CLUSTAL format seed alignment for MF_00845

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

A0A0D4C0N3_9MICC      ------------------------------------MITIIGAGLGGLTLARVLQKNGAQ
D9VFG6_9ACTN          ----------------------MYFVNTVYRGDVIMRIVIAGGGLGGLTCARVLHAHGID
A0A379C170_9NOCA      --------------------------------MTTPRIAIVGGGPAGLMCARVLQSYDIQ
G8S5F7_ACTS5          ---------------------------MTSPAPSTARISVIGAGPGGLTCARILQRHGLA
A0A1P8TAM4_9ACTN      ----------------MTRQTQTHAHPHTHSTSTRPRIAIVGAGPGGLICARVLQRHGIA
A0A285HNS3_9ACTN      ---------------------------------MNTPVTIVGAGLGGLTLARVLRVNGIE
R4LFF5_9ACTN          ----------------------------------MKPVVIIGAGLAGLTLARVLHLNDIP
A0A3Q9KPU0_STRGD      MNTSSESHERDGGNATDGWKARDGGNATDTGGRGSPRIAVVGGGIGGLVVAGMLHRHGIA
A0A126YCA6_9ACTN      MDAWRRRETRRRTEEARQRTDVRRRIEVRRGRQMRHRIAVVGAGPGGLTLARILHRHGLS
A0A143GH32_9PSED      -------------------------------MNSSLRIAIVGGGPAGLTLARILTINGFT
A0A381KS22_BACCE      ------------------------------MYNSKKRIAIIGAGPGGLTLARILQQAGFE
A0A455SKA8_9CHLR      ----------------------------------MTRIAIIGAGPGGLTLARLLQQQGFT
W7TBL7_9PSEU          ----------------------------------MSDIAILGAGPAGLAAARLLHLRGID
A0A2L2NWN6_9NOSO      -------------------------MKTCDELQISGTVAIVGAGPAGLTLARLLQMRGFS
A5V686_SPHWW          ---MTASQSGRVRNIERIGIEVDMTEDDATSPIAGKKIAIVGAGPSGLTLARLLQMRGGS
A0A1H4K8Z2_9BACT      -----------------------------MGAISGKKIAIVGGGPGGLTLARLLQQGGAS
TETX_BACFG            -------------------MTMRIDTDKQMNLLSDKNVAIIGGGPVGLTMAKLLQQNGID
TETX_SPHSM            -------------------MTMRIDTDKQMNLLSDKNVAIIGGGPVGLTMAKLLQQNGID
TETX_BACT4            -------------------MTMRIDTDKQMNLLSDKNVAIIGGGPVGLTMAKLLQQNGID
A0A249T051_9BACT      -----------------------------MSITSIGKVAIIGAGPVGLTMARLLQQANIA
A5FG16_FLAJ1          ------------------------------MLLTNKKTAIIGAGPVGLTMARLLQQNGIN
A0A1H6QIR0_9BACT      ------------------------------MLLEKKHVVVIGAGPVGLTMAGLLQQKGIR
A0A1I1HV84_9BACT      ------------------------------MLLDNKKVAIIGAGPVGLTMARLLQQKGVA
A0A142HWQ5_9SPHI      ------------------------------MLLQNKRVAIIGGGPAGLTLARLLQQKGLK
A0A448AZQ1_9FLAO      ------------------------------MLLQDKKVAVIGAGPVGLTFARLLQQEGVN
A0A0P0NHL0_9SPHI      ---------------------------MKTTLIKDKRIAIIGAGPVGLVTARLLQMRGAQ
A0A2S1YNA9_9FLAO      ------------------------------MLLQNKQVAVIGGGMGGLTLARLLQIKNID
                                                             : *.*  **  * :*   .  

