CLUSTAL format seed alignment for MF_00841

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

C4ZG42_AGARV          -----MKTHITTLNNMA--GTASLAHRRVLKVAQS-IGCHEMGLSFY----PLKPDYAKE
A0A174FAP9_9FIRM      -----MKTHITTLNNMA--GTASLAHRRVLKVAQS-IGCHEMGLSFY----HLKPDYAKE
D4JM13_9FIRM          -----MKTHITTLNNMA--GTASLAHRRVLKVAQS-IGCHEMGLSFY----PLKPDYAKE
D6E170_9FIRM          -----MKTHITTLNNMA--GTASLAHRRVLKVAQS-IGCHEMGLSFY----PLKPDYAKE
A0A380KDH8_9STRE      -----MKVHVTCVTNHRQDSVARMAQQMIADVGRQ-LGYEVCPIYTKYTTPHQEPDSLEE
A0A1D7TQ84_9LACO      -----MSIYITKVCGLR--GTAGKGQQLVANEAKK-LGIEEIRIPYY----DYFSESKEE
A0A1V9QDC9_9LACO      -----MSIYITKICGLG--GTAGKGQQLVANEAKK-LGIEEIRIPYY----DYFSESREE
A0A1D7TQ53_9LACO      -----MSIYITNTYALI--GVGSKAQNLVTEEAKK-LGIEEIRIPYI----DYKSEDRNN
A0A089QAW7_9LACO      -----MSIYITNTYVLG--GIASKAQNLVTEEAKK-LGIEEIRIPYI----DYESEDRNN
A0A089RTA9_9LACO      -----MRVHITSLYGMM--GVVGVSQRRTAEIGRQ-LGFNELGIFRY----PVESDTDAE
A0A1V9QD95_9LACO      ---MKNRVHITSLYGLG--GIAGVAQKRAVEAAKQ-LGFNELAIFKY----DDLADSPSE
A0A1D7TQ77_9LACO      ---MKNRVHITSLYGLG--GIAGVAQKRAVEAAKQ-LGFNELAIFKY----DDLTDSPSE
A0A089QFZ3_9LACO      ---MKNRTHITSLYGIG--GIAGVAQKRVVEAAKQ-LGINELAIFTY----DDLTDSPSE
T2F5F4_LACLC          -----MNKYITNIYGHSLQSTAMHGQHAITNLAQE-IGYKEINIAAY----RVSDDSEEE
A0A1I4EXP7_9LACT      -----MRKYITNLYGQSEQSTAMTAQHMITKLAQD-EGFKEISISAY----SVSEDTAEE
A0A380JYM5_STRDY      -----MKVHITNLRGMAASSTAQVAQNKVAKIARD-LGFYEIGVYFF----DTKSDSTSE
A0A0D4CK53_LACMC      -----MTVYITNMHGQMRNSTAQIAQNMAAQFADE-IGIRELGYYFY----DASAEPAGE
GTF3_STRPA            -----MRVYITNINGQSIQSTAQLCQNTVTDVAVS-LGYRELGIYCY----QIHTDSESE
GTF3_STRA6            -----MRTYITNLNGHSITSTAQIAQNMVTDIAVS-LGFRELGIHSY----PIDTDSPEE
A0A222W676_9LACO      -----MRVHITNMNGQA--STAQVAQNMVAKIAREQLGFTEMGIYSY----NVASDSPDK
A0A222W6A0_9LACO      -----MQVHITNLHGQSLKSTAQRAQNMVTEIATKQLDFNEMGLYFY----PVKSDSPDK
GTF3_STRPN            -----MKLHLTNLYGMAGDSTVILAQNAVQKIASQ-LGFREVGIYFY----NIASDSPSE
GTF3_STRGN            -----MKVNITNLYGMSGQSTALIAQNDVTKLAKQ-LGFNELSFYFY----DIYSDSQSE
F4AEQ9_LACJH          -----MTVHITNINGMAINSVAQNAQNMVVDFAKQ-LGMNEFGIYVY----HWKEEPLQA
A0A7D9N503_LACJH      ----MMTVHITNINGMALNSVAQNAQNMVVDFAKQ-LGMNEFGIYVY----HWKEEPLQA
Q74L32_LACJO          ----MMTVHITNINGMAMNSVAQNAQNMVVDFAKQ-LGMNEFGIYVY----HWTEEPLQA
A0A3G2JWK4_LACJH      -----MTVHITNINGMAMNSVAQNAQNMVVDFAKQ-LGMNEFGIYVY----HWTEEPLQA
