CLUSTAL format seed alignment for MF_00839

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

HPF_BRADU         ------------------------MTLRISGKSVSVGEALRGRVSDRTEEVLRKYFDGN-
B1M4S3_METRJ      -----------------------MGSLRVTGHGVDLGESLRGRVEERMSAIQAKYLDSHM
HPF_RHIME         ------------------------MSVRVSGKHMEIGDSFRVRIGEQIEQAVTKYFDGG-
Q7D1P1_AGRFC      ------------------------MSVRVSGKHMEIGESFRQRIEDNIGLAVTKYFDGG-
H7C7J2_CAUVC      ------------------------MQVQVSGKHVDVGEALRARVSDEIALSIGKYFDRG-
Q1GP80_SPHAL      ------------------------MEIRVSGHQIETGEALQAHVADRMNAIADKYFSRA-
Q3IYP3_CERS4      ------------------------MRYQISGKQIDIGEALQTHVKSELGEVIEKYAQRP-
HPF_BACSU         ------------------------MNYNIRGENIEVTPALKDHVERKI--GKLERYFDH-
HPF_LISM4         -----------------------MLKYNIRGENIEVTEPIRDYVEKKI--DKLERYFTE-
HPF_STAA3         -----------------------MIRFEIHGDNLTITDAIRNYIEEKI--GKLERYFND-
HPF_STAA8         -----------------------MIRFEIHGDNLTITDAIRNYIEEKI--GKLERYFND-
HPF_STRP6         -----------------------MIKFSIRGENIEVTEAIRDYVESKL--TKIEKYFAK-
HPF_LACLM         -----------------------MIKFNIRGENVEVTDAIRAYVEDKI--GKLDKYFND-
HPF_DEIRA         -----------------------MQIYQLSGRNVEVTEPMREYVEEKL--SRLDRYTDQ-
HPF_SYNP2         ------------------------MKLLIQGNNIAVTESIHDYVESKL--EKATKHFQTF
HPF_SYNY3         ------------------------MKLLIQGNNITVTEAIHDYVEEKV--ERAVKHFQNL
HPF_MYCTU         MSRLAVDSGQVLAEPKSN------AEIVFKGRNVEIPDHFRIYVSQKL--ARLERFDRTI
Q8NSB7_CORGL      MTTPAENNTLSPE-----------TKVSITGRNVEVPDHFAERVNTKL--AKIERLDPTL
Q9KYX2_STRCO      MDRNLVQKGDAPPSKRSDPGTEFCVDIVVKGRKTEVPERFRKHVAEKLKLEKIQKLDGKV
Q8G4G6_BIFLO      ------------------------MEIVVTGRHTQVKQRFRDVVETKM--NRVTAIAPDA
C1DTJ4_SULAA      ------------------------MQVEHVGKNIELTDFIKAYTEHKL--ERLKNYLKDL
O67537_AQUAE      -----MRLYLIIESGKSTKLRRKEMNIEYRGVDVNISEAMKAVIESKL--NRFKRYLKEV
Q8RG57_FUSNN      ------------------------MKLSIHGRKITLTDAIRKYAEEKI--SKVEKFNDSI
D1B9M7_THEAS      ------------------------MDVRFVARNVELQNSVKDLMEKKL--GKLERFFDRI
C7M130_ACIFD      ------------------------MAVDLRCRGCTLTEQQRAHVEDRI--ARLEKYLGAP
Q72BK6_DESVH      ------------------------MNIAFTFKNFEPSEHLKKYARRRF--EKLARFVGKS
Q2LSN2_SYNAS      ---MMFPFRVKPFGRIIMLRPYHVKWIQGGAKMMKISVTFRNTEEEGWQTQYVEDRVKRL