A0A0D4C0N3_9MICC      VQIYELESSPSARSQGGTLDLHAESGQFALQQAGLFEEFAKLARPEGED--------WRF
D9VFG6_9ACTN          AVVCERDASREARVQGGTLDLTVDGGQWALREAGLEAGYRAIARPEGQD--------MVL
A0A379C170_9NOCA      PTVYDADAAVDARDPGGTLDLHADSGQIALEDAGLMDAFRALARVEGQA--------KSR
G8S5F7_ACTS5          VTVYDRDQRRDARNQGGTLDLHADDGQVALRAAGLLDDFFRLARAEGQE--------MRR
A0A1P8TAM4_9ACTN      ATVHELDASPSARDQGGSLDMHPETGQLALREAGLLAEFVDLARPEGRQ--------MRL
A0A285HNS3_9ACTN      AIVYESERSPDARAQGGMLDIHDYNGQLALEAAGLMAEFRAAVLPGREA--------YRG
R4LFF5_9ACTN          VVLYEGEESLNARTQGGQLDIHDFNGQVALARCRLTDEFHSIVNLGAEA--------MRF
A0A3Q9KPU0_STRGD      ATVYERDRALDARGHGGTLDLHPGSGQRALAELGLTEAFRAEARPEGEN--------LRI
A0A126YCA6_9ACTN      VTVLERDAGPDARPPGGSLDLHEGMGQRALEKAGLLAEFGALSRPEGQA--------MRI
A0A143GH32_9PSED      ASVFERERGPLERPQGGTLDLHVESGQLALKKAGLEDAFHTIARYEDQG--------SRL
A0A381KS22_BACCE      PLIYEREPSSTERSQGGTLDLEFHTGQKALRVAGLMKEFEKVCRYEGQE--------LRI
A0A455SKA8_9CHLR      PTIFERDTSPHARTQGGSLDLHAGSGLDAIQKARLEAEFRALARPQDQA--------LRI
W7TBL7_9PSEU          CAVYERDADRHARTQGGSLDLGTESGLRAITACGLAEQFERYARPQGQH--------TNY
A0A2L2NWN6_9NOSO      VRVFERDDSPTSRMQGGSLDLRPNSGQRAIRQAGLGHAFEQASRSEAKS--------FKM
A5V686_SPHWW          VTVYDLDPSLAARNQGGSLDLHEASGQLALKKAGLLDLFHAAARPEGQA--------TRV
A0A1H4K8Z2_9BACT      VTVYERDQSRSARVQGSALDLHEDSGLAALEAAGLMDAFWANHRPDLDR--------LRL
TETX_BACFG            VSVYERDNDREARIFGGTLDLHKGSGQEAMKKAGLLQTYYDLALPMG----------VNI
TETX_SPHSM            VSVYERDNDREARIFGGTLDLHKGSGQEAMKKAGLLQTYYDLALPMG----------VNI
TETX_BACT4            VSVYERDNDREARIFGGTLDLHKGSGQEAMKKAGLLQTYYDLALPMG----------VNI
A0A249T051_9BACT      VTVYERDENPQARIWGGTLDLHKESGQRALEKAGLLDAYYSIGIPMG----------RII
A5FG16_FLAJ1          VTVYERDKDPKARIWGGTLDLHKGSGQDAMQKAGLLEEYYKKAIPMG----------RII
A0A1H6QIR0_9BACT      VTVVERDKDAQARIWGGTLDLDKESGQKALMKLGLLERYFALAKPMG----------RIL
A0A1I1HV84_9BACT      VSVHERDRNDTARIWGGTLDLHPATGQHAMQQAGLLAQYFALAKPMG----------RII
A0A142HWQ5_9SPHI      VNVYERDKNAEARVWGSTLDLHKDSGQKAWNEAGLLKLYFDQALPMG----------RIV
A0A448AZQ1_9FLAO      VSVYERDINQYARIKGGTLDLLKDMGQAVFEKAGLLAAYFDNARPTA----------RRI
A0A0P0NHL0_9SPHI      VTVYERDKNKDTRISGGTLDLHHDSGQLALKEAGLLESYFSNSRAVS----------ERR
A0A2S1YNA9_9FLAO      IKVYERDVNKEVRVQGSPLDLHEDSGLKAIIKADLLDEFYANVRQNASKARIVSKDFELL
                        : : :     *  *. **:    *  .     *   :                     