A0A347T5X0_LACRE      -----MTVHITNLYGFNLKSTAQIAQHQIARIACDQLGFKELGIYCY----DSSQESLPH
S5NS50_LACRE          -----MTVHITNLYGFNLKSTAQIAQHQIARIACDQLGFKELGIYCY----DSSQESLPH
A0A0U5EYB6_LACRE      -----MTVHITNLYGQSFQSTAQIAQNQIAKIGRE-LGFNELGIYSY----NWPDEPSVA
GTF3_LIMR5            MEGLSLTVHITNLYGQSFQSTAQIAQNQIAKIGRE-LGFNELGIYNY----NWPDEPSVA
A0A0U5JTA1_LACRE      -----MTVHITNLYGQSFQSTAQIAQNQIAKIGRE-LGFNELGIYSY----NWPDEPSVA
A0A2K4ZEP1_9FIRM      -----MKVHITNVSGLA--GAAGNAQQRVTDIARRYLYVNVLGIFHY----PVESDTPEM
A0A2K4ZEP8_9FIRM      -----MKVHITNIYGVT--GIGLKAQQAAAEIAKRDLQYQELGIYFY----PVDSDSPDM
                               :*        .     :.     .                      :    

C4ZG42_AGARV          IDKRLDGIIAPLNYGDIVIFQYPSWIGVNYDESFVNKIKSYRD---TKLIIFVQDIQKLM
A0A174FAP9_9FIRM      IDKRLDGIIAPLNYGDIVIFQYPSWIGVNYDESFVNKIKSYRD---TKLIIFVQDIQKLM
D4JM13_9FIRM          IDKRLDGIIAPLNYGDIVIFQYPSWIGVNYDESFVNKIKSYRD---TKLIIFVQDIQKLM
D6E170_9FIRM          IDKRLDGIIAPLNYGDIVIFQYPSWIGVNYDESFVNKIKSYRD---TKLIIFVQDIQKLM
A0A380KDH8_9STRE      LLKRLDDLGKKTAAGDAVIFQFPTWNHYTVDANLLSWLKSQQR----RVIIFLHDYVPVM
A0A1D7TQ84_9LACO      LSKRIDGILTGISENDTVILQSPTWNYPNFESALIGHLKSIDN---LQLVIFVHDIRAMM
A0A1V9QDC9_9LACO      LSKRIDGILTGVSENDTVILQSPTWNYPNFESALIGHLKSIDN---LQLVIFVHDIRAMM
A0A1D7TQ53_9LACO      MSNKIDGVLTGVTSGDTIIYQNPIWNDPNFDIFFMNKLLGIGN---LNIIIFIHDIRPMM
A0A089QAW7_9LACO      MSNKIDGILTGITSGDTIIYQSPTWNDPNFDIFFMNKLLGIGI---LNIIIFIHDIRPMM
A0A089RTA9_9LACO      LSKRYDGISAGIGSGDIVIYQSPTFNGTKFDDYFITNLRWRYGQS-VKVIIFVEDIVPMM
A0A1V9QD95_9LACO      LSKRIDGIIAGLEIGDTVIFQSPVWISPNFEKRFIDKVRLYQG----KVAIFINDVVSMM
A0A1D7TQ77_9LACO      LSKRIDGIIAGLEIGDTVIFQSPVWISPNFEKRFIDKVKLYQG----KVIIFINDVPPMM
A0A089QFZ3_9LACO      LTKRIDGILAGMEMGDNVIFQSPVWISSKFEKRFIDKVKLYQG----KVIIFINDVPPMM
T2F5F4_LACLC          KEKRIDGMLTSVEYGGLVIAQMPTWNGIAFDKVLLKKLRERAK----KLVVFVHDFVPLM
A0A1I4EXP7_9LACT      KEKRIFGMLSSVTQGDLAIAQMPSWNGIAFDEVFLKILRERVD----KLVVFIHDFVPLM
A0A380JYM5_STRDY      LARRMDGMIASVSQGDVLIAQFPTWNSVEYDDALMTRLCFYGN----KVIIFVHDIIPLM
A0A0D4CK53_LACMC      LSARLDGILSSLTVDDIVILQEPTWMEMQWQQRLVDKINAYRQEYRVKLIMFVHDVAPLM
GTF3_STRPA            LSKRLDGIVAGLRHGDVVIFQTPTWNTTEFDEKLMNKLKLY-D---IKIVLFIHDVVPLM
GTF3_STRA6            MSKRLDGICSGLRKNDIVIFQTPTWNTTTFDEKLFHKLKIF-G---VKIVIFIHDVVPLM
A0A222W676_9LACO      LNGRLDGIIAGLSVDDVVILQSPTWNGARFEHLLLDRIKAYRN---VKVIVFIHDVVPWM