Q9X1U3_THEMA      ------------------------MEYRITGKGVEISEAIKNYLEKRL--DKIDRVIYDD
Q1IR29_KORVE      ------------------------MNVEVIGRQYNITPAVRKEVESGL--EKLTKILGES
                                                                              

HPF_BRADU         ---YSGHITLSKD-G------------FGFRTDCALHLDS--GITLEADSNAPDAYASAD
B1M4S3_METRJ      HDSCNGHVTLRRD-G------------TAFRTDCVLHLVS--GLTIEANGFAHDARSSFE
HPF_RHIME         ---YSSQVTVEKS-G------------SRFSADCKLHLDT--GVVLQANGQANEPQSAFD
Q7D1P1_AGRFC      ---YSGQVTVEKS-G------------SRFAADCKLHLDT--GVVLHAAGQANDPQASFD
H7C7J2_CAUVC      ---GAAEVVVSKE-G------------YAFRVDCSVKLAS--GQQLISHGSGGDAHAAFD
Q1GP80_SPHAL      ---ISAHATFGKGPH------------DSFQCDIVAHVMQ--GLVLKGHGQAQDAHVAFE
Q3IYP3_CERS4      ---TEATIVFSRV-A------------HEHVCESTIHLST--GLTAQATGRATEIYAAFE
HPF_BACSU         SVDADVNVNLKFYN--------------DKESKVEVTIPMT-DLALRSEVHNEDMYNAID
HPF_LISM4         TPDANVHVNLKVYS--------------DKNAKVEVTIPLP-NLVLRAEETSGDLYASID
HPF_STAA3         VPNAVAHVKVKTYS--------------NSATKIEVTIPLK-NVTLRAEERNDDLYAGID
HPF_STAA8         VPNAVAHVKVKTYS--------------NSATKIEVTIPLK-NVTLRAEERNDDLYAGID
HPF_STRP6         DQEIDARVNLKVYR--------------ERSSKVEVTIPLD-SVTLRAEDVSQDMYGSID
HPF_LACLM         GHEVTAYVNLKVYT--------------EKRAKVEVTLPAK-NVTLRAEDTSQDMYSSID
HPF_DEIRA         ITDARVTLTVRDVRN------------NERRNRVEVQLNVP-GGIIRAEEHHADMYAAID
HPF_SYNP2         ATKVDVHLSVANNAR------------ITDKHKAEVTVYAN-GTVIRAQEGSENLYASID
HPF_SYNY3         TTKVDVHLSVARNAR------------ITNKHKAEVTVYAN-GTVIRAQEGSENLYASID
HPF_MYCTU         YLFDVELDHERNRRQ------------RKSCQRVEITARGR-GPVVRGEACADSFYAALE
Q8NSB7_CORGL      TFFHVELQHEPNPRR------------ADESDRIQITATGK-GHIARAEAKEDSFYAALE
Q9KYX2_STRCO      ISLDVEVSKEPNPRQ------------ADRCDRVEITLRSR-GPVIRAEAAASDPYAALD
Q8G4G6_BIFLO      QRAQIVLTHEGNPRQ------------ADTAKRVEITVIAG-RTVVRAEASSTDEFSALD
C1DTJ4_SULAA      DTSEDSVRVRVVYDFEKRR--------HRNRVDIDIYFNTPGGGVIHAWEESNDLYSAID
O67537_AQUAE      GEDEVEAVVAISSTRSRQKDYAGDSLPTFYRVDLHLYLKNVPHGAIHAWEEDTDVFTAID
Q8RG57_FUSNN      IKIDATLAASKLKTG---------------NAHVTEILAYLSGSTLKATATESDLYASID
D1B9M7_THEAS      LDTQVAVDFKRGMYV------------------VEITSNIN-GMVMRGEDYAPDLRKAFE
C7M130_ACIFD      ERVEVHVERAGNPAN-------------PDRVVTEVTYVVS-KAVVRARGVGETELESFD