A0A0D4C0N3_9MICC      LDQRGE------VLFEEISSAELKEGEGRPEIDRKLLRGLLIDSLKPGTISWGRKINSVH
D9VFG6_9ACTN          YNSAGT------LLRREVAPDEGDQRWSRPEADRPALRKLLLDALPEETVHWGHTVAGAE
A0A379C170_9NOCA      RDQHG-------TVLAEFTPAAGD--DAAPEIDRGQLRTMLYAHLRPGTVAWGHKLLRAT
G8S5F7_ACTS5          LGIDG-------TLQEHHLPAPDE--LVKPEIDRGQLRDLLLDSLEPGTVQWGRALT---
A0A1P8TAM4_9ACTN      VGRDG-------RVLFDAAPPETDPGDGNPEIDRGQLRELLVRSLAPGTVQWGRKLTRAE
A0A285HNS3_9ACTN      LATDG-------TLLFDKADD-GT--GGRPEVQRGDLRRILLDSLPAGTVRWGHKVDGVR
R4LFF5_9ACTN          LDPDG-------HVVGEIPDD-GK--LTNPEVLRGELRRILVESLPEGTIRWDHKIASIH
A0A3Q9KPU0_STRGD      LDPAG-------RTLGHHAPEPGS--GTRPEIDRGVLRKLLLTRVPETAMSWGRRLTGVE
A0A126YCA6_9ACTN      LDPDG-------TVLRDWRPRPDD--RANPEIDRGHLRDLLLGSL---DVRWGSGVTGVT
A0A143GH32_9PSED      MDKHAR------LLFEDPSPAAGD----RPEVDRTALRQILLDSLPADCVKWDVNVSEIR
A0A381KS22_BACCE      MNKNGH------LRYKNDFQDKEE--NSRPEIDRMDLRNLLLNSLHPNSVQWGYKLIQAV
A0A455SKA8_9CHLR      IDKTGK------LLLE-DHQDTTA--FIQPEIDRAELRSLLVASVVPESIRWGWKLHSIH
W7TBL7_9PSEU          FDRHGT------LLLATDAEDDDE---ARPEIDRLELRSMLLDSLPAGTVRWGCEAADV-
A0A2L2NWN6_9NOSO      LDWQGE------VRTEVEAESQED---NGPEIDRGELRRLLLDSVSPGTITWGHVAKDVL
A5V686_SPHWW          LDHHGK------IYVDLRPSDETS---TRPEIDRGTLQSILFDSLEPGTVKWGRRLLSVE
A0A1H4K8Z2_9BACT      TNEKGT------VLHDHPRQKSGAG--QRPEIERGPLRDLLLDSLRPGTVQWDCKLESA-
TETX_BACFG            ADKKGN--------ILSTKNVKPENRFDNPEINRNDLRAILLNSLENDTVIWDRKLVMLE
TETX_SPHSM            ADKKGN--------ILSTKNVKPENRFDNPEINRNDLRAILLNSLENDTVIWDRKLVMLE
TETX_BACT4            ADEKGN--------ILSTKNVKPENRFDNPEINRNDLRAILLNSLENDTVIWDRKLVMLE
A0A249T051_9BACT      VDQQAN--------HLFTK----EPGLESPEINRNNLRKLLLNSLADNTVIWDRKFIALE
A5FG16_FLAJ1          TDYLGN--------VLFSKETSVEEQYDGPEINRNDLRTLLINSLEKDTVIWDRKLIKAE
A0A1H6QIR0_9BACT      ADQHGN--------VLFSKRLNAENQHDHPEISRNDLRTILMESLTSETVLWGRKFTSLD
A0A1I1HV84_9BACT      TDEQGN--------VLAQK----NPAFDNPEINRNQLRTLLLQSLNAGTVIWDKHLTALE
A0A142HWQ5_9SPHI      TDEKNK--------LLSTR----PADYSNPEINRTVLRNILLESLANDTIVWDKRLIALE
A0A448AZQ1_9FLAO      ADIHGN--------VVQTL-----PISDNPEIDRNDLRRILLESLHPQTVIWDRKFISIE
A0A0P0NHL0_9SPHI      YDQFGE--------LREEELPSPATKFMRPEIDRRDLRKIVLDVLHPHTVIWNKQFSGIS
A0A2S1YNA9_9FLAO      FDEHAVQEKKIPKASTTARNSLDAISKPRPEIDRSELRNILLNSLLSETIVWNSQFDFME
                                                   **  *  *: ::   :    : *.       