A0A222W6A0_9LACO      LSGRLDGIISALNPGDVVILQTPTWNGTHYEHRLLDKIRGYSD---VKIIAFIHDVEAWM
GTF3_STRPN            MNKRLDGIMASISIGDILVFQSPTWNGFEFDRLLFDKLKDM-Q---VKIICFIHDVVPLM
GTF3_STRGN            LSRRLDGIMASVGYGDVVIYQSPTWNGREFDQAFISKLKIL-Q---AKLITFIHDVPPLM
F4AEQ9_LACJH          RSTRFDGIIASLNGGDTVIFQSPSWIAIEWDQALIDHINLYPN---IKKIIFIHDVIPLM
A0A7D9N503_LACJH      RSTRFDGIIASLNGGDTVIFQSPSWIAIEWDQALLDHINLYPN---IKKIIFIHDVIPLM
Q74L32_LACJO          RSTRFDGIIASLNGGDTVIFQSPSWIAIEWDQALIDHINLYPN---IKKIIFIHDVIPLM
A0A3G2JWK4_LACJH      RSTRFDGIIASLNGGDTVIFQSPSWIAIEWDQALIDHINLYPN---IKKIIFIHDVIPLM
A0A347T5X0_LACRE      LKARFDGIIASVAIGDTVIFQSPTWNPIEWDQAFIDHLAPY-N---VKKIIFIHDIIPLM
S5NS50_LACRE          LKARFDGIIASVAIGDTVIFQSPTWNPIEWDQAFIDHLAPY-N---VKKIIFIHDIIPLM
A0A0U5EYB6_LACRE      LDTRFDGIIASVSNNDTVIFQSPTWNSIEWDQAFIDHLAPY-N---VKKIIFIHDIIPLM
GTF3_LIMR5            LDTRFDGIIASVSNNDTVIFQSPTWNSIEWDQAFIDHLAPY-N---VKKIIFIHDIIPLM
A0A0U5JTA1_LACRE      LDTRFDGIIASVSNNDTVIFQSPTWNSIEWDQAFIDHLAPY-N---VKKIIFIHDIIPLM
A0A2K4ZEP1_9FIRM      LRTRLDGILAAISHGDTVIFQLPTWNDIKFDEAFAARLGNYRG---VKKIFFVHDVPPLM
A0A2K4ZEP8_9FIRM      LRTRLDGILASVSPGDVVIMQSPTWNDIRFDESLMNRMNRYSG---LKKIIWLHDVQPLM
                         .  .:      ..  : * * :     :  :   :         .   :: *    *

C4ZG42_AGARV          FDSEQAILDMEIKTLNKADLLILPSKKMHRYLKENGLDEKPVIYQTIWDMPSDICFV-DH
A0A174FAP9_9FIRM      FDSEQAILDMEIRTLNKADLLILPSKKMHRYLKENGLDEKPVIYQTIWDMPSDICFV-DH
D4JM13_9FIRM          FDSEQAILDMEIKTLNKADLLILPSKKMHRYLKENGLDEKPVIYQTIWDMPSDICFV-DH
D6E170_9FIRM          FDSEQAILDMEIKTLNKADLLILPSKKMHRYLKENGLDEKPVIYQTIWDMPSDICFV-DH
A0A380KDH8_9STRE      YKESRPLAPQFIAMLNQAEVIIVPSVAMYEVLKKHGLTVKKYVVQGIWDHLTQKTFV-SP
A0A1D7TQ84_9LACO      FPIEAESMPFYVELFNIADSLIVPSENMAQYLKEKGVN-TPMVIQHLWDSDNHVDFNQAS
A0A1V9QDC9_9LACO      FPIEAESMPFYVELFNIADSLIVPSENMAQYLKEKGVN-TPMVIQHLWDFDNHVDFNQAS
A0A1D7TQ53_9LACO      FPTEQSIMPSYIELFNVANYLIVPSKNMAQYLGEKGVT-TPMVTQHLWDSNKETTFQEVS
A0A089QAW7_9LACO      FLTEQINMPSYIELFNVANYLIVPSKNMAQYLGEKGVT-TPMVTQYLWDSNKEMVFQEVP
A0A089RTA9_9LACO      YQGNEYLFPQVIDMYNKAHALIVASENMKEYLIEKGVVNPKIYVQNLWDLPEKVDISITP
A0A1V9QD95_9LACO      FEGNKVLLPDFIEVYNKADLLIVASENMKEYLIEQGVTVKKFVIQNLWDIPVDFAINGQT
A0A1D7TQ77_9LACO      FASNEVLMPDFIEVYNKADLLIVSSENMKEYLVDKGVTVKKIIIQNLWDIPVEFEKTSET
A0A089QFZ3_9LACO      FVSNEVLMPNFIEVYNKADLLIVSSENMKEYLVDKGVTVKKIIIQNLWDIPVEFEKSSET
T2F5F4_LACLC          FIGNAYLADAYLEAYNQADLVVLPSSKMEVTLRAKGLT-PPVLYQEVWDHVTPMDFPETP