Q72BK6_DESVH      ANLELQVALSLDKFR----------------QKAEVQLVGD-SINIAAVEQSEDMYATID
Q2LSN2_SYNAS      NKYIDAPADVHVVLTV-----------EKFRNVAEISVMTN-GLNLIGKEESKDMHLAID
Q9X1U3_THEMA      DLVSFNVRIEKDGKN---------------QYVVKFNMNLK-GNIINVEERHPDIYTAID
Q1IR29_KORVE      FKSKVILSVEKHRNL------------------AEITIKRR-AQDLVGLGESTDMRTAIG
                                                                              

HPF_BRADU         QALVMIEKRLKRYKSRLKDRSARKAHVASAALAAMDATSYVLEAPG---EGEDEDEVTGY
B1M4S3_METRJ      QTAERLETRLRRYKHKLKQHATG-----PGDAAAIEAAYAVFAAPE---VEEDDAAEGDA
HPF_RHIME         AASERIEKRLRRYKRKLKDHHNG-----NGQNSTEVAYRVMDSVP-----FEDEEVPDDY
Q7D1P1_AGRFC      AAAERIEKRLRRYKRKLKDHHSG-----SNGALPEIAYTVMDAVP-----DEDHEVPEDY
H7C7J2_CAUVC      AALAKIDTRIRRYKRRLKSHSAA-----ATAKQVENAAMFVLRAPESDDVDEDWDIEDDH
Q1GP80_SPHAL      GAADRIEKQLRRYMRRLKDRNNGPAEPSPTIDEIEDNASYTVFDPG-----TEEDEAGDA
Q3IYP3_CERS4      SCREKMDKQLRRYKRRLRDHHRER----TAPVEFGPGSSYILAASE----EAEDGEVENL
HPF_BACSU         LATNKLERQIRKHKTKVNRKFREQGSPK-YLLANGLGSDTDIAVQDDIEEEES-------
HPF_LISM4         LIVDKLERQIRKHKTKVNRKFRDKGAERDYFAYSDVNGSTP---PEENEGDFD-------
HPF_STAA3         LINNKLERQVRKYKTRINRKSRDRGDQEVFVAELQEMQETQ--VDNDAYDDNE-------
HPF_STAA8         LINNKLERQVRKYKTRINRKSRDRGDQEVFVAELQEMQETQ--VDNDAYDDNE-------
HPF_STRP6         LVVDKIERQIRKNKTKIAKKHREKVPTGQVFTTEFEA-EEVDEIPE--------------
HPF_LACLM         FVEEKLERQIRKYKTRMNRKPRNAVPTGQVFGDEFAPLDTTDEVAEDH------------
HPF_DEIRA         KASDVLERQLRKFKTRYMKQRQEGRPEPLPGPAEAEVNAQGSGAAMDDVSEFH-------
HPF_SYNP2         LVSDKIARQLRKYKEKNFGKKTHVQEKTSEVLPEDPVPDNL---IGDRAPELP-------
HPF_SYNY3         LVADKIARQLRKYKER-IQDKQHGNVKTSEIVEDKPVEENL---IGDRAPELP-------
HPF_MYCTU         SAVVKLESRLRRGKDRRKV-HYGDKTPVSLAE-ATAVVPAPEN----GFNTRPAEAHDHD
Q8NSB7_CORGL      TALAKMERSLRKVKARRSISRSGHRAPLGTGE-VGAQLVAESQEARGADELGKYDVDPYA
Q9KYX2_STRCO      LAAEKLGARLRKQHDKRFS-RRGARR-ISAAE-VADHVPGAATLNGNGDVVPTEKQDGVP
Q8G4G6_BIFLO      MALDKLTLRLRRTRDRRKDHRRGYANPVPVDLGVIAPEPEPEVSEEEPNNSPQAAVASDL
C1DTJ4_SULAA      FVIDEVERQLIRLKSRRIEEKRRQAKL-ESLKEHSVTTPSIER-----------------
O67537_AQUAE      KALDELEKQLVKLKERRHEYIREARKFKEKLHEAELAPEERER-----------------