A0A0D4C0N3_9MICC      SLGDSRHVLDFTDGESEIVEMLVGADGSWSKVRRLLSAAVPEYSGLSFIELRLSNIDERN
D9VFG6_9ACTN          PLGDGRRRVRLSDGETLDCDLLIGADGARSRIRPLLTDAEPAYCGVHGMELVIHDADRAH
A0A379C170_9NOCA      PLESGTHRLEFANGVSAEADLVIGADGAWSPVRRLLTDAVPQYLGVSFLDARFDDVDTRH
G8S5F7_ACTS5          --STDGRVLRFADGSTAETDLVIGADGAFSRVRPVVSPAVPHYSGVTFLEAWFDDVSERH
A0A1P8TAM4_9ACTN      PLGDGVHRLHFADATTVDADLVVGADGAWSAVRPLVSDARPVYTGVTFVETGLDDADVRH
A0A285HNS3_9ACTN      ALGGGRHELSFAGRGSVTTSLLVGADGAWSRVRPLLTGAVPVYAGTSFIETFLYDVQRRH
R4LFF5_9ACTN          ATGDA-HTVVFANGDSVDADVLVGADGAWSRVRAYLNGAAPEYTGTLWAETFLHDVEARH
A0A3Q9KPU0_STRGD      ELPSGGHRLAFADGGLADCDLLIGADGGRSRVRPLLTDARPAHLSAY-LQLTITDADRRS
A0A126YCA6_9ACTN      AEAGGGARVRLADGRQERYDLVVGADGAWSRVRPALSPATPQYTGVTAVETSLDEVDSRH
A0A143GH32_9PSED      QAGDTCWTLHQGDTVHGPFDLVVGADGAWSKVRPLLSHYQPQYSGLTFIEFGVDDVDRRH
A0A381KS22_BACCE      PVANHQYELQFEHGEKVTVDLVIAADGAFSRIRPLVSKASAKYSGISMIELSIMNVADQH
A0A455SKA8_9CHLR      ADDNRTYTLHFENGQIETFDLVIGADGTWSRVRPLLTDATPIYCGVTYIELGIDDIDNRY
W7TBL7_9PSEU          SRIGDRWRIALSDGGHVDADLVIGADGINSRTRRLVTDVVPAYTGVTLIAGVIAEP-RPD
A0A2L2NWN6_9NOSO      PETGGRWRLEFKEQASVTADLIVGADGIGSRVRPYLTPIRPQYFGLTMLAAVIRKELWRD
A5V686_SPHWW          RNEGGGLCLRFADDTTEQADLVFGSDGAWSRVRPMVSPDKPRYSDITFIEGRISAADTDW
A0A1H4K8Z2_9BACT      ELDGELVGLRFGSGQTAVADIAIGSDGANSRLRELVTPIRPEYVGVSLVEGLVPAAQQTI
TETX_BACFG            P-GKKKWTLTFENKPSETADLVILANGGMSKVRKFVTDTEVEETGTFNIQADIHQPEINC
TETX_SPHSM            P-GKKKWTLTFENKPSETADLVILANGGMSKVRKFVTDTEVEETGTFNIQADIHQPEINC
TETX_BACT4            P-GKKKWTLTFENKPSETADLVILANGGMSKVRKFVTDTEVEETGTFNIQADIHQPEINC
A0A249T051_9BACT      E-NRGKWLIHFENQPDETADFVIGANGGMTKVRQYVTDAEVEETGTIIIQGEILQPEINC
A5FG16_FLAJ1          E-QNNKWVLHFENGEIETADFVIGANGGMTAIRKYLTDAAVEFTGTYMIQGEVSEPEIKC
A0A1H6QIR0_9BACT      L-YEGKWLLHFEGQPDLLADMVIGANGGMSKLRSYVADAQMEETGTYIIQGEVADAELSC
A0A1I1HV84_9BACT      A-HGGQWLLQFADQSTATADLVIGANGGMSGIRKYITDTQVEATGTQIIQGEVVLPAMRC
A0A142HWQ5_9SPHI      P-DREQWLLHFEGKTTSVADMVIGADGGLSNVRQFVTNTEVEYTGSFIIQGDIAQPELRC
A0A448AZQ1_9FLAO      K-KEGTFLLHFENDITETADLVVGANGIMSRLRKEMTEVPARYTGTITITGEVLDYASQC
A0A0P0NHL0_9SPHI      S-LKDGYELSFKDGSTITADLVIAADGGNSKLRSSLTDVIKVYTGITIIQGDIQASETLA
A0A2S1YNA9_9FLAO      K-ENTGWRLHFKNGSTAFADLVIAADGANSKVRPYISTEKPIYSGITLIEGTIYNAKENA
                              :          .. . ::*  :  *  :        .       .       