A0A1I4EXP7_9LACT      FQNNDYLFERYLEAYNLADLVILPSERMEKKLRERGLT-SPVKIQGIWDHLVGIENLRQP
A0A380JYM5_STRDY      FPSNRYLLPKVIATLNRAALLILPSQAMYNLLVSEGLTVQNYLIQELWDYETEIPVQ-SP
A0A0D4CK53_LACMC      FD-NPTRVPEWIDFYNQADVLILPMPQMKQELDKWGLKVKKIVYQQAWDALTVDQLTGES
GTF3_STRPA            FSGNFYLMDRTIAYYNKADVVVAPSQKMIDKLRDFGMNVSKTVVQGMWDHPTQAPMF-PA
GTF3_STRA6            FDGNFYLMDRTIAYYNEADVLIAPSQAMVDKLQSYGLTVKKILVQGMWDHPTNITLQ-AV
A0A222W676_9LACO      NADAAGELTNYIKLYNRCDLVISPNQKMTNRLRECGLMVTKVINQEFWDHPVAVDSTKVA
A0A222W6A0_9LACO      FEGMEFVLDEYIKVYNRCDLVISPTEKMTARLRKHGLTVKKVINQEFWDHPVAVDTTTFP
GTF3_STRPN            FDSNYYLMKDYLYMYNLSDVLIVPSERMKTRLMEEGLTTKKILVQGMWDHPHDLSLY-TP
GTF3_STRGN            FPSNYYLMPEYIDMYNQSDAVIVPSEQMRDKLLAEGLTVNKILIQRMWDHPYDLPLH-QP
F4AEQ9_LACJH          FEVNRYLMPQYIDYYNKADVLIVPSKKMYDLLRENGLKEKPYVVQHFWDHPATVNYFITP
A0A7D9N503_LACJH      FEVNRYLMPQYIDYYNKADVLIVPSKKMYDLLRENGLEEKPYVVQHFWDHPATVNYFITP
Q74L32_LACJO          FEVNRYLMPQYIDYYNKADVLIVPSKKMYDLLRENGLKEKPYVVQHFWDHPATVNYFITP
A0A3G2JWK4_LACJH      FEVNRYLMPQYIDYYNKADVLIVPSKKMYDLLRENGLKEKPYVVQHFWDHPATVNYFITP
A0A347T5X0_LACRE      FESNRYLLPQFIDYYNKADLIIAPSQPMVDFLRANGLTVEKVVLQHMWDHCASVDFTVTP
S5NS50_LACRE          FESNRYLLPQFIDYYNKADLIIAPSQPMVDFLRANGLTVEKVVLQHMWDHCASVDFTVTP
A0A0U5EYB6_LACRE      FESNRYLLPQFIDYYNKADLIIAPSQPMVDFLRANGLTVEKVVLQHMWDHCASVDFTVTP
GTF3_LIMR5            FESNRYLLPQFIDYYNKADLIIAPSQPMVDFLRANGLTVEKVVLQHMWDHCASVDFTVTL
A0A0U5JTA1_LACRE      FESNRYLLPQFIDYYNKADLIIAPSQPMVDFLRANGLTVEKVVLQHMWDHCASVDFTVTP
A0A2K4ZEP1_9FIRM      FENTLGWLGRYIDLYNLADVLIVPSREMEEYLRSNGLKVPKIVVQRMWDFPVEIDQTIVP
A0A2K4ZEP8_9FIRM      KEAKREFLSRWIELYNQADLIIAASQNEVDVLRSHGLRVRKTVIQRMWDCQVSVDRTLVP
                                 :   * .  :: .       *   *:       *  **           

C4ZG42_AGARV          AVTRCFHFAGNYN---RFPFLAEYH--GKTPIYQYDANKP--DRENDDSFCWKGY-FEQE
A0A174FAP9_9FIRM      AVTRCFHFAGNYN---RFPFLAEYH--GKTPIYQYDANKP--DRENDDSFCWRGY-LEQE
D4JM13_9FIRM          AVTRCFHFAGNYN---RFPFLAEYH--GKTPIYQYDANKP--DRENDDSFCWRGY-FEQE
D6E170_9FIRM          AVTRCFHFAGNYN---RFPFLAEYH--GKTPIYQYDANKP--DRENDDSFCWRGY-FEQE
A0A380KDH8_9STRE      TFQRQLHFLGSPE---RFNFVNHWQ--SALPLRLYTQKLP---RPMCANVLYEGY-FEDE
A0A1D7TQ84_9LACO      NYGNRISFIGDDE---KFMISKNFPTNSDTSLELYGKKNE--QMKQTNNIHYHGF-LDEY
A0A1V9QDC9_9LACO      NYRNRISFIGDDE---KFMISTNFPTNSDTSLELYGRKNE--QMEQANNIHYHGF-LDEY