Q8RG57_FUSNN      KAVDIMESLLKKHKEKRSRAKVQDDTRKKSYSFDYIVEPEEKLSDE--------------
D1B9M7_THEAS      KSLKNIERQVKRHKDMLVDRLQLKTKDISFELETEPFVAEEEKQEGG-------------
C7M130_ACIFD      RAEERLKRRLERLKGRLVARSHPHHRGGAEAPEARLD-----------------------
Q72BK6_DESVH      LVLDKLEAQLKKHVSRVKERRRSARTNANIDVFTYHTEGEGED-----------------
Q2LSN2_SYNAS      NAVEKIERQLKKHKEKIRGYKNNTMKEEETIEAEAFPGELEDVAGA--------------
Q9X1U3_THEMA      FASDALEKQVKRLKERLKNHPHRSSALVETPLEEPGEFSPSDK-----------------
Q1IR29_KORVE      EALEHIEKQALKHNNRRRNIKRKGKADWKETSEGEQALTIAVGSTATTAVPVMVHKFPSV
                       :     :                                                

HPF_BRADU         ------------SPVIIAEATTSLKQLSVSEAVMELDLSGAPCLVFQHGSSGRVNIIYRR
B1M4S3_METRJ      ------------HPPIVAESTKTLQRRTIGEAVTALDMTGSPVVVFVHAGTGRVNVVYRR
HPF_RHIME         ------------APTIVAETTKQLRTMSVANAVMALDMTDEPVLMFRSPGKDDLNIVYRR
Q7D1P1_AGRFC      ------------APTIVAESSKQIKTMSVASAVMALDMTDEPVLLFRSPGKEYLNIVYRR
H7C7J2_CAUVC      PTGAP-------AAMVIAETQAAMKTMTVSMAVMELDLTAYPAIVFRNAAHGGISVVYRR
Q1GP80_SPHAL      -------------PAIIAETRVDIPNSSVSDAVMMLDLRNTNALLFVNSKTGAHNMVYRR
Q3IYP3_CERS4      ------------QPMVIAEMETKVPSITVGEAVMQLELAGQSMLVFRNEGHGGVNVVYRR
HPF_BACSU         -------------LDIVRQKRFNLKPMDSEEAILQMNMLGHNFFVFTNAETNLTNVVYRR
HPF_LISM4         -------------LEIVRTKQFSLKPMDSEEAVLQMNLLGHSFYVYTDAETNGTNIVYSR
HPF_STAA3         -------------IEIIRSKEFSLKPMDSEEAVLQMNLLGHDFFVFTDRETDGTSIVYRR
HPF_STAA8         -------------IEIIRSKEFSLKPMDSEEAVLQMNLLGHDFFVFTDRETDGTSIVYRR
HPF_STRP6         -------------VQVVRTKNVTLKPMDVEEARLQMELLGHDFFIYTDSEDGATNILYRR
HPF_LACLM         -------------VDIVRTKHVALKPMDAEEAVLQMDMLGHDFYVFTDADSNGTHVVYRR
HPF_DEIRA         -------------PEIVRQKRFELRPMSAEDAVVQMEALGHDFYVFQDLQ-GQTGVVYRR
HPF_SYNP2         -------------SEVVRMKYFAMPPMTIDEALEQLQLVDHDFYMFLNKDTNAINVIYIR
HPF_SYNY3         -------------SEVLRMKYFAMPPMAIEDALEQLQLVDHDFYMFRNKDTDEINVIYIR
HPF_MYCTU         GAVVEREPGR-----IVRTKEHPAKPMSVDDALYQMELVGHDFFLFYDKDTERPSVVYRR
Q8NSB7_CORGL      DKVDDVMPGQ-----VVRTKEHPATPMSVDDALSEMELVGHDFYLFVNEETNQPSVVYRR
Q9KYX2_STRCO      TKKIGSLEVQGDGPLVVREKTHVAAPMSLDQALYEMELVGHDFYLFVDSETKEPSVVYRR
Q8G4G6_BIFLO      GPGESVEVQVGDTPIVIRRKLHIAEPMSIDEALYEMELIGHDFFLFVNKETGRPSVVYHR