A0A0D4C0N3_9MICC      PELSTLVGRGSLSVNA-PGKGISAQRNGDGSVRVYLAFRVAESWIQGCGIDFHDAAAARR
D9VFG6_9ACTN          PEASALVGRGGFSSIG-DQKVLSAQRNGDGTIRVHLALRCAEDWPVTSGIPFDDPDRARA
A0A379C170_9NOCA      PEIAAIVGDGHMFSTDGDGRAVIVQRNSNGVVRGYVAFRAELDWHVTAGVDVTDRAAVRA
G8S5F7_ACTS5          PDLSDLVGQGGAHAADGT-RALFAQRNSGDHIRVYIIRKAPVDWITAAGLTIADTAGIRA
A0A1P8TAM4_9ACTN      PGLAALTGDGTMMALDDN-RGFVAQRNSGGHIRVYVGMRTAEDWHRRAGIDLADESAVRD
A0A285HNS3_9ACTN      PDVARVAGPGTTIASDFAGRQINAHREADGTLHVYAELTEPLEFFDSIDVTRIA-RQF--
R4LFF5_9ACTN          RDGAEIVGRGAMLAMQ-PGRGIFGHREANDIIHVYAVMKKPLAWAETVDLADRE-RALQV
A0A3Q9KPU0_STRGD      PGTAAFVGPGSLMALG-DNRNLGAQRSGDGTIRVSVTVRTDAGWLDRQRFADLTWEETVA
A0A126YCA6_9ACTN      PGLARLIGDGSFAVYG-VRRSLVAQRGSGGHVKVYAQFRAPLDRGAEPGPADA--ETVRA
A0A143GH32_9PSED      PALATLVGQGKLDVSG-DARLLVVQRNANAHLRGYGIFRVPTDWAAQQ-LDWSSPQATRQ
A0A381KS22_BACCE      PDILKFNGSGSMFAMG-DNKTLVAQVNGDGRIRIYLGFRTSYNFLDECGIPFHEPEKAKK
A0A455SKA8_9CHLR      PELARFVGRGSLVAVD-NNRNLTTQRNAHGHIRIYTAFRA---LIEDIHIDDTHPARARE
W7TBL7_9PSEU          SYAASLVGEGAGLAFA-ADQAFLLQRNGDGSIQVYYTQRRAEDPRRAVGTVLHDPAFIRA
A0A2L2NWN6_9NOSO      SELSELLGEGSMLVSG-GGQTIWVQRCAHDLIRLYFSMAIAEDWPKSQGFTLDDTKAVLK
A5V686_SPHWW          PDISRLVGEGAIMVTG-DNRAILAQRNSDGHIRLYACLRETEEWIARQAFDFTDPASVRT
A0A1H4K8Z2_9BACT      PKLWELLGGSALIALG-NERTIGMGTKPDGSVLLYAGLKTHDTAVRRSLEEAVGPEQRVA
TETX_BACFG            PGFFQLCNGNRLMASH-QGNLLFANPNNNGALHFGISFKTPDEWKNQTQVDFQNRNSVVD
TETX_SPHSM            PGFFQLCNGNRLMASH-QGNLLFANPNNNGALHFGISFKTPDEWKNQTQVDFQNRNSVVD
TETX_BACT4            PGFFQLCNGNRLMASH-QGNLLFANPNNNGALHFGISFKTPDEWKNQTQVDFQNRNSVVD
A0A249T051_9BACT      TRFFALCQGKILMVAY-NGILFAANPTNNGALTYNVIFKKPDESKTGFDLDLHKKETICN
A5FG16_FLAJ1          PDFYKLCADKILMTSN-NGNLLVANPKNSNVLSYNVIFKMPEI----LELDFKNSDSVIE
A0A1H6QIR0_9BACT      PDFYQLCDGNILMSSY-RGNLLVANPSNRGTLAYGITFQTPHEWTDGHGLDFRNLDQICM
A0A1I1HV84_9BACT      PTFYQKCAGQILMTTH-NGYSLVANPQNNGILTYSIMFAATQS-----PAHWENPENISA
A0A142HWQ5_9SPHI      PEFYRFCKGNILMTSK-QGINLVLNPCNGGVMSYGITFSNLDVGLN--CFDFRDSVSTIK
A0A448AZQ1_9FLAO      PNFKNICADDKIIAKD-DRIFFLSQPKTNGELYYYVCFRQPESWLKSHNLNLNDNQQIAA
A0A0P0NHL0_9SPHI      AVINTMTNKGNLMALA-EEKMIFVQTRRNGSLNYYISFRQPENWLENTGLDLKNLPEMAA