A0A1D7TQ53_9LACO      KLKRKIHFIGNDA---KFMISKNFPINSNVTLELYGRKND--EMVRAENINYHGF-FDEY
A0A089QAW7_9LACO      KLKKQINFIGSDA---KFMISRNFPINSDVTLDLYGRKND--EMVRAENINYHVF-FNEY
A0A089RTA9_9LACO      KFMKRISFTGNDG---KFGIMDAFPE-SDVALEVYGSDKR--EDVPQ-NINFNPFISDEH
A0A1V9QD95_9LACO      RYMPRITFVGRDQ---KFGIVNKLKS-SDIELEIYDHKPE--DKFVSDNIHYHGY-VDEI
A0A1D7TQ77_9LACO      KYLSKISFAGSDK---KFGISEKLKS-SDIKVEIYDNRPD--NKVIPNNIHYSGY-VDEI
A0A089QFZ3_9LACO      KYLSKISFAGSDK---KFGISEKLKS-SDIKVEIYDNRPD--SKEIPDNIHYSGY-VDEI
T2F5F4_LACLC          RFEPVLKFAGNME---RFPFVKNWK--SETRLEVFSRGQ---FEPQG-NVIIQGW-KHDD
A0A1I4EXP7_9LACT      KFQRKLKFAGNIT---RFPFVKEWS--SDLPLEVFSSGE---VNAKG-FLRMKGW-QHDD
A0A380JYM5_STRDY      RYQNLIHFPGNPS---KFPFTKAWNF--DSRLRIYSEED---VKISSNKVEKINF-LPTE
A0A0D4CK53_LACMC      PYRTVLNFAGSPS---KFTFVNDWH--EKVPLEVFADPTAPLDNP---QVRFQGY-VANE
GTF3_STRPA            GLKREIHFPGNPE---RFSFVKEWKY--DIPLKVYTWQNV--ELPQ--NVHKINY-RPDE
GTF3_STRA6            NHKKLVHFPGNPE---RFNFIKNWR--IPTELHVYTDHNM--QLPT--TVVKEPY-QSDE
A0A222W676_9LACO      PFAKRVTFIGLGS---TKPLIENWDS-EQVKLVLTTDKQP--MAADK-NIEFMGY-QYDY
A0A222W6A0_9LACO      PFNRVVNFIGRGK---KFDFVKNWSA-ADVKLILTDTDTG--WGASK-NIEFIGY-QNDA
GTF3_STRPN            AFKKELFFAGSLE---RFPDLQNWS--QDTPLRVFSNKGE--ASSSARSLSIEGW-KKDE
GTF3_STRGN            QFAPKLYFAGSVE---RFPHLINWSY-A-TPLEIFSPEEE--SNPEA-NVSYCGW-VSRP
F4AEQ9_LACJH          ENNKVINFAGNAD---KFDFVKTWNC-QNIKLKVYSDPEN--NDSEH-NVELTGW-KHDP
A0A7D9N503_LACJH      ENNKIINFAGNAE---KFDFVKNWNC-QNVKLKVYSDPVN--NDPEH-NVELTGW-KHDP
Q74L32_LACJO          ENNKVINFAGNAE---KFDFVKKWDC-QNVKLKVYSDPVN--NDPEH-NVELTGW-KHDP
A0A3G2JWK4_LACJH      ENNKVINFAGNAE---KFDFVKKWDC-QNVKLKVYSDPVN--NDPEH-NVELTGW-KHDP
A0A347T5X0_LACRE      QNTGVINLAGNLE---KFQLVGHWHY-PDNPLYAFAKVIN--IESTD-NIKFMGW-QSDP
S5NS50_LACRE          QNTGVINLAGNLE---KFQLVGHWHY-PDNPLYAFAKVIN--IEPTD-NIKFMGW-QSDP
A0A0U5EYB6_LACRE      QNTGVINLAGNLE---KFQLVGHWHY-PNNPLYAFAKVID--IEPTD-NIKFMGW-QSDP
GTF3_LIMR5            QNTGVINFAGNLE---KFQLVGHWHY-PDNPLYAFAKVID--VEPTD-NIKFMGW-QSDP
A0A0U5JTA1_LACRE      QNTGVINLAGNLE---KFQLVGHWHY-PDNPLYAFAKVID--VEPTD-NIKFMGW-QSDP
A0A2K4ZEP1_9FIRM      CFRKRINFAANVTSNYR-PFVREWNH-DRVELAVTANPGDYEWAKGR-NIRFLGWHNNDN
A0A2K4ZEP8_9FIRM      RFQKVINFAGDPSNEPKLAFARNWKY-DNITLAVTVNGGS--WAQGK-NIRFLGWYNNDN
                           . : .                     :                 .    :     

