
PAGP_CITRI      GFTAGVTARDNW-KYIPVPVLLPLASIGYGPATFQMTYIPGTYNN----GNVYFAWMRFQ
PAGP_CROS8      GYTVGVTARDNW-DYIPIPLVLPLASVGYGPATFQMTYIPGTYNN----GNVYFAWLRLQ
PAGP_CROSK      GYTVGVTARDNW-DYIPIPLVLPLASVGYGPATFQMTYIPGTYNN----GNVYFAWLRLQ
PAGP_CROTZ      GYTLGVTARDNW-DYIPIPLVLPLASVGYGPATFQMTYIPGTYNN----GNVYFAWLRLQ
PAGP_KLEP7      GYTLGVTARDNW-NYIPIPVILPLASIGYGPATFQMTYIPGTYNN----GNVYFAWARFQ
PAGP_ENTLS      GYTLGVTARDNW-NYIPLPVILPMASVGYGPATFQMTYIPGTYNN----GNVYFAWLRFQ
PAGP_EDWTF      GYTVGVTMRDNW-RYIPIPVILPMASVGYGPLTLQMTYIPGTYDN----GNVYFAWLRLQ
PAGP_EDWTE      GYTVGVTMRDNW-RYIPIPVILPMASVGYGPLTLQMTYIPGTYDN----GNVYFAWLRLQ
PAGP_ERWAE      GYTAGVTMRDNW-NYIPIPLLLPLASIGYGAANFQMTYIPGTYNN----GNVYFAWLRWQ
PAGP_ERWAC      GYTAGVTMRDNW-NYIPIPLLLPLASIGYGAANFQMTYIPGTYNN----GNVYFAWLRWQ
PAGP_ERWP6      GYTAGVTMRDNW-SYIPIPVLLPLASIGYEYVSFQMTYIPGTYNN----GNVYFAWLRWQ
PAGP_ERWPE      GYTAGVTMRDNW-SYIPIPVLLPLASIGYEYVSFQMTYIPGTYNN----GNVYFAWLRWQ
PAGP_ERWSE      GYTAGVTMRDNW-SYIPIPVLLPLASIGYEYVSFQMTYIPGTYNN----GNVYFAWLRWQ
PAGP_ERWT9      GYTAGVTMRDNW-NYIPIPVLLPLASIGYGSATFQMTYIPGTYNN----GNVYFAWLRWQ
PAGP_PANAA      GYTAGVTARHNW-GYYPVPAILPLASIGYGSLNFQMTYIPGTYNN----GNVYFAWLRWQ
PAGP_PANAM      GYTAGVTARHNW-GYYPVPAILPLASIGYGSLNFQMTYIPGTYNN----GNVYFAWLRWQ
PAGP_PECCP      GFTAGVTMRDNW-NYIPIPVLLPLASISYSKLSFQATYIPGTYNN----GNVFFAWLRWQ
PAGP_PECAS      GFTAGFTMRDNW-NYIPIPVLLPLASISYSKLSFQATYIPGTYNN----GNVFFAWFRWQ
PAGP_PECPW      GFTAGFTMRDNW-NYIPIPVLLPLASISYSKLSFQATYIPGTYNN----GNVFFAWFRWQ
PAGP_DICD3      GFTAGVTMRDNW-KYIPIPVLLPMASVSYQRLSFQATYIPGTHNN----GNVFFAWLRWQ
PAGP_DICC1      GFTAGVTLRDNW-NYIPLPVLLPMASLSYQRLSFQATYIPGTYNN----GNVFFAWLRWQ
PAGP_DICZ5      GFTAGVTMRDNW-HYIPIPVLLPLASVSYQRLSFQATYIPGTYNN----GNVFFAWLRWQ
PAGP_DICP7      GFTAGVTMRDNW-NYIPIPVLLPLASINYQRLSFQMTYIPGTHNN----GNVYFAWLRWQ
PAGP_SERP5      GFTASITARDNW-NYIPIPAPLPLASIGYKQLTFQATYIPGTYNN----GNVFFGWFRWQ
PAGP_SODGM      GFTAGVTARDNW-KYIPVPALLPLASVGYKQLTFQATYIPGTYNN----GNVFFAWLRYR
PAGP_ENTCL      GAAAGITARDDFANYVPLPFIFPLFSAGYKRVTVQFTYIPGTYNN----GNVLFAWLRLG
PAGP_LARHH      GFTVGVTARSDY-SYIPFPAILPLVSVEYRRLALQATYIPGGHNN----GNVLFGWLRWQ
PAGP_LEGPN      GYSVLVTSRVD-YDNVPFPGALPWVALFYKRTTVAATYIPGSAGA----GNVLYILGKIS