A0A2S1YNA9_9FLAO      PNLFEFSKGGKVLAFG-NEQTLMYGSKGDGSLMFLLSSKIPERWILEGNLDFKNKEAVFE
                                           .         :                            

A0A0D4C0N3_9MICC      ALAGFFEGWDSQLLELILRSDGD-VTPRPIYALPIGHSWQATA--GVTLLGDAAHLMSPF
D9VFG6_9ACTN          ALKKLYAGWPEEFLGLVDATSGP-MLVYPLNALPVGLRWDHRP--GVTLIGDAAHLMSPF
A0A379C170_9NOCA      FLLREFSQWSALMRPLITDNDGD-YIPRSFWALPAPLTWNHVP--GVTLIGDAAHLMAPF
G8S5F7_ACTS5          RLLAEFADWSPRMLQMVTENDGV-YVDRPIFALPVPHTWDPHP--SVTLLGDAAHVMPPL
A0A1P8TAM4_9ACTN      ALLAGFNGWSPDLLGYITATDSG-YTNRPLYALPVPHSWPHTP--GVTLLGDAAHLMSPF
A0A285HNS3_9ACTN      ------DGWAPELLAFITDSDTAPVHRPHYALPPEGLRWGHRP--GVTLIGDAAHLAAPD
R4LFF5_9ACTN          IADQLGDGWAPELTELITGGDTDPVVRPIWGLPL-GHTWDRRR--GVMLVGDAAHLTPPD
A0A3Q9KPU0_STRGD      RLHGLFADWDPGLTGLIDACDAGSLVGRNIEALPVGTRWPSRP--DVTLLGDAAHLMPPV
A0A126YCA6_9ACTN      RLLERYEGWAPPVLDLLRHGTA--FVHRPLYALPVDHAWPHVP--GVTLLGDAAHLMPPL
A0A143GH32_9PSED      SLLAQFEGWHPDILALLHASNER-FLSRAIYALPVGHHWAHRP--GLTLIGDAAHLMSPF
A0A381KS22_BACCE      ELLEYFDDWSGDLKKYILCANGE-IIPRRIYMLPVHHRWENRF--GVTLIGDAAHLMSPF
A0A455SKA8_9CHLR      QLLALFEGWNPALQELIRVSNDK-ITTRPLYMLPTGLTWPGRP--GVTLLGDAAHLMPPF
W7TBL7_9PSEU          ELDRELADWSPRMRGVLDEVEAP-FVWWPLYVMPARQSWREHS--GVTLIGDAAHVMPPY
A0A2L2NWN6_9NOSO      FVTAAYHDWSPNLITMMTQVEGS-FERWPLYVMPPDHRWTTQP--GLTMVGDASHVMPPF
A5V686_SPHWW          KLLAHYAGWSPEMLQMLTASDDQ-FVLRPIYTHEPTQHWTPQP--DVTLTGDAAHVMPPF
A0A1H4K8Z2_9BACT      WFRANFDGWSEIWEPLFREAVST--VWRPLLVCPKEQHWEPKP--NVTLIGDAAHVMPPY
TETX_BACFG            FLLKEFSDWDERYKELIHTTL--SFVGLATRIFPLEKPWKSKRPLPITMIGDAAHLMPPF
TETX_SPHSM            FLLKEFSDWDERYKELIHTTL--SFVGLATRIFPLEKPWKSKRPLPITMIGDAAHLMPPF
TETX_BACT4            FLLKEFSDWDERYKELIHTTL--SFVGLATRIFPLEKPWKSKRPLPITMIGDAAHLMPPF
A0A249T051_9BACT      FLLEKFADWDDVFKALIHATS--SFWGLPTKQIPLDKPWIHKRPLPITLIGDAAHLMGPF
A5FG16_FLAJ1          FISERFKDWDAVYKQLFQAAS--FFTGLPTKKISVEE-WKNNRPLPITLIGDAAHLMPPF
A0A1H6QIR0_9BACT      YLSARFVGWDRRYHQLFNATS--FFVGLPTRKLLLDKPWNSNRPLPITLIGDAAHLMPPF
A0A1I1HV84_9BACT      FLAQKLGHWGSIFQELFGATS--AFWALPTRKLPLAQAWKNNRPIPLTLIGDAAHLMPPF
A0A142HWQ5_9SPHI      FLMTMFTNWDEVYKGLFRATT--SFAGLPSRLLPLDRPWKTDRLLPVTLIGDAAHIMPPF