C4ZG42_AGARV          KLMHELSK-GGFGLVW---SDDEYFDRYYSMNQPYKLGTNLAAGIPVIVKRGCVHDKFVE
A0A174FAP9_9FIRM      KLMHELSK-GGFGLVW---SDDEYFDRYYSMNQPYKLGTNLAAGIPVIVKRGCVHEKFVE
D4JM13_9FIRM          KLMHELSK-GGFGLVW---SDDEYFDRYYSMNQPYKLGTNLAAGIPVIVKRGCVHEKFVE
D6E170_9FIRM          KLMHELSK-GGFGLVW---SDDEYFDRYYSMNQPYKLGTNLAAGIPVIVKRGCVHDKFVE
A0A380KDH8_9STRE      VLLAKLAEAGGFGLVW---HSDDDL-DYMRIYSPYKLGTYLAAGLPIVARRGFAQADLIE
A0A1D7TQ84_9LACO      SLLQELHK-GGFGLVW---SEDEQVKNYMHYCNSYKVSTYLQAGIPLIVHNDISCRKLVE
A0A1V9QDC9_9LACO      SLLQELHK-GGFGLVW---SEDEQVKNYMHYCNSYKVSTYLQAGIPLIVHNDISCRKLVE
A0A1D7TQ53_9LACO      NLLHELHR-GGFGLVW---TEDMYWREYMRYNTSFKISTYLRAGIPLIVHESISCRKMIE
A0A089QAW7_9LACO      NLLHELHK-GGFGLVW---TEDMYWREYMKYNTSFKTSTYLRAGIPLIVHESISCRKMIE
A0A089RTA9_9LACO      VLLNKLRE-GGFGLVW---AENEHVRNYMHYCNSYKVSTYLRAGIPVIAHKSISCAKLLE
A0A1V9QD95_9LACO      KLLSELHE-GGFGLVW---TEDMYWREYMKYNASYKVSTYLRAGIPLIVHRDISCRKLIE
A0A1D7TQ77_9LACO      SLLSRLHE-GGFGLVW---TENMYWREYMKYNASYKVSTYLRAGIPIVAHKSISCANLIE
A0A089QFZ3_9LACO      SLLSRLHE-GGFGLIW---SEDEHIKNYMHYCNSYKMSTYLRAGIPIVAHKSISCANLIE
T2F5F4_LACLC          ELLRSLRQ-GGYGLVWSEDIETQHEREYSEMNASYKFSTYLAAGIPLIVNKGMAKQDFVE
A0A1I4EXP7_9LACT      QLLRELNK-GGFGLVWSENIENQFEREYSEMNASFKFSTYLAAGLPIIVNQGLAKQNFVE
A0A380JYM5_STRDY      LLIAELSK-GGFGIIW----EALDGMAYLSLCCSYKLSIFIAAGIPVIVRRGIANQAELE
A0A0D4CK53_LACMC      HLIECLHQNGGFGLLW---EASPTVYEYMKLNVNFKFGSYLAAGLPIVIHRGIAQADLVE
GTF3_STRPA            QLLMEMSQ-GGFGLVW---MDDKD-KEYQSLYCSYKLGSFLAAGIPVIVQEGIANQELIE
GTF3_STRA6            QLIMKMSE-GGYGLVW---MDDRD-KQYQSLYCPYKLGAYIAAGIPVIIQKGIANQDIIE
A0A222W676_9LACO      NLLGRLRQQGGFGLLW---NALPIWREYMQYNTSYKLSTYLAAGLPVITSPNIAQREVIE
A0A222W6A0_9LACO      DLVSRMHRTGGFGLLW---SENQLWSEYMKLNVSYKLSTYLAAGIPVIVEPDTPQANTIL
GTF3_STRPN            ELLLELSK-GGFGLVWGTHQNEGESNQYYTLNISHKVSTYLTAGIPVIVPSSLSTAKFIV
GTF3_STRGN            ELLLELSK-GGLGLVWGVEDNPADEPEYYGLNISHKSATYLAAGIPVIVPSYLSNAELIR
F4AEQ9_LACJH          VLLEELRQTGGFGLVW---SEEPYWSEYMKVNASYKLSTYLAAGLPIIVNSATPEAEAIK
A0A7D9N503_LACJH      VLLEELRQTGGFGLVW---SEEPYWSEYMKVNASYKLSTYLAAGLPIIVNSTTPEAETIK
Q74L32_LACJO          VLLEELRQTGGFGLVW---SEEPYWSEYMKVNASYKLSTYLAAGLPIIVNSTTPEAETIK
A0A3G2JWK4_LACJH      VLLEELRQTGGFGLVW---SEEPYWSEYMKVNASYKLSTYLAAGLPIIVNSTTPEAETIK
A0A347T5X0_LACRE      VLLSKLRHNGGFGLVW---SNEPYWKNYMHLNANHKLSTYLAAGIPVIVNKSLAESETIL