C1DTJ4_SULAA      -------------PLITLEPLPSEKPMSVEDARLLLEETGAFFLPFINSETGQVNVIYRK
O67537_AQUAE      -------------PEIVEEELVVDKPMSVEDAKAELEETHAYFIPFVDIADGQLKILYRK
Q8RG57_FUSNN      --------------KKLVRVYLPLKPMEISEAILQLEYLNRVFFAFTNTTTGKMAVVYKR
D1B9M7_THEAS      -------------VNIVKVKRFPVRVMTPEEAALQMDLLGHSFFLFRDGDTGDLNVVYRR
C7M130_ACIFD      ---------------IRRRKRFALQPLDPQSAAFRMDLLDHSFYLFINEETGRPAVVYRR
Q72BK6_DESVH      -------------RAIVGTDQFVPKPLHVDEAAMQLDALDYEFLVFLNAESERINVIYRR
Q2LSN2_SYNAS      --------------KIVETRKIILKPMSLDDAVLEMDSTKNRFVVYRNAISENVNVIYRR
Q9X1U3_THEMA      ---------------VSSVKRVSLLNLDLDEAVMQMDELNHRFLVFRNVNTGEINLLYRD
Q1IR29_KORVE      TRTTE-------AHLTRSQDAVALRPMTVEEAVKECEFRDREVFVFRDKK-GRVNVLHRR
                                                 *    :        :         :::  

HPF_BRADU         ADGNVGWVDPPGGKADGKAGG---------
B1M4S3_METRJ      SDGAIGWVDPPNATE---------------
HPF_RHIME         NDGNIGWIDAANIKA---------------
Q7D1P1_AGRFC      HDGNIGWIDAETIKS---------------
H7C7J2_CAUVC      PDGNIGWIDPERTKSNGHGSTAS-------
Q1GP80_SPHAL      DDGTIGWVEPR-------------------
Q3IYP3_CERS4      DDGNIGWIDPRNSK----------------
HPF_BACSU         NDGKYGLIEPTE------------------
HPF_LISM4         KDGKYGLIETN-------------------
HPF_STAA3         KDGKYGLIQTSEQ-----------------
HPF_STAA8         KDGKYGLIQTSEQ-----------------
HPF_STRP6         EDGNLGLIEAK-------------------
HPF_LACLM         TDGRYGLIETE-------------------
HPF_DEIRA         RDGHYGLIGSS-------------------
HPF_SYNP2         NHGGYGVIQPRLGKE---------------
HPF_SYNY3         NHGGYGVIQPHQAS----------------
HPF_MYCTU         HAYDYGLIRLA-------------------
Q8NSB7_CORGL      HAFDYGLISLSDA-----------------
Q9KYX2_STRCO      HAYDYGVIHLTTDTMVTQAHAPDAGDALGG
Q8G4G6_BIFLO      HGWSYGVFEIDTPENVKKA-----------
C1DTJ4_SULAA      KAGNYGLIAPNV------------------
O67537_AQUAE      RGGNYGLLSTGCKYL---------------
Q8RG57_FUSNN      KDGDYGVIED--------------------
D1B9M7_THEAS      KEGGYGVLKPE-------------------
C7M130_ACIFD      EDGTVGLIDQAEEEGAGVAD----------
Q72BK6_DESVH      RNGDFGLIDPVV------------------
Q2LSN2_SYNAS      DDGGYLLIETNG------------------
Q9X1U3_THEMA      ENGDIHLIEMAE------------------
Q1IR29_KORVE      KDGKMELIEAP-------------------
                         .