A0A448AZQ1_9FLAO      FLSSLCYEWDGAYKELFAATS--EFTLLPMYQVPLENWHNHSH---ITLMGDAAHGMPPY
A0A0P0NHL0_9SPHI      YLHDVFRNWHPAYHQLFKASN--EYQVLPMYTLPVEKAWDRFE--PIALVGDAAHLMPPF
A0A2S1YNA9_9FLAO      WFKKVYKDWNLQWDELFTANEL-HFIPRPQYYFPVNQFWKTQN--NVTMIGDAAHRMPPF
                              *       .                             : : ***:*   * 

A0A0D4C0N3_9MICC      AGEGANLAMQDGAELALALLAQP-EDANAAVASYETAMFPRAEAAAAE-------SAANL
D9VFG6_9ACTN          AGQGANLAMRDGAELALTLAQ------GGDVRKFEQAMFERAEPAARM-------SADNL
A0A379C170_9NOCA      GGHGTNLALLDGAELAHAIAK-Q-NDLDDAIAHYETTMFPRSGELAVS-------SNTAL
G8S5F7_ACTS5          G-VGVNLAMLDASELALALAS-S-PTVDEALRHYEATMLPRSTECAKL-------LENGA
A0A1P8TAM4_9ACTN      SGMGANLAMLDGADLARALIE-H-PTVDQAISSYEKAALPRSAEAAEG-------AAEGI
A0A285HNS3_9ACTN      G-EGANLAMQDAAELGAALAAHG-GD---GLTSYEETLFPRSAEHAV-------------
R4LFF5_9ACTN          G-DGANWALFDGAELGTLIAENP-DDIDAAFDAFAERMLPRSAESSEEGYQSFERTFGYN
A0A3Q9KPU0_STRGD      G-EGANQAMLDGVLLARAIAGSG-DDLGAAVAAYESEMFDRAASIGAE-------SARLE
A0A126YCA6_9ACTN      G-AGANLAMLEGAELGEALAAAP-AGLDEAVRAHEQRMWPRARRWAEL-------TTTGL
A0A143GH32_9PSED      GGEGVNAAMLDAAELARHLIE-N-STCSEAVRAYETQMFDRIEPIARD-------SAEAA
A0A381KS22_BACCE      AGAGANLAMLDGAELALSIIN-H-SNLNDAIKIYEDKMFAYAGEMAAI-------TQVNL
A0A455SKA8_9CHLR      AGQGVNGAMKDALELTEALVQ-H-TTLDKALHAYEQAMFERARKAALL-------TAEGL
W7TBL7_9PSEU          SGQGVNMGLLDALELDGALSEHP--DVDAAVAAYEKSMLARMEPIIGA-------TTAYE
A0A2L2NWN6_9NOSO      TGKGVNLALLDALELADSLMVDPAASVTAAVETFETRMQERTQQEISE-------CLDRG
A5V686_SPHWW          TGKGVNLAMQDALELADALTGGEHADVASALRAYESGMLARMEKEIRL-------VLHDQ
A0A1H4K8Z2_9BACT      AGEGVNMAMLDALVLSKLLLTDD--TPAAAIAAYEAEMFARMREMTAD-------TMVNT
TETX_BACFG            AGQGVNSGLVDALILSDNLADGKFNSIEEAVKNYEQQMFMYGKEAQEE-------STQNE
TETX_SPHSM            AGQGVNSGLVDALILSDNLADGKFNSIEEAVKNYEQQMFMYGKEAQEE-------STQNE
TETX_BACT4            AGQGVNSGLVDALILSDNLADGKFNSIEEAVKNYEQQMFIYGKEAQEE-------STQNE
A0A249T051_9BACT      AGQGVNTGLLDALTLADNLTQGKFETIGQAIEDYEQKMFVYASAAQRD-------SCRNE
A5FG16_FLAJ1          AGQGANIGLLDALILSENLTNRDFKTIEEAVFDYEQQMQLYARKAQEE-------TRINE
A0A1H6QIR0_9BACT      AGKGVNTGLIDACVLAENLTSRDYKTPQAAIENYEQRMFDYASEAQRA-------SSENE