S5NS50_LACRE          VLLSKLRHNGGFGLVW---SNEPYWKNYMHLNANHKLSTYLAAGIPVIVNKSLAESETIL
A0A0U5EYB6_LACRE      VLLSKLRHNGGFGLVW---SNEPYWKNYMHLNANHKLSTYLAAGLPVIVNENIAESETIL
GTF3_LIMR5            VLLSKLRHNGGFGLVW---SNEPYCKNYMHLNANHKLSTYLAAGLPVIVNENIAESETIL
A0A0U5JTA1_LACRE      VLLSKLRHNGGFGLVW---SNEPYCKNYMHLNANHKLSTYLAAGLPVIVNENIAESGTIL
A0A2K4ZEP1_9FIRM      LLADALRKSGGFGLLW---QDCPWWKEYMKLNASYKRSACLAAGLPIIVSSSTAETEMIL
A0A2K4ZEP8_9FIRM      LLVNALRRSGGFGLLW---SEDAYWREYMRINASYKFSTYLAAGIPVIVPSDIAESDTIL
                       *   :   ** *::*           *      .* .  : **:*::          : 

C4ZG42_AGARV          RNGLGYAVDTLDEADKLVQSITDAEYIELYRNVKNIQKLILDGAYTRKILQDAIIEVLEN
A0A174FAP9_9FIRM      RNGLGYAVDTLDEADKLVQSITDAEYIKLYHNVKNIQKLILDGAYTRKTLQDAIIEVLEN
D4JM13_9FIRM          RNGLGYAVDTLDEADKLVQSITDAEYIKLYHNVKNIQKLILDGAYTRKTLQDAIIEVLEN
D6E170_9FIRM          RNGLGYAVDTLDEADKLVQSITDAEYIKLYHNVKNIQKLILDGAYTRKTLQDAIIEVLEN
A0A380KDH8_9STRE      KHGLGLVVSSFDELERVLETMTEETYHKMAQCVADYRPFLTQPYHTQQILSQAVACLFS-
A0A1D7TQ84_9LACO      DNHWGIVVNSLEEAVQKVKEMSEEEYRSYIDAIFNIKYKLENGYYTKKAITDVIYNLFVR
A0A1V9QDC9_9LACO      DNHWGIVVNSLEEAVQKVKEMSEEEYRSYIDAISNIKYKLENGYYTKKSLSDAIYNLFIC
A0A1D7TQ53_9LACO      DNHWGIIVNSLAEAVEKVKAMTVEEYNSYVEAIQGIKYPLEHGYFTKKVLVDSVYKLFVH
A0A089QAW7_9LACO      DNHWGIIVNSLAEAVEKVKAMTVEEYNSYVKAIQEVKYSLENGYFTKKVLVDSVYKLFVQ
A0A089RTA9_9LACO      KNHWGILADTLEEAVDIIDNMSDEEYQKYIESVGKVGFLLENGYFTKKVLNEAIYGLYVD
A0A1V9QD95_9LACO      NNHWGIVVDSLEEAVQKVKAMSEDEYQGYVDSIAKVSELLGDSYFTKKLLIDTIYEL---
A0A1D7TQ77_9LACO      KNHWGILVDTLEEAVEVINNMSEEEYQKYIDSVSKVSFLLSSNWFTKKLLVDAMYEL---
A0A089QFZ3_9LACO      KNNWGILVDTLEEAVEVINNMSEEEYQKYIDSVSKVSFLLGNNWFTKKLLVDSIYKL---
T2F5F4_LACLC          KYNLGFVCENMDEVLELLKDMTEETYREKQKASQDIGELIKEGFFAKKLLIEIQNALYL-
A0A1I4EXP7_9LACT      EQEIGLVASNLEEAIDYVKYMSSAEYMLLSTNVQRVGALVKEGFFTKQLLMEIQNYLFLE
A0A380JYM5_STRDY      EKGVIIVVDSLEEAAAIVTHMSSELYDSYCQNVRKLAKVTRNGWVTRQLLTNAVYSVIND
A0A0D4CK53_LACMC      KYHLGKVVDSLAEASEWVQSVTEEQYRQLADHVYRFGWLNRQGMFTKRALTEAVFQARLE
GTF3_STRPA            NNGLGWIVKDVEEAIMKVKNVNEDEYIELVKNVRSFNPILRKGFFTRRLLTESVFQAICD
GTF3_STRA6            KNNLGFIIEKIDDISNIVESTTEEEYMEIVSDVRRFNPLVRQGYFTRKLLTDAVFSALNS
A0A222W676_9LACO      AKKLGLFVNSVDEAVRQIENMTSAEYQEMRAGVEEFAHLIRNGYFTKRILTGAIFNLFY-
A0A222W6A0_9LACO      AKKLGLVVNSLDEAVEQVKQMTPADYQEMVVAVEHFAQLIRGGYFTKRLLTQAVFDLFYD