PAGP_LEGPL      GYSVLITSRVD-YDNVPFPGALPWVALFYKRTTVAATYIPGSAGA----GNVLYILGKIS
PAGP_LEGPC      GYSVLVTSRVD-YDNVPIPGALPWAALFYKRITIAATYIPGSSREGHENGNVLYMLGKIS
PAGP_LEGP2      GYSVLVTSRVD-YDNVPIPGALPWAALFYKRITIAATYIPGSSREGHENGNVLYMLGKIS
PAGP_LEGPH      GYSVLVTSRVD-YDNVPIPGALPWAALFYKRITIAATYIPGSSREGHENGNVLYMLGKIS
PAGP_LEGPA      GYSVLVTSRVD-YDNVPIPGALPWAALFYKRITIAATYIPGSSREGHENGNVLYMLGKIS
PAGP_LEGLN      GFSVLVTARPDIFHNIPFPGAVPWAGIFYKKLSVKAAYIPGSSTN----GNVLYVVGTYS
PAGP_BORBR      GYTVFLTSRSDIMSRVPFPGILPLVSAGYRDATLYATYIPGGKGN----GNVLFMFGRWE
PAGP_BORPA      GYTVFLTSRSDIMSRVPFPGILPLVSAGYRDATLYATYIPGGKGN----GNVLFMFGRWE
PAGP_BORPE      GYTVFLTSRSDIMSRVPFPGILPLVSAGYRDATLYATYIPGGKGN----GNVLFMFGRWE
PAGP_BORPC      GYTVFLTSRSDIMSRVPFPGILPLVSAGYRDATLYATYIPGGKGN----GNVLFMFGRWE
PAGP_METFK      GYTAFLTSRADIYKNIPIPGVLPIASLNYRQYSVNTSYVPGGRGN----GNILFFWSRVG
                * :   * * :     *.*  .*  .  *    .  :*:**        **: :      

PAGP_YERPN      ---
PAGP_YERPA      ---
PAGP_YERPZ      ---
PAGP_YERPE      ---
PAGP_YERPB      F--
PAGP_YERE8      F--
PAGP_PHOAA      W--
PAGP_PHOLL      W--
PAGP_PROMH      ---
PAGP_ECOKO      F--
PAGP_ECOLW      F--
PAGP_ECOLI      F--
PAGP_ECO57      F--
PAGP_SHIFL      F--
PAGP_SHIF8      F--
PAGP_SHIF2      F--
PAGP_SHIBS      F--
PAGP_ECOUT      F--
PAGP_ECOL6      F--
PAGP_ECOL5      F--
PAGP_SALPA      F--
PAGP_SALTI      F--
PAGP_SALTY      F--
PAGP_SALPC      F--
PAGP_CITK8      F--
PAGP_CITRI      F--
PAGP_CROS8      F--
PAGP_CROSK      F--
PAGP_CROTZ      F--
PAGP_KLEP7      F--
PAGP_ENTLS      F--
PAGP_EDWTF      F--
PAGP_EDWTE      F--
PAGP_ERWAE      F--
PAGP_ERWAC      F--
PAGP_ERWP6      L--
PAGP_ERWPE      L--
PAGP_ERWSE      L--
PAGP_ERWT9      F--
PAGP_PANAA      F--
PAGP_PANAM      F--
PAGP_PECCP      I--
PAGP_PECAS      I--
PAGP_PECPW      I--
PAGP_DICD3      F--
PAGP_DICC1      F--
PAGP_DICZ5      F--
PAGP_DICP7      L--
PAGP_SERP5      F--
PAGP_SODGM      F--
PAGP_ENTCL      F--
PAGP_LARHH      L--
PAGP_LEGPN      L--
PAGP_LEGPL      L--
PAGP_LEGPC      L--
PAGP_LEGP2      L--
PAGP_LEGPH      L--
PAGP_LEGPA      L--
PAGP_LEGLN      FDK
PAGP_BORBR      F--
PAGP_BORPA      F--
PAGP_BORPE      F--
PAGP_BORPC      F--
PAGP_METFK      F--