A0A1I1HV84_9BACT      AGQGVNTGLMDAVLLTENLSNGQFETIETAIAHYEQQMFVYASQAQEA-------SAHNE
A0A142HWQ5_9SPHI      AGQGVNTGMMDALILSRNLVDTNFGTLGAAISDYEQKMFIYAKAAQAE-------TSKNE
A0A448AZQ1_9FLAO      AGVGVNTGLLDALHLAENLTNREFESIQAAIDDYERQMFAYASEAQQQ-------TASNE
A0A0P0NHL0_9SPHI      AGVGVNIGLLDALNLVNNLTSEKFPTIAAAIQDYASKMFIYAAAAQAD-------TLEAE
A0A2S1YNA9_9FLAO      AGKGANLALFDALELADFLTSNQFNDLKTAISAFERRMLERASKATKE-------TLENS
                         *.* .: :.  *   :           .  .                          

A0A0D4C0N3_9MICC      KLFYNDEA---------PYSIISKFQNPSTTVA-------
D9VFG6_9ACTN          ELFLSDGA---------AEKVRRLFAKMSGEES-------
A0A379C170_9NOCA      TRFFATTSPDTPHLPPDHAQEHKNYQARAAEYRRRQPNS-
G8S5F7_ACTS5          EQLLATDL---------HDFDEERLQS-------------
A0A1P8TAM4_9ACTN      AGAFAPDS---------AAQALAHMTGHH-----------
A0A285HNS3_9ACTN      AAAYKPTR----------EDMIEFFAV-------------
R4LFF5_9ACTN          APVNLRNM----------MDGAKTYGREHHE---------
A0A3Q9KPU0_STRGD      SMGLAPDA----------AERMAAFFG-------------
A0A126YCA6_9ACTN      NRLVGPDP----------AEAIALFDEVQPE---------
A0A143GH32_9PSED      ATQLSHDD---------IALSLAHFRSHSAQD--------
A0A381KS22_BACCE      DMFFSDRA---------DEKLKEVFRDIQH----------
A0A455SKA8_9CHLR      EMLHGDDA---------VSTTVAYFRQFIAE---------
W7TBL7_9PSEU          NLVLNPDG---------PQALLDLARTGGR----------
A0A2L2NWN6_9NOSO      REIYGID--------------IHFDRQPSA----------
A5V686_SPHWW          DIFVSPIA---------PQGVIELFEARLRGEG-------
A0A1H4K8Z2_9BACT      EMFYAPDA---------CDRVVSLFRSFGGTESVPPLSEA
TETX_BACFG            IEMFKPDFTF--------QQLLNV----------------
TETX_SPHSM            IEMFKPDFTF--------QQLLNV----------------
TETX_BACT4            IEMFKPDFTF--------QQLLNV----------------
A0A249T051_9BACT      LEVLSPGFSI--------QQLLQKFIRKS-----------
A5FG16_FLAJ1          IKMLKRDFTF--------LKFAN-----------------
A0A1H6QIR0_9BACT      LEIRRPDFTY--------ERFIR-----------------
A0A1I1HV84_9BACT      IQIRQPDFSF--------IQIIQ-----------------
A0A142HWQ5_9SPHI      IEMHQPTFSF--------RQRFSN----------------
A0A448AZQ1_9FLAO      AALFPKE---------------------------------
A0A0P0NHL0_9SPHI      TGIHHSDAIN--------QNKPTGRNKEY-----------
A0A2S1YNA9_9FLAO      EQLHAEEALE--------RLVLIFQKNIQN----------