GTF3_STRPN            DQGLGFMADSLEEVHEIVDKMNLQEYQEMTNRIKTFSYLLKEGYFTKKLLVDAIYHLGID
GTF3_STRGN            ERGLGFVVDSLEEASRIVENLTVEEYQDMVERVRKFSFLLKEGYFSKKVLIDAVMEVLS-
F4AEQ9_LACJH          NKHLGIIADSLDEAQAKVLQTNNEDYRQMIDSVNNFGSLIRNGYFTKKALVDAVVKAQYN
A0A7D9N503_LACJH      NKHLGIIADSLDEAQAKVLQINDENYNQMVDSVNNFGSLIRDGYFTKKALVDAVVKAQYN
Q74L32_LACJO          NKHLGIIADSLDEAQAKVLQINDEDYKQMVDSVNNFSSLIRNGYFTKKALVDAVVKAQYN
A0A3G2JWK4_LACJH      NKHLGIIADSLDEAQAKVLQINDEDYKQMVDSVNNFSSLIRNGYFTKKALVDAVVKAQYN
A0A347T5X0_LACRE      RKGLGIVADNLDGAIEKVQNLSNNDYNKMVHQVNSFAELVRNGYFAKKALTEAIFKLHYQ
S5NS50_LACRE          RKGLGIVADNLDGAIEKVQNLSNNDYNKMVHQVNSFAELVRNGYFAKKALTEAIFKLHYQ
A0A0U5EYB6_LACRE      RKGLGIVADNLDEAIEKVQGMDDQSYNEMVQRVDDFARLIREGYFAKKALTEAVFNLYY-
GTF3_LIMR5            RKGLGIVADNLDEAIEKVQGMDDQSYNEMVQRVDDFARLIREGYFAKKALTEAVFKLYYQ
A0A0U5JTA1_LACRE      RKGLGIVADNLDEAIEKVQGMDDQSYNEMVQRVDDFARLIREGYFAKKALTEAVFKLYYQ
A0A2K4ZEP1_9FIRM      RKNLGLVVDSLDEAVDRVASMEEGQYRKMVEDVGKFAQLIQGGYFTKKLLIDSVFRLLYD
A0A2K4ZEP8_9FIRM      RKNLGIVADSLDEAVERVAAVKEEEYKKMAEDTEQFAWLLREGYFTRKVLTDAVFQVFAD
                              . .      :       *                   :.. :          

C4ZG42_AGARV          ACTPVENRYQDHI
A0A174FAP9_9FIRM      ACTPVENRYQDHI
D4JM13_9FIRM          ACTPVENRYQDHI
D6E170_9FIRM          ACTPVENRYQDHI
A0A380KDH8_9STRE      -------------
A0A1D7TQ84_9LACO      -------------
A0A1V9QDC9_9LACO      -------------
A0A1D7TQ53_9LACO      -------------
A0A089QAW7_9LACO      -------------
A0A089RTA9_9LACO      D------------
A0A1V9QD95_9LACO      -------------
A0A1D7TQ77_9LACO      -------------
A0A089QFZ3_9LACO      -------------
T2F5F4_LACLC          -------------
A0A1I4EXP7_9LACT      KGKENDHL-----
A0A380JYM5_STRDY      KE-----------
A0A0D4CK53_LACMC      E------------
GTF3_STRPA            -------------
GTF3_STRA6            M------------
A0A222W676_9LACO      -------------
A0A222W6A0_9LACO      -------------
GTF3_STRPN            -------------
GTF3_STRGN            -------------
F4AEQ9_LACJH          N------------
A0A7D9N503_LACJH      N------------
Q74L32_LACJO          N------------
A0A3G2JWK4_LACJH      N------------
A0A347T5X0_LACRE      -------------
S5NS50_LACRE          -------------
A0A0U5EYB6_LACRE      -------------
GTF3_LIMR5            -------------
A0A0U5JTA1_LACRE      -------------
A0A2K4ZEP1_9FIRM      -------------
A0A2K4ZEP8_9FIRM      -------------